Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_33.1545591490144100.0
Scas_617.47913046889e-78
KLLA0D09603g8204806531e-72
CAGL0G09295g7673686491e-72
YGR196C (FYV8)8172856336e-70
ACR036C7542964718e-49
Kwal_0.2371547117703.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.15455
         (901 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.15455                                                        1703   0.0  
Scas_617.4                                                            269   9e-78
KLLA0D09603g 811234..813696 weakly similar to sp|P46949 Saccharo...   256   1e-72
CAGL0G09295g 887666..889969 similar to sp|P46949 Saccharomyces c...   254   1e-72
YGR196C (FYV8) [2146] chr7 complement(889736..892189) Protein of...   248   6e-70
ACR036C [1084] [Homologous to ScYGR196C (FYV8) - SH] (423030..42...   186   8e-49
Kwal_0.237                                                             32   3.5  

>Kwal_33.15455
          Length = 914

 Score = 1703 bits (4410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 844/901 (93%), Positives = 844/901 (93%)

Query: 1   MSVNMERKKSQRWVSVSKGTYDGKEWDSSEEDEPYGAWENDEGQSRKSPERNGTVSKLPP 60
           MSVNMERKKSQRWVSVSKGTYDGKEWDSSEEDEPYGAWENDEGQSRKSPERNGTVSKLPP
Sbjct: 1   MSVNMERKKSQRWVSVSKGTYDGKEWDSSEEDEPYGAWENDEGQSRKSPERNGTVSKLPP 60

Query: 61  LPMLSYGKDSRRSNEVERTETGADEASGSQLDSTSTGAGSPRLYQSSSGAARVNSQSSTG 120
           LPMLSYGKDSRRSNEVERTETGADEASGSQLDSTSTGAGSPRLYQSSSGAARVNSQSSTG
Sbjct: 61  LPMLSYGKDSRRSNEVERTETGADEASGSQLDSTSTGAGSPRLYQSSSGAARVNSQSSTG 120

Query: 121 RITRGPSQYKSENLDHLMTQLSQELTPVSISESRFSFNDDGLNSPRGSADRYRDSNGFSY 180
           RITRGPSQYKSENLDHLMTQLSQELTPVSISESRFSFNDDGLNSPRGSADRYRDSNGFSY
Sbjct: 121 RITRGPSQYKSENLDHLMTQLSQELTPVSISESRFSFNDDGLNSPRGSADRYRDSNGFSY 180

Query: 181 SESEEEPQVSKTGYFSNMMQSPDGADQSSEHSESEFFATPDPSNVPQATFGVTTQAERDA 240
           SESEEEPQVSKTGYFSNMMQSPDGADQSSEHSESEFFATPDPSNVPQATFGVTTQAERDA
Sbjct: 181 SESEEEPQVSKTGYFSNMMQSPDGADQSSEHSESEFFATPDPSNVPQATFGVTTQAERDA 240

Query: 241 GDTVSEDSRSETPKIQGEQLQRKLISPRASDYDLPQSRRSSIDSDKQTISAQEELAPVTA 300
           GDTVSEDSRSETPKIQGEQLQRKLISPRASDYDLPQSRRSSIDSDKQTISAQEELAPVTA
Sbjct: 241 GDTVSEDSRSETPKIQGEQLQRKLISPRASDYDLPQSRRSSIDSDKQTISAQEELAPVTA 300

Query: 301 LSTDDNTKETKSAVLSDSSAESQEILNSQETTNSQETTNSQETPNSQETPNSQETTNSQE 360
           LSTDDNTKETKSAVLSDSSAESQEILNSQETTNSQETTNSQETPNSQETPNSQETTNSQE
Sbjct: 301 LSTDDNTKETKSAVLSDSSAESQEILNSQETTNSQETTNSQETPNSQETPNSQETTNSQE 360

Query: 361 TTNSQETTNSQETTNSQETPSSQDSPSKNSTESTSQEQSLPNALEASRERSSIHEERDQV 420
           TTNSQETTNSQETTNSQETPSSQDSPSKNSTESTSQEQSLPNALEASRERSSIHEERDQV
Sbjct: 361 TTNSQETTNSQETTNSQETPSSQDSPSKNSTESTSQEQSLPNALEASRERSSIHEERDQV 420

