Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_33.154611961828321e-115
YJR014W1981836496e-87
Sklu_1575.21911806426e-86
Scas_647.81971836365e-85
ACL112C1991816183e-82
KLLA0F21934g2001816044e-80
CAGL0B03927g1961815965e-79
Scas_706.1510862868e-04
YNL244C (SUI1)10862800.005
CAGL0J07678g10862800.006
KLLA0C03091g10887760.022
AER457W10862740.038
ADL395C10862740.038
Sklu_2432.820262730.13
AFR642C10862680.23
YGR203W14827670.57
CAGL0B01837g56991680.75
CAGL0I02222g151257616.0
KLLA0E19877g56760606.7
YER086W (ILV1)57654606.8
Sklu_1842.356254607.6
CAGL0I05126g57153598.7
Scas_500.256953599.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.15461
         (194 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.15461                                                         325   e-115
YJR014W (YJR014W) [2917] chr10 (461743..462339) Protein with sim...   254   6e-87
Sklu_1575.2 YJR014W, Contig c1575 2478-3053 reverse complement        251   6e-86
Scas_647.8                                                            249   5e-85
ACL112C [937] [Homologous to ScYJR014W - SH] (148437..149036) [6...   242   3e-82
KLLA0F21934g 2039116..2039718 similar to sp|P47089 Saccharomyces...   237   4e-80
CAGL0B03927g 386875..387465 highly similar to sp|P47089 Saccharo...   234   5e-79
Scas_706.15                                                            38   8e-04
YNL244C (SUI1) [4363] chr14 complement(187169..187495) Subunit (...    35   0.005
CAGL0J07678g 750008..750334 highly similar to sp|P32911 Saccharo...    35   0.006
KLLA0C03091g complement(276491..276817) highly similar to sp|P32...    34   0.022
AER457W [2957] [Homologous to ScYNL244C (SUI1) - SH] complement(...    33   0.038
ADL395C [1346] [Homologous to ScYNL244C (SUI1) - SH] (17676..180...    33   0.038
Sklu_2432.8 YNL244C, Contig c2432 18118-18726                          33   0.13 
AFR642C [3834] [Homologous to ScYNL244C (SUI1) - SH] (1607516..1...    31   0.23 
YGR203W (YGR203W) [2153] chr7 (905240..905686) Protein with simi...    30   0.57 
CAGL0B01837g complement(166953..168662) similar to tr|Q04600 Sac...    31   0.75 
CAGL0I02222g complement(190099..194637) similar to sp|P38859 Sac...    28   6.0  
KLLA0E19877g complement(1760800..1762503) highly similar to sp|P...    28   6.7  
YER086W (ILV1) [1517] chr5 (328473..330203) Serine and threonine...    28   6.8  
Sklu_1842.3 YER086W, Contig c1842 3436-5124 reverse complement         28   7.6  
CAGL0I05126g complement(481145..482860) highly similar to sp|P00...    27   8.7  
Scas_500.2                                                             27   9.8  

>Kwal_33.15461
          Length = 196

 Score =  325 bits (832), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 163/182 (89%), Positives = 163/182 (89%)

Query: 1   MSLRKVIYCGVCSFPPDFCEFTGKLKRCKVWLSENHSEKYQALYGDQEVEEAAANLAGSS 60
           MSLRKVIYCGVCSFPPDFCEFTGKLKRCKVWLSENHSEKYQALYGDQEVEEAAANLAGSS
Sbjct: 1   MSLRKVIYCGVCSFPPDFCEFTGKLKRCKVWLSENHSEKYQALYGDQEVEEAAANLAGSS 60

Query: 61  IGXXXXXXXXXXXXXXXXXXXNREQRELAKKLSSKVIIKREARTKRKTMVAISGLEVFEI 120
           IG                   NREQRELAKKLSSKVIIKREARTKRKTMVAISGLEVFEI
Sbjct: 61  IGEEREEKLEKDLLKLQSKQENREQRELAKKLSSKVIIKREARTKRKTMVAISGLEVFEI 120

