Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_33.1545324524212641e-179
Sklu_1267.227324211381e-159
Scas_647.724624211331e-159
CAGL0G09317g24624210941e-153
YGR195W (SKI6)24624210821e-151
KLLA0D09625g24524210771e-150
ACR035W24624210371e-144
Sklu_1989.12231381299e-09
Scas_716.302281361281e-08
KLLA0D14993g2251481263e-08
YGR095C (RRP46)2231401245e-08
KLLA0F18304g2361441183e-07
CAGL0G03113g2331381174e-07
Sklu_1879.12381441113e-06
Kwal_23.39692242211095e-06
Scas_621.172391291078e-06
AFR109W2371411051e-05
CAGL0E03223g248147790.029
YGR158C (MTR3)250128750.10
KLLA0C09735g784239730.28
AAR035C25297710.29
KLLA0A06017g45682671.4
YLR092W (SUL2)893104643.2
Kwal_27.11900726106625.5
ACR193C72977618.6
YHR082C (KSP1)102952618.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.15453
         (242 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.15453                                                         491   e-179
Sklu_1267.2 YGR195W, Contig c1267 529-1350                            442   e-159
Scas_647.7                                                            441   e-159
CAGL0G09317g complement(890158..890898) highly similar to sp|P46...   426   e-153
YGR195W (SKI6) [2145] chr7 (888885..889625) Component of the exo...   421   e-151
KLLA0D09625g complement(813773..814510) highly similar to sp|P46...   419   e-150
ACR035W [1083] [Homologous to ScYGR195W (SKI6) - SH] complement(...   404   e-144
Sklu_1989.1 YGR095C, Contig c1989 348-1019                             54   9e-09
Scas_716.30                                                            54   1e-08
KLLA0D14993g complement(1266752..1267429) similar to sp|P53256 S...    53   3e-08
YGR095C (RRP46) [2055] chr7 complement(675673..676344) Protein c...    52   5e-08
KLLA0F18304g complement(1689187..1689897) similar to sp|P48240 S...    50   3e-07
CAGL0G03113g complement(289747..290448) similar to sp|P53256 Sac...    50   4e-07
Sklu_1879.1 YGR158C, Contig c1879 329-1045 reverse complement          47   3e-06
Kwal_23.3969                                                           47   5e-06
Scas_621.17                                                            46   8e-06
AFR109W [3301] [Homologous to ScYGR158C (MTR3) - SH] complement(...    45   1e-05
CAGL0E03223g complement(297800..298546) similar to sp|P48240 Sac...    35   0.029
YGR158C (MTR3) [2112] chr7 complement(805272..806024) Protein in...    33   0.10 
KLLA0C09735g 841867..844221 similar to sgd|S0005782 Saccharomyce...    33   0.28 
AAR035C [221] [Homologous to ScYGR095C (RRP46) - SH] (406091..40...    32   0.29 
KLLA0A06017g complement(555280..556650) weakly similar to sp|P36...    30   1.4  
YLR092W (SUL2) [3507] chr12 (323545..326226) High-affinity sulfa...    29   3.2  
Kwal_27.11900                                                          28   5.5  
ACR193C [1240] [Homologous to ScYPR031W - SH] (687668..689857) [...    28   8.6  
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    28   8.6  

>Kwal_33.15453
          Length = 245

 Score =  491 bits (1264), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 242/242 (100%), Positives = 242/242 (100%)

Query: 1   MSRLEIYSPEGLRVDGRRWNELRRLECAINTHANASDGSSYLEQGNNKIITLVNGPQEPK 60
           MSRLEIYSPEGLRVDGRRWNELRRLECAINTHANASDGSSYLEQGNNKIITLVNGPQEPK
Sbjct: 1   MSRLEIYSPEGLRVDGRRWNELRRLECAINTHANASDGSSYLEQGNNKIITLVNGPQEPK 60