Query: 421 INEPSESQRTPNAKTFPRVASSSDEYEDNESFFNQYGNNSSQSSPANRADRGEMSSPPKL 480
           INEPSESQRTPNAKTFPRVASSSDEYEDNESFFNQYGNNSSQSSPANRADRGEMSSPPKL
Sbjct: 421 INEPSESQRTPNAKTFPRVASSSDEYEDNESFFNQYGNNSSQSSPANRADRGEMSSPPKL 480

Query: 481 RQTTETKLXXXXXXXXXXXXTETDGTASNSEVFKFKXXXXXXXXXXXXXXXXXXXXXXXX 540
           RQTTETKL            TETDGTASNSEVFKFK                        
Sbjct: 481 RQTTETKLSQGDGDGSQSDQTETDGTASNSEVFKFKDRIRDSILESSDDDIDDDESVLRV 540

Query: 541 PKSGYYAQMVKETSGPXXXXXXXXXXXXXXXXXXXXXVCSITKSINYSSARPRSSIPPVS 600
           PKSGYYAQMVKETSGP                     VCSITKSINYSSARPRSSIPPVS
Sbjct: 541 PKSGYYAQMVKETSGPDESDDQQTVTDDDYTSSSGTDVCSITKSINYSSARPRSSIPPVS 600

Query: 601 QSSTEKQGEAPAESPSSDDDQNKVGLNSRQSVNLGKWQPDTDAGRAEFLGQAKPEVPEGY 660
           QSSTEKQGEAPAESPSSDDDQNKVGLNSRQSVNLGKWQPDTDAGRAEFLGQAKPEVPEGY
Sbjct: 601 QSSTEKQGEAPAESPSSDDDQNKVGLNSRQSVNLGKWQPDTDAGRAEFLGQAKPEVPEGY 660

Query: 661 VVDQDGQLVNVNPSSMRDARVVSTYSEAESAWNAFPASAGNGGDLDTIYDTKTIYDNQTI 720
           VVDQDGQLVNVNPSSMRDARVVSTYSEAESAWNAFPASAGNGGDLDTIYDTKTIYDNQTI
Sbjct: 661 VVDQDGQLVNVNPSSMRDARVVSTYSEAESAWNAFPASAGNGGDLDTIYDTKTIYDNQTI 720

Query: 721 HNVPGLATNNDSLPPLPRDITAVDSSLSANVTDSDSILNHLNGVKRHHYSNLKESFSVHT 780
           HNVPGLATNNDSLPPLPRDITAVDSSLSANVTDSDSILNHLNGVKRHHYSNLKESFSVHT
Sbjct: 721 HNVPGLATNNDSLPPLPRDITAVDSSLSANVTDSDSILNHLNGVKRHHYSNLKESFSVHT 780

Query: 781 PDQEEIALVKQKAVPTADLDALITRKNTTHAAKINDLNKHFNELKDYDSGLHTWISYALK 840
           PDQEEIALVKQKAVPTADLDALITRKNTTHAAKINDLNKHFNELKDYDSGLHTWISYALK
Sbjct: 781 PDQEEIALVKQKAVPTADLDALITRKNTTHAAKINDLNKHFNELKDYDSGLHTWISYALK 840

Query: 841 TSTSDKDYIFQNYKVSTHVKDAYSHADDLSKKMTVSNTVANVNQNVSHLKRKVFSHTMKE 900
           TSTSDKDYIFQNYKVSTHVKDAYSHADDLSKKMTVSNTVANVNQNVSHLKRKVFSHTMKE
Sbjct: 841 TSTSDKDYIFQNYKVSTHVKDAYSHADDLSKKMTVSNTVANVNQNVSHLKRKVFSHTMKE 900

Query: 901 K 901
           K
Sbjct: 901 K 901

>Scas_617.4
          Length = 791

 Score =  269 bits (688), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 147/304 (48%), Positives = 202/304 (66%), Gaps = 13/304 (4%)

Query: 603 STEKQGEAPAESPSSDDDQNKV---GLNSRQSVNLGKWQPDTDAGRAEFLGQAKPEVPEG 659
           ++EK+ +  +E+  S DDQ      G +SR S+NLG W+PDTDA R+ F+       P G
Sbjct: 477 TSEKEKDRESENSKSGDDQETTITEGDSSRDSINLGSWKPDTDAIRSGFVQDTNKRAPPG 536