Query: 121 DMKKLAKTFASKFATGCSVSKNVEKKEEIIIQGDVADEAEAYIQKLLEEKGLKDIKVEQM 180
           DMKKLAKTFASKFATGCSVSKNVEKKEEIIIQGDVADEAEAYIQKLLEEKGLKDIKVEQM
Sbjct: 121 DMKKLAKTFASKFATGCSVSKNVEKKEEIIIQGDVADEAEAYIQKLLEEKGLKDIKVEQM 180

Query: 181 DM 182
           DM
Sbjct: 181 DM 182

>YJR014W (YJR014W) [2917] chr10 (461743..462339) Protein with
           similarity to human DENR/DRP density-regulated protein
           [597 bp, 198 aa]
          Length = 198

 Score =  254 bits (649), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 142/183 (77%), Gaps = 4/183 (2%)

Query: 3   LRKVIYCGVCSFPPDFCEFTGKLKRCKVWLSENHSEKYQALYGD----QEVEEAAANLAG 58
           LR+VIYCG+CS+PP++CEF+GKLKRCKVWLSENH++ Y  LYG     QEVE     LA 
Sbjct: 2   LREVIYCGICSYPPEYCEFSGKLKRCKVWLSENHADLYAKLYGTDDNTQEVEAVTNKLAE 61

Query: 59  SSIGXXXXXXXXXXXXXXXXXXXNREQRELAKKLSSKVIIKREARTKRKTMVAISGLEVF 118
           SSIG                   NREQRELAKKLSSKVIIKREARTKRK +VAISGLEVF
Sbjct: 62  SSIGEAREEKLEKDLLKIQKKQENREQRELAKKLSSKVIIKREARTKRKFIVAISGLEVF 121

Query: 119 EIDMKKLAKTFASKFATGCSVSKNVEKKEEIIIQGDVADEAEAYIQKLLEEKGLKDIKVE 178
           +IDMKKLAKTFAS+FATGCSVSKN EKKEE++IQGDV DE E YI  LLEEKGLKD+KVE
Sbjct: 122 DIDMKKLAKTFASRFATGCSVSKNAEKKEEVVIQGDVMDEVETYIHSLLEEKGLKDVKVE 181

Query: 179 QMD 181
            +D
Sbjct: 182 TID 184

>Sklu_1575.2 YJR014W, Contig c1575 2478-3053 reverse complement
          Length = 191

 Score =  251 bits (642), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 124/180 (68%), Positives = 140/180 (77%), Gaps = 1/180 (0%)

Query: 3   LRKVIYCGVCSFPPDFCEFTGKLKRCKVWLSENHSEKYQALY-GDQEVEEAAANLAGSSI 61
           L+ V+YCGVCS PP++CEFTGKLKRCKVWL ENH++ +  LY  D EV++ A  L  SSI
Sbjct: 2   LKTVVYCGVCSLPPEYCEFTGKLKRCKVWLKENHADLFNQLYPADCEVDDVATKLGNSSI 61

Query: 62  GXXXXXXXXXXXXXXXXXXXNREQRELAKKLSSKVIIKREARTKRKTMVAISGLEVFEID 121
           G                   +REQRELAKKLSSKV+IKREARTKRK M+AISGLEVFEID
Sbjct: 62  GGAREEKLEKDLLRLQAKQESREQRELAKKLSSKVVIKREARTKRKCMIAISGLEVFEID 121

Query: 122 MKKLAKTFASKFATGCSVSKNVEKKEEIIIQGDVADEAEAYIQKLLEEKGLKDIKVEQMD 181
           MKKLAKTFASKFATGCSVSKN EKKEEI++QGDVADE EAYI  LLEEKGLK +KVE +D
Sbjct: 122 MKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLLEEKGLKQVKVEHID 181

>Scas_647.8
          Length = 197

 Score =  249 bits (636), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 141/183 (77%), Gaps = 2/183 (1%)

Query: 1   MSLRKVIYCGVCSFPPDFCEFTGKLKRCKVWLSENHSEKYQALYGDQ--EVEEAAANLAG 58
           M L++V+YCGVCS+PP++CEFTGKLKRCKVWL ENH + +  LYGD   +V   A  LA 
Sbjct: 1   MPLQEVVYCGVCSYPPEYCEFTGKLKRCKVWLKENHPDLFTKLYGDDNGDVAAVAGKLAE 60