Query: 61  LRSQMNVNQATLSVAVNITRFSKIERSKSSHKNERRVLEMQTALVRTFEKNVMLHLYPRT 120
           LRSQMNVNQATLSVAVNITRFSKIERSKSSHKNERRVLEMQTALVRTFEKNVMLHLYPRT
Sbjct: 61  LRSQMNVNQATLSVAVNITRFSKIERSKSSHKNERRVLEMQTALVRTFEKNVMLHLYPRT 120

Query: 121 QIDIQIHVLQQDGGLMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNSVEEN 180
           QIDIQIHVLQQDGGLMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNSVEEN
Sbjct: 121 QIDIQIHVLQQDGGLMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNSVEEN 180

Query: 181 AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLESVLAIGIAGSHRIRELMDQELRKHGEKRL 240
           AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLESVLAIGIAGSHRIRELMDQELRKHGEKRL
Sbjct: 181 AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLESVLAIGIAGSHRIRELMDQELRKHGEKRL 240

Query: 241 AN 242
           AN
Sbjct: 241 AN 242

>Sklu_1267.2 YGR195W, Contig c1267 529-1350
          Length = 273

 Score =  442 bits (1138), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 211/242 (87%), Positives = 230/242 (95%)

Query: 1   MSRLEIYSPEGLRVDGRRWNELRRLECAINTHANASDGSSYLEQGNNKIITLVNGPQEPK 60
           MSRLEIYSPEGLR+DGRRWNELRR +C+INTH NA+DGSSYLEQGNNKIITLVNGPQEP 
Sbjct: 28  MSRLEIYSPEGLRLDGRRWNELRRFDCSINTHPNAADGSSYLEQGNNKIITLVNGPQEPA 87

Query: 61  LRSQMNVNQATLSVAVNITRFSKIERSKSSHKNERRVLEMQTALVRTFEKNVMLHLYPRT 120
           LRSQ N + AT++V VNIT+FSK+ERSKSSHKNERRVLEMQT+LVRTFEKNVML LYPRT
Sbjct: 88  LRSQTNPSHATMNVTVNITKFSKMERSKSSHKNERRVLEMQTSLVRTFEKNVMLQLYPRT 147

Query: 121 QIDIQIHVLQQDGGLMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNSVEEN 180
            IDIQIHVLQQDGG+MG+LINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNS+EEN
Sbjct: 148 LIDIQIHVLQQDGGIMGALINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNSLEEN 207

Query: 181 AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLESVLAIGIAGSHRIRELMDQELRKHGEKRL 240
           AMSS+TLGVVGKSEKLSLLLVEDK+PLDR ESVLAIGIAG+H IR+LMD+ELR+HGEKRL
Sbjct: 208 AMSSITLGVVGKSEKLSLLLVEDKVPLDRFESVLAIGIAGAHIIRDLMDKELRRHGEKRL 267

Query: 241 AN 242
            N
Sbjct: 268 TN 269

>Scas_647.7
          Length = 246

 Score =  441 bits (1133), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 207/242 (85%), Positives = 232/242 (95%)

Query: 1   MSRLEIYSPEGLRVDGRRWNELRRLECAINTHANASDGSSYLEQGNNKIITLVNGPQEPK 60
           MSRLEIYSPEGLR+DGRRWNELRR EC+INTH++ASDGSSYLEQGNNK+ITLV GP+EP 
Sbjct: 1   MSRLEIYSPEGLRLDGRRWNELRRFECSINTHSHASDGSSYLEQGNNKVITLVKGPKEPT 60

Query: 61  LRSQMNVNQATLSVAVNITRFSKIERSKSSHKNERRVLEMQTALVRTFEKNVMLHLYPRT 120
           LRSQM+  +A L ++VNIT+FSK ERSKSSHKNERRVLEMQTAL+RTFEKNVML++YPRT
Sbjct: 61  LRSQMDTEKAILKISVNITQFSKFERSKSSHKNERRVLEMQTALIRTFEKNVMLNIYPRT 120