Query: 660 YVVDQDGQLVNVNPSSMRDARVVSTYSEAESAWNAFPASAG--NGGDLDTIYDTKTIYDN 717
           +V D++G+LV++ PSSM+  RVVSTYSE ES W AFP++    N  DL+TI DTKT+YDN
Sbjct: 537 FVYDENGKLVDLTPSSMK-PRVVSTYSEMESTWAAFPSNGNPENNEDLETIKDTKTLYDN 595

Query: 718 QTIHNVPGLATNNDSLPPLPRDITAVDSSLSANVTDSDSILNHLNGVKRHHYSNLKESFS 777
            TI NVPG+ TNN++LPPLP+++     SL    T +         +K  H     E  S
Sbjct: 596 NTIFNVPGIMTNNENLPPLPKNVNIEQGSLPVARTLTAGSEVDKKSIKSIH----SEGPS 651

Query: 778 VHTPDQEEIA-LVKQKAVPTADLDALITRKNTTHAAKINDLNKHFNELKDYDSGLHTWIS 836
           VH PD  E+A L  Q  +P  DL+ LI+ K  +H +KI  L  +   L DYDSG+ TWI+
Sbjct: 652 VHKPDSYEMAKLSDQDPLPELDLNELISSK-ASHLSKIEQLQAYSQSLADYDSGIQTWIN 710

Query: 837 YALKTST-SDKDYIFQNYKVSTHVKDAYSHADDLSKKMTVSNTVANVNQNVSHLKRKVFS 895
           Y LK+S+ +D+DY+F  YK + HV++AY++A+DLS+K TV NTVA+VNQNVSHL++KVFS
Sbjct: 711 YTLKSSSKADRDYLFDEYKKNEHVREAYANAEDLSRKNTVINTVASVNQNVSHLRKKVFS 770

Query: 896 HTMK 899
           H+MK
Sbjct: 771 HSMK 774

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 78/258 (30%), Positives = 111/258 (43%), Gaps = 63/258 (24%)

Query: 2   SVNMERKKSQRWVSVSKGTYDGKEWDSSEEDEPYGAWENDEGQSRKSPERNGTVSKLPPL 61
           S N+ RKKS RW S S+ TYDG +W+SS+ DE + A  N+E Q          V+KLP L
Sbjct: 3   SENVGRKKSHRWASASQATYDGADWNSSDSDEDH-AISNEEAQP--------NVTKLPSL 53

Query: 62  PMLSYGKDSRRSNEVERTETGADEASGSQLDSTSTGAGSPRLYQSSSGAARVNSQSSTGR 121
           P L+Y      SNE        +E  G   D+       P   +       + ++  T R
Sbjct: 54  PKLNYT-----SNE--------EEEEGKLTDNAEENGKLPNSEEEERPTLHITTEDETDR 100

Query: 122 I------------TRGPSQYKSEN--LDHLMTQLSQELTPVSISESRFSFNDDGLNSPR- 166
                        TR  S  +  N  LD+LM Q+S+E+TP   +E  F   D   ++ R 
Sbjct: 101 SSSNNESKSSLNRTRRNSPMRGVNTDLDNLMLQISKEMTPKLENEPVFPPRDSPTSASRE 160

Query: 167 GSADRYRDSNGF----SYSESEEEP-------------QVSKTGYFSNMMQSPDGADQSS 209
           GS   Y  S+         E E E              ++SK GYFS+ M+  +G+D   
Sbjct: 161 GSTPFYNASSVIQQPNDAREGEREVNENDNDDDDDDDYELSKNGYFSDYMR--EGSDHEP 218

Query: 210 E-------HSESEFFATP 220
           E       H+ES+   +P
Sbjct: 219 EDNTPSHSHTESDVLDSP 236

>KLLA0D09603g 811234..813696 weakly similar to sp|P46949
           Saccharomyces cerevisiae YGR196c singleton, start by
           similarity
          Length = 820

 Score =  256 bits (653), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 185/480 (38%), Positives = 259/480 (53%), Gaps = 49/480 (10%)

Query: 448 DNESFFNQYGNNSSQSSPANRADRGEMSSPPKLRQTTETKLXXXXXXXXXXXXTETDGTA 507
           D++S  N YG     S P+   D    +SP KLR+T++T L             E +   
Sbjct: 352 DSDSLLNGYG-----SEPSLMKDN---ASPVKLRKTSKTDLSYHDGYSSESSGEEKERAI 403