Query: 59  SSIGXXXXXXXXXXXXXXXXXXXNREQRELAKKLSSKVIIKREARTKRKTMVAISGLEVF 118
           SSIG                   NREQRELAKKLSSKVIIKREARTKRK ++AISGLEVF
Sbjct: 61  SSIGEEREEKLEKDLLKLQTKQENREQRELAKKLSSKVIIKREARTKRKFIIAISGLEVF 120

Query: 119 EIDMKKLAKTFASKFATGCSVSKNVEKKEEIIIQGDVADEAEAYIQKLLEEKGLKDIKVE 178
           EIDMKKLAKTFASKFATGCSVSKN EKKEEI+IQGDV +  EAYI  LL+EKGLKD+KVE
Sbjct: 121 EIDMKKLAKTFASKFATGCSVSKNAEKKEEIVIQGDVLEAVEAYIHSLLKEKGLKDVKVE 180

Query: 179 QMD 181
            +D
Sbjct: 181 TID 183

>ACL112C [937] [Homologous to ScYJR014W - SH] (148437..149036) [600
           bp, 199 aa]
          Length = 199

 Score =  242 bits (618), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 142/181 (78%), Gaps = 2/181 (1%)

Query: 3   LRKVIYCGVCSFPPDFCEFTGKLKRCKVWLSENHSEKYQALYGD--QEVEEAAANLAGSS 60
           L+KV+YCGVCS PP++CEFTGK++RCKVWL E+  E +  LYGD  ++V+  AA L  SS
Sbjct: 2   LKKVVYCGVCSLPPEYCEFTGKIRRCKVWLHEHDQELFAQLYGDDKEDVDGVAARLGQSS 61

Query: 61  IGXXXXXXXXXXXXXXXXXXXNREQRELAKKLSSKVIIKREARTKRKTMVAISGLEVFEI 120
           IG                   ++EQRELA+KLSS+V+I+REARTKRK MV ++GLEVFEI
Sbjct: 62  IGEEREEQLEKKLQKLQAREESKEQRELARKLSSRVVIRREARTKRKCMVVVAGLEVFEI 121

Query: 121 DMKKLAKTFASKFATGCSVSKNVEKKEEIIIQGDVADEAEAYIQKLLEEKGLKDIKVEQM 180
           DMKKLAKTFASKFATGCSVSKNVEKKEE+++QGD+ADE EAYI  LLEEKG+K +KVEQ+
Sbjct: 122 DMKKLAKTFASKFATGCSVSKNVEKKEEVVVQGDIADEVEAYIHALLEEKGMKGVKVEQI 181

Query: 181 D 181
           D
Sbjct: 182 D 182

>KLLA0F21934g 2039116..2039718 similar to sp|P47089 Saccharomyces
           cerevisiae YJR014w singleton, start by similarity
          Length = 200

 Score =  237 bits (604), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 117/181 (64%), Positives = 135/181 (74%), Gaps = 1/181 (0%)

Query: 1   MSLRKVIYCGVCSFPPDFCEFTGKLKRCKVWLSENHSEKYQALYGDQEVEEAAANLAGSS 60
           M L  VIYCGVC FP ++CEF+GK KRCK WL ENH E Y   YGD   E+ +  LA SS
Sbjct: 1   MPLTNVIYCGVCDFPAEYCEFSGKFKRCKAWLQENHPELYTKWYGDV-TEDVSKQLAESS 59

Query: 61  IGXXXXXXXXXXXXXXXXXXXNREQRELAKKLSSKVIIKREARTKRKTMVAISGLEVFEI 120
           IG                    RE+RELAKKLSSKV+I+REARTKRK M+AISGLEVFEI
Sbjct: 60  IGDEREEKLEKALEKLERKQQAREERELAKKLSSKVVIRREARTKRKCMIAISGLEVFEI 119

Query: 121 DMKKLAKTFASKFATGCSVSKNVEKKEEIIIQGDVADEAEAYIQKLLEEKGLKDIKVEQM 180
           DMKKL+KTFASKFATGCS+SKN EKKEE+I+QGD+ADE EAYI  LLEEKG+K++KVE +
Sbjct: 120 DMKKLSKTFASKFATGCSISKNAEKKEEVIVQGDLADEVEAYIHSLLEEKGMKEVKVEVI 179