Query: 121 QIDIQIHVLQQDGGLMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNSVEEN 180
            IDI++HVLQQDGG+MGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLD+NS+EEN
Sbjct: 121 LIDIEVHVLQQDGGIMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDVNSLEEN 180

Query: 181 AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLESVLAIGIAGSHRIRELMDQELRKHGEKRL 240
           AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLE+VLAIGIAG+HR+R+LMD+ELRKH EKR+
Sbjct: 181 AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLETVLAIGIAGAHRVRDLMDEELRKHAEKRV 240

Query: 241 AN 242
           AN
Sbjct: 241 AN 242

>CAGL0G09317g complement(890158..890898) highly similar to sp|P46948
           Saccharomyces cerevisiae YGR195w SKI6 3-5
           exoribonuclease required for 3 end formation of 5.8S
           rRNA, start by similarity
          Length = 246

 Score =  426 bits (1094), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 197/242 (81%), Positives = 228/242 (94%)

Query: 1   MSRLEIYSPEGLRVDGRRWNELRRLECAINTHANASDGSSYLEQGNNKIITLVNGPQEPK 60
           MSR+EIYSPEGLR+DGRRWNELRR E AINTH +A+DGSSYLEQGNNK+ITLV GP+EP 
Sbjct: 1   MSRVEIYSPEGLRLDGRRWNELRRFESAINTHPHAADGSSYLEQGNNKVITLVKGPKEPT 60

Query: 61  LRSQMNVNQATLSVAVNITRFSKIERSKSSHKNERRVLEMQTALVRTFEKNVMLHLYPRT 120
           L+SQM++ +A L V VNIT+FSK ERSKSSHKNERRVLEMQTALVRTFEKNVMLH+YPRT
Sbjct: 61  LKSQMDIQKAILKVTVNITKFSKFERSKSSHKNERRVLEMQTALVRTFEKNVMLHVYPRT 120

Query: 121 QIDIQIHVLQQDGGLMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNSVEEN 180
            IDI+IHVLQQDGG+MG+L+NGI+LALIDAGIAMYDY+SG+S+GLYDTTPLLD+NS+EEN
Sbjct: 121 LIDIEIHVLQQDGGIMGTLLNGISLALIDAGIAMYDYVSGISVGLYDTTPLLDINSLEEN 180

Query: 181 AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLESVLAIGIAGSHRIRELMDQELRKHGEKRL 240
           AMS+VTLGVVGKSEKLSLL +EDKIPLDR+E+VLAIGIAG+HRIR+LM+QE+R H EKR+
Sbjct: 181 AMSAVTLGVVGKSEKLSLLQIEDKIPLDRIENVLAIGIAGAHRIRDLMEQEIRAHAEKRV 240

Query: 241 AN 242
           AN
Sbjct: 241 AN 242

>YGR195W (SKI6) [2145] chr7 (888885..889625) Component of the
           exosome 3'-5' exoribonuclease complex involved in 3'
           processing of ribosomal 5.8S rRNA, of snoRNAs and of U4
           snRNA, and in degradation of poly(A)- mRNAs, confers
           antiviral activity by repressing replication of
           double-stranded RNA viruses [741 bp, 246 aa]
          Length = 246

 Score =  421 bits (1082), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 196/242 (80%), Positives = 231/242 (95%)

Query: 1   MSRLEIYSPEGLRVDGRRWNELRRLECAINTHANASDGSSYLEQGNNKIITLVNGPQEPK 60
           MSRLEIYSPEGLR+DGRRWNELRR E +INTH +A+DGSSY+EQGNNKIITLV GP+EP+
Sbjct: 1   MSRLEIYSPEGLRLDGRRWNELRRFESSINTHPHAADGSSYMEQGNNKIITLVKGPKEPR 60

Query: 61  LRSQMNVNQATLSVAVNITRFSKIERSKSSHKNERRVLEMQTALVRTFEKNVMLHLYPRT 120
           L+SQM+ ++A L+V+VNIT+FSK ERSKSSHKNERRVLE+QT+LVR FEKNVML++YPRT
Sbjct: 61  LKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERRVLEIQTSLVRMFEKNVMLNIYPRT 120