Query: 508 S----------NSEVFKFK--XXXXXXXXXXXXXXXXXXXXXXXXPKSGYYAQMVKETSG 555
           S          ++E FKF+                           KSGY+A MV E   
Sbjct: 404 SEVSLGQYVVHSAESFKFRNPVRNSVLDSSDDDIDYTDEDGDLEVTKSGYFAAMVDEDKE 463

Query: 556 PXXXXXXXXXXXXXXXXXXXXXVCSITKSINYSSARPRSSIPPVSQSSTEKQG---EAPA 612
                                 V SIT+S+       R S   ++QS    Q    +   
Sbjct: 464 IDDSDRHTLNNNDTDGLTADSDVNSITESVT-----KRLSQSSITQSDVPDQNSENDVGG 518

Query: 613 ESPSSDDDQN---KVGLNSRQSVNLGKWQPDTDAGRAEFLGQA----KPEVPEGYVVDQD 665
            S SS+D+++   K+  ++R+S+NLGKW+PDTDA R+ F+ +      P  PEGY V++D
Sbjct: 519 YSDSSEDEEDGPQKLAFSTRESINLGKWKPDTDAFRSGFVTETIDINNP--PEGYTVNED 576

Query: 666 GQLVNVNPSSMRDA-RVVSTYSEAESAWNAFPAS-AGNGGDLDTIYDTKTIYDNQTIHNV 723
           G++V VN ++  +  R  S  S+ ES +NAFP   A +  DL TI DTKTIYDNQTI+NV
Sbjct: 577 GEIVEVNKNTTSNIQRNSSVASDGESQFNAFPHDVASDDDDLKTIADTKTIYDNQTIYNV 636

Query: 724 PGLATNNDSLPPLPRDITAVDSSLSANVTDSDSILNHLNGVKRHHYSNLKESFSVHTPDQ 783
           P L  NN S P LP +I   + S    V+ +D+I  H+NG      S LKE+FS    + 
Sbjct: 637 PALIANNASAPALPTNIQITNESTDY-VSSNDTIFKHVNGEAPKGESKLKEAFS---SEG 692

Query: 784 EEI-ALVKQKAVPTADLDALITRKNTTHAAKINDLNKHFNELKDYDSGLHTWISYALKTS 842
           +EI ++V Q  VP  DL  L++  N  H+ K+  LN +  +LK+YDSGL +WI YALK+S
Sbjct: 693 DEIPSVVHQSTVPNLDLVKLLSS-NELHSQKLKKLNNYKEQLKEYDSGLQSWIQYALKSS 751

Query: 843 -TSDKDYIFQNYKVSTHVKDAYSHADDLSKKMTVSNTVANVNQNVSHLKRKVFSHTMKEK 901
            TSDKD+IF++YKV+ HV+DAY+ AD LSKK +V+NT   VNQNV+HLK+K+FS +M+EK
Sbjct: 752 TTSDKDFIFKDYKVNKHVQDAYAQADILSKKNSVANT---VNQNVTHLKKKMFSSSMREK 808

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 64/215 (29%), Positives = 93/215 (43%), Gaps = 65/215 (30%)

Query: 1   MSVNMERKKSQRWVSVSKGTYDGKEWDSSEEDEPYGAWENDEGQSRKSPERNGTVSKLPP 60
           MS N+ R KSQRWVS SK  YDG +WD+      Y +   DEG +          + +P 
Sbjct: 15  MSDNITRHKSQRWVSASKANYDGADWDA------YSSNSEDEGLT----------NNIPQ 58

Query: 61  LPMLSYGKDSRRSNEVERTETGADEASGSQLDSTSTGAGSPRLYQSSSGAARVNSQSSTG 120
           LP ++  +    SN + ++ +  D + G+ L S S    S R     SG   VN      
Sbjct: 59  LPQVNIPE----SNNIAKS-SSPDPSIGTCLRSDSLNT-SVR-----SGNKSVN------ 101

Query: 121 RITRGPSQYKSENLDHLMTQLSQELTPVSISESRFSFNDDGLNSPRGSADRYRDSNGFSY 180
                      ++LD LM Q+SQE+T            D+ +N+     D          
Sbjct: 102 -----------DDLDSLMHQISQEMTA----------KDEDVNNTSDPED---------- 130

Query: 181 SESEEEPQVSKTGYFSNMMQSPDGADQSSEHSESE 215
            E + E +VSKTGYF+  +   D  D+ S  S+ E
Sbjct: 131 -EDDAELKVSKTGYFAAYVNDEDTDDRESVKSDIE 164