Query: 181 D 181
           D
Sbjct: 180 D 180

>CAGL0B03927g 386875..387465 highly similar to sp|P47089
           Saccharomyces cerevisiae YJR014w, start by similarity
          Length = 196

 Score =  234 bits (596), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 119/181 (65%), Positives = 138/181 (76%), Gaps = 2/181 (1%)

Query: 3   LRKVIYCGVCSFPPDFCEFTGKLKRCKVWLSENHSEKYQALYG--DQEVEEAAANLAGSS 60
           L++V+YCGVC++P D+CEF+GKLKRCKVWL ENH++ Y  LY   D      +A LA SS
Sbjct: 2   LKEVVYCGVCTYPIDYCEFSGKLKRCKVWLKENHADLYDKLYSEDDAAAASLSAKLAESS 61

Query: 61  IGXXXXXXXXXXXXXXXXXXXNREQRELAKKLSSKVIIKREARTKRKTMVAISGLEVFEI 120
           IG                   N+EQRELAKKLSSKVI+KREARTKRK +VAISGLEVFEI
Sbjct: 62  IGEAREEKLEKDLQKLQTKQENKEQRELAKKLSSKVIVKREARTKRKYIVAISGLEVFEI 121

Query: 121 DMKKLAKTFASKFATGCSVSKNVEKKEEIIIQGDVADEAEAYIQKLLEEKGLKDIKVEQM 180
           DMKKLAKTFASKFATGCSVSKN EKKEE+++QGDV DE  AYI  LLEEKG+KD+KVE +
Sbjct: 122 DMKKLAKTFASKFATGCSVSKNAEKKEEVVVQGDVLDEVVAYIHSLLEEKGMKDVKVETI 181

Query: 181 D 181
           D
Sbjct: 182 D 182

>Scas_706.15
          Length = 108

 Score = 37.7 bits (86), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 93  SSKVIIKREARTKRKTMVAISGLEVFEIDMKKLAKTFASKFATGCSVSKNVEKKEEIIIQ 152
           ++ + I+ + R  RKT+  + G+   E D+K++ K     FA   ++ K+VE  E I +Q
Sbjct: 23  ANYIHIRIQQRNGRKTLTTVQGVPA-EYDLKRILKVLKKDFACNGNIVKDVEMGEIIQLQ 81

Query: 153 GD 154
           GD
Sbjct: 82  GD 83

>YNL244C (SUI1) [4363] chr14 complement(187169..187495) Subunit (16
           kDa) of translation initiation factor eIF3, involved in
           initiation and in monitoring translational accuracy
           during elongation [327 bp, 108 aa]
          Length = 108

 Score = 35.4 bits (80), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 93  SSKVIIKREARTKRKTMVAISGLEVFEIDMKKLAKTFASKFATGCSVSKNVEKKEEIIIQ 152
           S+ + I+ + R  RKT+  + G+   E D+K++ K     FA   ++ K+ E  E I +Q
Sbjct: 23  SNYIHIRIQQRNGRKTLTTVQGVPE-EYDLKRILKVLKKDFACNGNIVKDPEMGEIIQLQ 81

Query: 153 GD 154
           GD
Sbjct: 82  GD 83

>CAGL0J07678g 750008..750334 highly similar to sp|P32911
           Saccharomyces cerevisiae YNL244c SUI1 translation
           initiation factor 3, start by similarity
          Length = 108

 Score = 35.4 bits (80), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 93  SSKVIIKREARTKRKTMVAISGLEVFEIDMKKLAKTFASKFATGCSVSKNVEKKEEIIIQ 152
           S+ + I+ + R  RKT+  + G+   E D K++ K     FA   ++ K+ E  E I +Q
Sbjct: 23  SNYIHIRIQQRNGRKTLTTVQGVPA-EYDQKRILKVLKKDFACNGNIVKDSEMGEIIQLQ 81

Query: 153 GD 154
           GD
Sbjct: 82  GD 83

>KLLA0C03091g complement(276491..276817) highly similar to sp|P32911
           Saccharomyces cerevisiae YNL244c SUI1 translation
           initiation factor 3 (eIF3) singleton, start by
           similarity
          Length = 108

 Score = 33.9 bits (76), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 47/87 (54%), Gaps = 4/87 (4%)