Query: 121 QIDIQIHVLQQDGGLMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNSVEEN 180
            IDI+IHVL+QDGG+MGSLINGITLALIDAGI+M+DYISG+S+GLYDTTPLLD NS+EEN
Sbjct: 121 VIDIEIHVLEQDGGIMGSLINGITLALIDAGISMFDYISGISVGLYDTTPLLDTNSLEEN 180

Query: 181 AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLESVLAIGIAGSHRIRELMDQELRKHGEKRL 240
           AMS+VTLGVVGKSEKLSLLLVEDKIPLDRLE+VLAIGIAG+HR+R+LMD+ELRKH +KR+
Sbjct: 181 AMSTVTLGVVGKSEKLSLLLVEDKIPLDRLENVLAIGIAGAHRVRDLMDEELRKHAQKRV 240

Query: 241 AN 242
           +N
Sbjct: 241 SN 242

>KLLA0D09625g complement(813773..814510) highly similar to sp|P46948
           Saccharomyces cerevisiae YGR195w SKI6 3 -5
           exoribonuclease required for 3 end formation of 5.8S
           rRNA singleton, start by similarity
          Length = 245

 Score =  419 bits (1077), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 191/242 (78%), Positives = 222/242 (91%)

Query: 1   MSRLEIYSPEGLRVDGRRWNELRRLECAINTHANASDGSSYLEQGNNKIITLVNGPQEPK 60
           MSR EIYSPEGLRVDGRRWNELR   C+INTH NA+DGSSYLEQGNNKIITLV GPQEP 
Sbjct: 1   MSRFEIYSPEGLRVDGRRWNELRSFNCSINTHPNAADGSSYLEQGNNKIITLVAGPQEPS 60

Query: 61  LRSQMNVNQATLSVAVNITRFSKIERSKSSHKNERRVLEMQTALVRTFEKNVMLHLYPRT 120
            RSQ+N  QATLSV +N+T+F+K+ERSKSSHKNERR LE Q +LVRTFEKN+MLHLYPRT
Sbjct: 61  SRSQVNTKQATLSVTINLTKFAKMERSKSSHKNERRTLEWQASLVRTFEKNLMLHLYPRT 120

Query: 121 QIDIQIHVLQQDGGLMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNSVEEN 180
            ID+Q+H LQ DGG++G+++NGITLALIDAGIAMYD++SGVS+GLYDTTPLLDLNS+EEN
Sbjct: 121 SIDVQVHALQLDGGILGAMLNGITLALIDAGIAMYDFVSGVSVGLYDTTPLLDLNSLEEN 180

Query: 181 AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLESVLAIGIAGSHRIRELMDQELRKHGEKRL 240
           AMSSVT+G +GKSEKLSLL+VEDK+PLDRLESV+AIGIAG+HRIR+LMD+ELRKHG+ R+
Sbjct: 181 AMSSVTIGTIGKSEKLSLLMVEDKVPLDRLESVMAIGIAGTHRIRDLMDKELRKHGKTRV 240

Query: 241 AN 242
            N
Sbjct: 241 EN 242

>ACR035W [1083] [Homologous to ScYGR195W (SKI6) - SH]
           complement(422233..422973) [741 bp, 246 aa]
          Length = 246

 Score =  404 bits (1037), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 185/242 (76%), Positives = 219/242 (90%)

Query: 1   MSRLEIYSPEGLRVDGRRWNELRRLECAINTHANASDGSSYLEQGNNKIITLVNGPQEPK 60
           M + EIYSPEGLR+DGRRWNELRR EC+INTH  A+DGSSYLEQGNNK+ITLV GP EP 
Sbjct: 1   MFKTEIYSPEGLRLDGRRWNELRRFECSINTHPTAADGSSYLEQGNNKLITLVTGPHEPA 60