>CAGL0G09295g 887666..889969 similar to sp|P46949 Saccharomyces
           cerevisiae YGR196c, start by similarity
          Length = 767

 Score =  254 bits (649), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 153/368 (41%), Positives = 224/368 (60%), Gaps = 44/368 (11%)

Query: 542 KSGYYAQMVKETSGPXXXXXXXXXXXXXXXXXXXXXVCSITKSINYSSARPRSSIPPVSQ 601
           KSGY+ ++V E  G                           KS+N  ++   +S      
Sbjct: 425 KSGYFKKLVAEELGDKK--------------------LDDGKSLNNVASTQTASTEDKVA 464

Query: 602 SSTEKQGEAPAESPSSDDDQNKVGLNS-RQSVNLGKWQPDTDAGRAEFLGQAKPEVPEGY 660
           S TE   E+ A++   DD +N   ++S R SV   +W+PDTDA R  F+ +     P G+
Sbjct: 465 SDTEDVQESKADN---DDTKNDAHVSSNRSSVTSEEWRPDTDALRDGFMQKTGDNPPPGF 521

Query: 661 VVDQDGQLVNVNPSSMRDARVVSTYSEAESAWNAFPASAGNGGDLDTIYDTKTIYDNQTI 720
           V D+ G+LV++ P+SM+  RVVSTYSE ES WNAFP+   +  DL+TI DTKT+YDN T+
Sbjct: 522 VRDEKGELVDLTPASMK-PRVVSTYSEIESTWNAFPSE--DADDLETIRDTKTLYDNSTL 578

Query: 721 HNVPGLATNNDSLPPLPRDITAVDSSLSANVTDSDSILNHLNGVKRHHYSNL-----KES 775
           +NVPG+ TNND+LPPLP D     +SL  +   SD++        R   +++     KE 
Sbjct: 579 YNVPGIMTNNDALPPLPED-----ASLYRDSNQSDAV----GSQDRARAASVTRKVSKEG 629

Query: 776 FSVHTPDQEEI-ALVKQKAVPTADLDALITRKNTTHAAKINDLNKHFNELKDYDSGLHTW 834
            ++  P  +EI  L +Q  +PT DL+ +I+  N+THA K+ +L  + N L ++DSGL TW
Sbjct: 630 VNIAQPTSQEINKLSEQNTMPTRDLNKIIS-SNSTHAIKLENLRDYRNTLDNFDSGLQTW 688

Query: 835 ISYALKTST-SDKDYIFQNYKVSTHVKDAYSHADDLSKKMTVSNTVANVNQNVSHLKRKV 893
           I+Y LK+S+ +D+D+IFQ YK ++HV++AY++ADDLS+K TV NTV NVNQNV+HL++KV
Sbjct: 689 IAYTLKSSSKTDRDFIFQEYKSNSHVREAYANADDLSRKNTVINTVTNVNQNVNHLRKKV 748

Query: 894 FSHTMKEK 901
             H++K K
Sbjct: 749 LQHSLKPK 756

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 87/194 (44%), Gaps = 42/194 (21%)

Query: 5   MERKKSQRWVSVSKGTYDGKEWDSSEEDEPYGAWENDEGQSRKSPERNGTVSKLPPLPML 64
           +ERKKS RWVS S+ TYDG  WDSS E E          ++R  P+       LP LP L
Sbjct: 6   VERKKSYRWVSASQATYDGAGWDSSSESET---------ETRSQPKLGKLDESLPSLPKL 56

Query: 65  SYG-------KDSRRSNEVERTETGADEASG-----SQLDSTSTGAGSPRLYQ------- 105
           +Y        K+    +   RTE   +  +G     S++ +       P + Q       
Sbjct: 57  NYDNTDVSQYKEEDDEDTDNRTEKAGEIGAGTLHSNSEIQNDVIVEDDPVIKQTPDMIDK 116

Query: 106 ----SSSGAARVNSQSSTG-RITRG----PSQYKSENLDHLMTQLSQELTPVSISESRFS 156
               +S  A + +S S  G R T      P++  +E+LD LM ++S+ELTP    E+ F 
Sbjct: 117 DTLLTSPTAHKESSPSPNGSRHTFSRRPLPNRAVNEHLDDLMLEISKELTPKPEQEAVF- 175