Query: 93  SSKVIIKREARTKRKTMVAISGLEVFEIDMKKLAKTFASKFATGCSVSKNVEKKEEIIIQ 152
           ++ + I+ + R  RKT+  + G+   E D+K++ K     FA   ++ K+ E  E I +Q
Sbjct: 23  ANYIHIRIQQRNGRKTLTTVQGVPE-EYDLKRILKVLKKDFACNGNIVKDEEMGEVIQLQ 81

Query: 153 GDV-ADEAEAYIQKLLEEKGLKDIKVE 178
           GD  A  +E  I +L  +K  K+IK+ 
Sbjct: 82  GDQRAKVSEFMITQLGMQK--KNIKIH 106

>AER457W [2957] [Homologous to ScYNL244C (SUI1) - SH]
           complement(1512587..1512913) [327 bp, 108 aa]
          Length = 108

 Score = 33.1 bits (74), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 93  SSKVIIKREARTKRKTMVAISGLEVFEIDMKKLAKTFASKFATGCSVSKNVEKKEEIIIQ 152
           S+ + I+ + R  RKT+  + G+   E D+K++ K     F    ++ K+ E  E I +Q
Sbjct: 23  SNYIHIRIQQRNGRKTLTTVQGIPE-EYDLKRILKVLRKDFGCNGNMVKDDEMGEIIQLQ 81

Query: 153 GD 154
           GD
Sbjct: 82  GD 83

>ADL395C [1346] [Homologous to ScYNL244C (SUI1) - SH] (17676..18002)
           [327 bp, 108 aa]
          Length = 108

 Score = 33.1 bits (74), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 93  SSKVIIKREARTKRKTMVAISGLEVFEIDMKKLAKTFASKFATGCSVSKNVEKKEEIIIQ 152
           S+ + I+ + R  RKT+  + G+   E D+K++ K     F    ++ K+ E  E I +Q
Sbjct: 23  SNYIHIRIQQRNGRKTLTTVQGIPE-EYDLKRILKVLRKDFGCNGNMVKDDEMGEIIQLQ 81

Query: 153 GD 154
           GD
Sbjct: 82  GD 83

>Sklu_2432.8 YNL244C, Contig c2432 18118-18726
          Length = 202

 Score = 32.7 bits (73), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 93  SSKVIIKREARTKRKTMVAISGLEVFEIDMKKLAKTFASKFATGCSVSKNVEKKEEIIIQ 152
           ++ + I+ + R  RKT+  + G+   E D+K++ K     FA   ++ K+ E  + I +Q
Sbjct: 117 TNYIHIRIQQRNGRKTLTTVQGVPE-EYDLKRILKVLKKDFACNGNIVKDEEMGQIIQMQ 175

Query: 153 GD 154
           GD
Sbjct: 176 GD 177

>AFR642C [3834] [Homologous to ScYNL244C (SUI1) - SH]
           (1607516..1607842) [327 bp, 108 aa]
          Length = 108

 Score = 30.8 bits (68), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 93  SSKVIIKREARTKRKTMVAISGLEVFEIDMKKLAKTFASKFATGCSVSKNVEKKEEIIIQ 152
           S+ + I+ + R  RKT+  + G+   + D+K++ K     F    ++ K+ E  E I +Q
Sbjct: 23  SNYIHIRIQQRNGRKTLTTVQGITK-KYDLKRILKVLRKDFGCNGNMVKDDEMGEIIQLQ 81

Query: 153 GD 154
           GD
Sbjct: 82  GD 83

>YGR203W (YGR203W) [2153] chr7 (905240..905686) Protein with
           similarity to arsenate reductase Arr2p [447 bp, 148 aa]
          Length = 148

 Score = 30.4 bits (67), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 18/27 (66%)

Query: 22  TGKLKRCKVWLSENHSEKYQALYGDQE 48
           T +L RC++W+      ++Q++YGD E
Sbjct: 110 TAELSRCRLWVLRGGFSRWQSVYGDDE 136

>CAGL0B01837g complement(166953..168662) similar to tr|Q04600
           Saccharomyces cerevisiae YDR117c, start by similarity
          Length = 569

 Score = 30.8 bits (68), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 40/91 (43%), Gaps = 7/91 (7%)