Query: 61  LRSQMNVNQATLSVAVNITRFSKIERSKSSHKNERRVLEMQTALVRTFEKNVMLHLYPRT 120
           LRSQ+N ++ATL+V VN+T+F+  ERSK+ HKNERR+LEMQTALVRTFEKNVML LYPRT
Sbjct: 61  LRSQVNPSKATLTVTVNMTKFAAAERSKTGHKNERRILEMQTALVRTFEKNVMLQLYPRT 120

Query: 121 QIDIQIHVLQQDGGLMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNSVEEN 180
            ID+Q+HVLQ DGG++GS+INGITLALIDAGIAMY+YISG+S+GLYDTTPLLDLN +EE 
Sbjct: 121 AIDVQVHVLQNDGGVLGSMINGITLALIDAGIAMYEYISGISVGLYDTTPLLDLNRLEEQ 180

Query: 181 AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLESVLAIGIAGSHRIRELMDQELRKHGEKRL 240
           AMS  TLGVVGKSEKLSLLLVEDK+PLDRLESV+++GIAG+HR+R++MD+ LR+HG+ RL
Sbjct: 181 AMSCFTLGVVGKSEKLSLLLVEDKVPLDRLESVMSLGIAGTHRVRDMMDKVLRQHGKIRL 240

Query: 241 AN 242
            N
Sbjct: 241 EN 242

>Sklu_1989.1 YGR095C, Contig c1989 348-1019
          Length = 223

 Score = 54.3 bits (129), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 59/138 (42%), Gaps = 18/138 (13%)

Query: 37  DGSSYLEQGNNKIITLVNGPQEPKLRSQMNVNQATLSVAVNITRFSKIERSKSSHKNERR 96
           DGSS +E    K+I  V GP EPK R ++   Q  L + V  ++     R K      R 
Sbjct: 13  DGSSQVECSATKVICSVTGPVEPKARQELP-TQLALEIVVRPSKGVPNTREKLMEDKIRG 71

Query: 97  VLEMQTALVRTFEKNVMLHLYPRTQIDIQIHVL-------QQDGGLMGSLINGITLALID 149
           VL     LVR        +LYPR    +   VL       Q     +G  IN   LAL+D
Sbjct: 72  VLT--PVLVR--------YLYPRQLCQLTFQVLESGESEEQYTVKELGCCINAAYLALVD 121

Query: 150 AGIAMYDYISGVSIGLYD 167
           AGIA+      V I + +
Sbjct: 122 AGIALKSSFVSVPICILE 139

>Scas_716.30
          Length = 228

 Score = 53.9 bits (128), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 60/136 (44%), Gaps = 18/136 (13%)

Query: 37  DGSSYLEQGNNKIITLVNGPQEPKLRSQMNVNQATLSVAVNITRFSKIERSKSSHKNERR 96
           DGSS +E    KII  V GP EPK R ++   Q  L + +         R  +   N R 
Sbjct: 14  DGSSLIESKQTKIICSVTGPIEPKSRQELP-TQLALEIII---------RPAAGVPNTRE 63

Query: 97  VLEMQTALVRTFEKNVMLHLYPRTQIDIQIHVLQQ-DGGL------MGSLINGITLALID 149
            L M+  L       +  +LYPR    I + +L   +  L      + + IN   +ALID
Sbjct: 64  KL-MEDKLRAVITPIITRYLYPRQLCQITLQILNSGESELEFAQRELATCINATLIALID 122

Query: 150 AGIAMYDYISGVSIGL 165
           AGIA+    + V I L
Sbjct: 123 AGIALNSMCACVPIAL 138

>KLLA0D14993g complement(1266752..1267429) similar to sp|P53256
           Saccharomyces cerevisiae YGR095c RRP46 involved in rRNA
           processing singleton, hypothetical start
          Length = 225

 Score = 53.1 bits (126), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 65/148 (43%), Gaps = 17/148 (11%)