Query: 157 FNDDGLNSPRGSAD 170
               G +SPR   D
Sbjct: 176 ----GNHSPRKDID 185

>YGR196C (FYV8) [2146] chr7 complement(889736..892189) Protein of
           unknown function [2454 bp, 817 aa]
          Length = 817

 Score =  248 bits (633), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 137/285 (48%), Positives = 191/285 (67%), Gaps = 15/285 (5%)

Query: 629 RQSVNLGKWQPDTDAGRAEFL-GQAKPEVPEGYVVDQDGQLVNVNPSSMRDARVVSTYSE 687
           + S ++  W+PD++A R+ F+   A  + P GYV+D +G+LV++ P+SM+  RVVSTYSE
Sbjct: 525 KDSTDVDSWKPDSEALRSGFVQDTANKKAPPGYVIDSNGKLVDLTPASMK-PRVVSTYSE 583

Query: 688 AESAWNAFPASAGNGGDLDTIYDTKTIYDNQTIHNVPGLATNNDSLPPLPRDITA-VDSS 746
            ES W+AFP S G   DL+TI DTKTIYDN TI+NVPGL  N  +LPPLP D    +++ 
Sbjct: 584 MESTWDAFP-SKGEDDDLETIRDTKTIYDNNTIYNVPGLIGNQSNLPPLPMDAQEQLNAG 642

Query: 747 LSANVTDSDSILNHLNGVKRHHYS--------NLKESFSVHTPDQEEIA-LVKQKAVPTA 797
              + TD+D+  N  N +     S        +  E  SVH P  EE+A L +Q  +P  
Sbjct: 643 NDNSTTDNDNSNNTANDLAARSASFKSENRTVSQGEMTSVHEPSTEEMAKLGQQNNLPKL 702

Query: 798 DLDALITRKNTTHAAKINDLNKHFNELKDYDSGLHTWISYALKTSTS-DKDYIFQNYKVS 856
           D++ L+  K T+HA KI  L  +  EL +YD+G+ TWI+Y LK+S++ DKD+I + YK  
Sbjct: 703 DMNKLLNSK-TSHAGKIEQLRNYKRELDEYDTGIQTWINYTLKSSSNKDKDFIAEEYKQH 761

Query: 857 THVKDAYSHADDLSKKMTVSNTVANVNQNVSHLKRKVFSHTMKEK 901
           +HV++AY++ADDLSKK TV NTVA+VNQNV+HL+RKVF H+MK K
Sbjct: 762 SHVREAYANADDLSKKHTVINTVASVNQNVTHLRRKVFQHSMKPK 806

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/173 (31%), Positives = 83/173 (47%), Gaps = 44/173 (25%)

Query: 7   RKKSQRWVSVSKGTYDGKEWDSSEEDEPYGAWENDEGQSRKSPERNGTVSKLPPLPMLSY 66
           RKKS RWVS S+ +YDG  WDSS+E + Y +    E  ++ S      +S LP LP L+Y
Sbjct: 8   RKKSYRWVSASQASYDGAGWDSSDEYD-YSS----EDGTKGSEIHKQKISNLPSLPKLNY 62

Query: 67  -------------GKDSRRSNEVERTETGADEASGSQLDSTSTGAGSPRLYQS------- 106
                         KDS  +N  +   + +D+  G   D      G P+L  S       
Sbjct: 63  TDVNGEHDENTGENKDSNDNNVSKSDISPSDKEVGYLSD------GVPKLMASRESVELQ 116

Query: 107 ---SSGAARVNSQSSTGRITRGPSQYK---------SENLDHLMTQLSQELTP 147
              SS  ++ +  SST  + + PS+ K         +E+LD+L+ Q+S+E+TP
Sbjct: 117 AKKSSEHSKSDYLSSTASL-KSPSENKKSPHTNRAVNEDLDNLIEQISREMTP 168

>ACR036C [1084] [Homologous to ScYGR196C (FYV8) - SH]
           (423030..425294) [2265 bp, 754 aa]
          Length = 754

 Score =  186 bits (471), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 119/296 (40%), Positives = 174/296 (58%), Gaps = 30/296 (10%)

Query: 618 DDDQNKVGLNSRQSVNLGKWQPDTDAGRAEFLGQAKP-EVPEGYVVDQDGQLVNVNPSSM 676
           +D QN++    +QSV+LG W PDT+  R  FL QA P    +G    QD +      ++ 
Sbjct: 459 EDWQNQL---RQQSVHLGAWNPDTEGKRGAFLTQASPMSTNKGMCGSQDEE------TTG 509