Query: 83  REQRELAKKL----SSKVIIKREARTKRKTMVAISGLEVFEIDMKKLAKTFASKFATGCS 138
            EQ  L K        K+ I  E +  RK +  +S  EVF+ID ++ A     K +   +
Sbjct: 459 NEQTPLTKTPLKGEPPKINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCSGSTT 518

Query: 139 V---SKNVEKKEEIIIQGDVADEAEAYIQKL 166
           +   + + +K  E+ +QG       +Y+  L
Sbjct: 519 IGETTSSAKKTAEVQVQGPHGQLIMSYLNDL 549

>CAGL0I02222g complement(190099..194637) similar to sp|P38859
           Saccharomyces cerevisiae YHR164c DNA2 DNA helicase,
           hypothetical start
          Length = 1512

 Score = 28.1 bits (61), Expect = 6.0,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 26/57 (45%)

Query: 124 KLAKTFASKFATGCSVSKNVEKKEEIIIQGDVADEAEAYIQKLLEEKGLKDIKVEQM 180
           +  K + SK + GC V  +  ++ E I   DV D  E  +  +   KG  D  VE +
Sbjct: 601 EFVKKYVSKSSYGCYVPVSGTRRTEPISISDVIDIEENIVSPMYGFKGFLDASVEAL 657

>KLLA0E19877g complement(1760800..1762503) highly similar to
           sp|P00927 Saccharomyces cerevisiae YER086w ILV1 anabolic
           serine and threonine dehydratase precursor, start by
           similarity
          Length = 567

 Score = 27.7 bits (60), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 1/60 (1%)

Query: 118 FEIDMKKLAKTFASKFATGCSVSKNVEK-KEEIIIQGDVADEAEAYIQKLLEEKGLKDIK 176
           F  +   +  T     +T     +NV +   ++++ GD  DEA+    +L EE+G+ DI 
Sbjct: 134 FSSNHMNIPATIVMPVSTPSIKYQNVSRLGAQVVLYGDDFDEAKLECARLAEERGMTDIP 193

>YER086W (ILV1) [1517] chr5 (328473..330203) Serine and threonine
           dehydratase (anabolic), catalyzes the first step in the
           isoleucine biosynthesis pathway, the conversion of
           threonine to alpha-ketobutyrate [1731 bp, 576 aa]
          Length = 576

 Score = 27.7 bits (60), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 124 KLAKTFASKFATGCSVSKNVEK-KEEIIIQGDVADEAEAYIQKLLEEKGLKDIK 176
           K+  T      T     +NV +   ++++ G+  DEA+A   KL EE+GL +I 
Sbjct: 149 KIPATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEERGLTNIP 202

>Sklu_1842.3 YER086W, Contig c1842 3436-5124 reverse complement
          Length = 562

 Score = 27.7 bits (60), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 124 KLAKTFASKFATGCSVSKNVEK-KEEIIIQGDVADEAEAYIQKLLEEKGLKDIK 176
            +  T     +T     +NV +   ++++ G+  DEA+A   KL EE+GL +I 
Sbjct: 135 NIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLTEERGLTNIP 188

>CAGL0I05126g complement(481145..482860) highly similar to sp|P00927
           Saccharomyces cerevisiae YER086w ILV1 anabolic serine
           and threonine dehydratase precursor, hypothetical start
          Length = 571

 Score = 27.3 bits (59), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 125 LAKTFASKFATGCSVSKNVEK-KEEIIIQGDVADEAEAYIQKLLEEKGLKDIK 176
           +  T     +T     +NV +   ++++ G+  DEA+A   KL EE+GL +I 
Sbjct: 145 IPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEERGLTNIP 197

>Scas_500.2
          Length = 569

 Score = 27.3 bits (59), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 125 LAKTFASKFATGCSVSKNVEK-KEEIIIQGDVADEAEAYIQKLLEEKGLKDIK 176
           +  T     +T     +NV +   ++++ G+  DEA+A   KL EE+GL +I 
Sbjct: 143 IPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEERGLTNIP 195

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.130    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,706,557
Number of extensions: 160531
Number of successful extensions: 616
Number of sequences better than 10.0: 31
Number of HSP's gapped: 608
Number of HSP's successfully gapped: 31
Length of query: 194
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 98
Effective length of database: 13,272,781
Effective search space: 1300732538
Effective search space used: 1300732538
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)