Query: 37  DGSSYLEQGNNKIITLVNGPQEPKLRSQMNVNQATLSVAVNITRFSKIERSKSSHKNERR 96
           DGSS +     K+I  V+GP EPK R ++   Q  L + V      +  R K      R 
Sbjct: 12  DGSSVVSNSGTKVICSVSGPMEPKSRQELP-TQLALEIIVKPAEGVQSTREKLMEDQIRS 70

Query: 97  VLEMQTALVRTFEKNVMLHLYPRTQIDIQIHVLQ----QDGGL--MGSLINGITLALIDA 150
           VL     L R        +L+PR  + I + VL+    +D  +  +   +N   LAL+DA
Sbjct: 71  VL--TPVLAR--------YLHPRQFVQICLQVLEAGESRDYTVKEVSVCVNAAVLALVDA 120

Query: 151 GIAMYDYISGVSIGLYDTTPLLDLNSVE 178
           G+ +    SG  IG+      L +N  E
Sbjct: 121 GVPLLSMCSGTCIGITTEGKQLVVNPTE 148

>YGR095C (RRP46) [2055] chr7 complement(675673..676344) Protein
           component of the exosome 3'-5' exoribonuclease complex
           involved in 3'end processing of multiple small RNA
           species [672 bp, 223 aa]
          Length = 223

 Score = 52.4 bits (124), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 58/140 (41%), Gaps = 18/140 (12%)

Query: 37  DGSSYLEQGNNKIITLVNGPQEPKLRSQMNVNQATLSVAVNITRFSKIERSKSSHKNERR 96
           DGSS     + K+I  V GP EPK R ++   Q  L + V   +     R K      R 
Sbjct: 14  DGSSEFVSQDTKVICSVTGPIEPKARQELP-TQLALEIIVRPAKGVATTREKVLEDKLRA 72

Query: 97  VLEMQTALVRTFEKNVMLHLYPRTQIDIQIHVLQ--QDGG-----LMGSLINGITLALID 149
           VL   T L+         H YPR    I   +L+  +D        +   IN   LAL+D
Sbjct: 73  VL---TPLITR-------HCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLALVD 122

Query: 150 AGIAMYDYISGVSIGLYDTT 169
           AGIA+    + + I +   T
Sbjct: 123 AGIALNSMCASIPIAIIKDT 142

>KLLA0F18304g complement(1689187..1689897) similar to sp|P48240
           Saccharomyces cerevisiae YGR158c MTR3 involved in mRNA
           transport singleton, start by similarity
          Length = 236

 Score = 50.1 bits (118), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 71/144 (49%), Gaps = 23/144 (15%)

Query: 31  THANASDGSSYLEQGNNKIITL--VNGPQEPKLRSQMNVNQATLSVAVNITRFSKIERSK 88
           T+AN S    Y++  +++++ +  V GP+   LR      Q+  SV++   +F ++    
Sbjct: 53  TNANGSSYLEYMDGTSDQVLVMSSVFGPR--PLRGSF---QSKASVSI---QFKEVTLE- 103

Query: 89  SSHKNERRVLEMQTALVRTFEKNVMLHLYPRTQIDIQIHVLQQDGG----------LMGS 138
             H N   + E+ T L   F   + +  YP++ IDI I ++Q              ++ +
Sbjct: 104 --HLNTGEIKEICTFLTNVFNAVINVEKYPKSGIDIFIDLIQHSNSNPTEEANIVNILPT 161

Query: 139 LINGITLALIDAGIAMYDYISGVS 162
            IN IT+AL+DAGI + D +S  S
Sbjct: 162 CINSITMALVDAGIEIIDLVSAGS 185

>CAGL0G03113g complement(289747..290448) similar to sp|P53256
           Saccharomyces cerevisiae YGR095c RRP46 involved in rRNA
           processing, hypothetical start
          Length = 233

 Score = 49.7 bits (117), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 18/138 (13%)