Query: 677 RDARVVSTYSE-AESAWNAFPASAGNGGDLDTIYDTKTIYDNQTIHNVPGLATNNDSLPP 735
            D ++    ++ ++S W  FP S G   DL ++ D KTIYDNQT++NVPG+ T++ S+PP
Sbjct: 510 DDQQLAEPCNDDSDSVWEGFP-SVGEYEDLQSVADIKTIYDNQTLYNVPGIITSSTSVPP 568

Query: 736 LP---------RDITAVDSSLSANVTDSDSILNHLNGVKRH--HYSNLKESFSVHTPDQE 784
           LP         +D + +  S S +  DSDS++  + G +RH    S  KE+F   TP+ +
Sbjct: 569 LPSSMSELTSRQDTSILSESTSGSGLDSDSLMRVVEG-QRHAPKPSMFKENFG-QTPEVQ 626

Query: 785 EIALVKQKAVPTADLDALITRKNTTHAAKINDLNKHFNELKDYDSGLHTWISYALKTSTS 844
              LV    VP+ D+ ALI    + H+ K + LN H  +L  Y SG  TWI YALK++ S
Sbjct: 627 VEHLV-NSPVPSLDICALIEGPQS-HSFKRDKLNSHIEDLNAYSSGAQTWIKYALKSTQS 684

Query: 845 DKDYIFQNYKVSTHVKDAYSHADDLSKKMTVSNTVANVNQNVSHLKRKVFSHTMKE 900
             +  F  Y +S HV+DAY+ A+++SKK +V+N    VNQNVS L++KVFSH+MKE
Sbjct: 685 SSNITFDEYVISKHVQDAYAQAEEVSKKHSVTNA---VNQNVSQLRKKVFSHSMKE 737

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/155 (33%), Positives = 78/155 (50%), Gaps = 27/155 (17%)

Query: 1   MSVNMERKKSQRWVSVSKGTYDGKEWDSSEEDEPYGAWENDEGQSRKSPER-NGTVSKLP 59
           M   + R+KSQRWVSVSKG YDG +WDS         +  +E +S  SP R + T+ KLP
Sbjct: 1   MPDKVNRRKSQRWVSVSKGNYDGADWDSD--------YSGEELES--SPTRQHETICKLP 50

Query: 60  PLPMLSYGKDSRRSNEVERTETGADE------ASGSQLDSTSTGAGSP--RLYQSSSGAA 111
            LP L+ G  +      ER   G+ +      A+  +  S+  GA +P   +    SGAA
Sbjct: 51  ELPKLNLGGSTE-----ERGRPGSGDGLAPRGAAEEEAASSGRGAATPAHEVQTPRSGAA 105

Query: 112 RVNSQSSTGRITRGPSQYKSENLDHLMTQLSQELT 146
              +Q  +   +       ++ LD LM ++S+E+T
Sbjct: 106 ---AQKFSLTSSSRSVSSMNKELDTLMDEISKEMT 137

>Kwal_0.237
          Length = 1547

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 54/117 (46%), Gaps = 19/117 (16%)

Query: 349  TPNSQETTNSQETTNSQETTNSQETTNSQETPSS---QDSPSKNSTESTSQEQSLPNALE 405
            +PN +    S + ++S    N  ++ N +E P S    D P+ NST +  +  +L     
Sbjct: 972  SPNQETDDESSKVSDSTSAVNRIQSENDEELPRSPELVDLPAINSTVAQEKNTAL----- 1026

Query: 406  ASRERSSIHEERDQVIN-EPSESQRTPNAKTFP---RVASSSDEYEDNESFFNQYGN 458
             S+  SS      Q IN EP E+Q +  AK FP   R+   +  +E + SF   + N
Sbjct: 1027 -SKSHSS------QKINLEPPETQYSTKAKMFPEVKRITLKNKMFERSPSFRELFEN 1076

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.301    0.118    0.319 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 29,230,141
Number of extensions: 1346021
Number of successful extensions: 16506
Number of sequences better than 10.0: 1561
Number of HSP's gapped: 11757
Number of HSP's successfully gapped: 2684
Length of query: 901
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 790
Effective length of database: 12,753,511
Effective search space: 10075273690
Effective search space used: 10075273690
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 17 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.8 bits)
S2: 66 (30.0 bits)