Query: 37  DGSSYLEQGNNKIITLVNGPQEPKLRSQMNVNQATLSVAVNITRFSKIERSKSSHKNERR 96
           DGS+ L   +  ++  V GP EPK R ++    A L V V   +     R K      R 
Sbjct: 16  DGSAKLLMNSTNVLCAVTGPVEPKARQELPTEMA-LEVIVRPAKGVPTPREKYLEDKIRA 74

Query: 97  VLEMQTALVRTFEKNVMLHLYPR--TQIDIQIHVLQQDGGL-----MGSLINGITLALID 149
           +          F   +  H YPR   QI  QI    ++  L     + + +N   LAL++
Sbjct: 75  I----------FTPLITRHKYPRQLCQITCQIMEAGENEQLHNQKELSACVNSALLALVN 124

Query: 150 AGIAMYDYISGVSIGLYD 167
           AG+A+ D  + V+I + D
Sbjct: 125 AGVALNDLAAAVTIAVID 142

>Sklu_1879.1 YGR158C, Contig c1879 329-1045 reverse complement
          Length = 238

 Score = 47.4 bits (111), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 70/144 (48%), Gaps = 33/144 (22%)

Query: 36  SDGSSYLE-------QGNNKIITLVNGPQEPKLRSQMNVNQATLSVA---VNITRFSKIE 85
           S+GSSYLE       Q +  +IT V GP+   +R     ++A+L++    V + +F+  E
Sbjct: 51  SNGSSYLEVTDENKTQYHALLITSVYGPR--PIRGSF-TSRASLTIQFKEVTLEKFTTGE 107

Query: 86  RSKSSHKNERRVLEMQTALVRTFEKNVMLHLYPRTQIDIQIHVLQQD---------GGLM 136
                      + E+   L   F   V L  YP++ IDI ++++Q             ++
Sbjct: 108 -----------IKEVCNFLTNIFNAVVNLERYPKSGIDIFLNLIQHSSTDNQETDIASVI 156

Query: 137 GSLINGITLALIDAGIAMYDYISG 160
            + INGITLAL +AGI + D +S 
Sbjct: 157 PTCINGITLALTNAGIEILDMVSA 180

>Kwal_23.3969
          Length = 224

 Score = 46.6 bits (109), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 91/221 (41%), Gaps = 30/221 (13%)

Query: 37  DGSSYLEQGNNKIITLVNGPQEPKLRSQMNVNQATLSVAVNITRFSKIERSKSSHKNERR 96
           DGS  ++ G   ++  V GP EPK R ++  +Q  L + V   +     R K      R 
Sbjct: 13  DGSCKIQCGETSVLCSVTGPIEPKARQELP-SQLALEIVVRPCKGVPNTREKLLEDQIRG 71

Query: 97  VLEMQTALVRTFEKNVMLHLYPRTQIDIQIHVLQQ---DGGL----MGSLINGITLALID 149
           VL     L R        +LYPR    I   +L+    D       + S IN   LALID
Sbjct: 72  VL--TPILAR--------YLYPRQLCQICFQILESGEPDESYSVKELNSCINAAYLALID 121

Query: 150 AGIAMYDYISGVSIGLYDTTPLLDLNSVEENAMSSVTLGVVG--------KSEKLSLLLV 201
           +GI +    + V + +      + +N   +  + S +  ++         K++K+ L+  
Sbjct: 122 SGIGLQSSFASVCLSVNGPNNEICINPASDQLIRSTSSHLLALEMGPGSKKTQKVLLIES 181

Query: 202 EDKIPLDRLESVLAIGIAGSHRIRELMDQELRKHGEKRLAN 242
                  +L  VL+ G     ++     QELR   E++++N
Sbjct: 182 HGAFTEQQLLDVLSKGEEACLQVA----QELRSAVERKISN 218

>Scas_621.17
          Length = 239

 Score = 45.8 bits (107), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 67/129 (51%), Gaps = 15/129 (11%)

Query: 36  SDGSSYLEQGNNKIITLVNGPQEPKLRSQMNVNQATLSVAVNITRFSKIERSKSSHKNER 95
            +GS+ +E     ++T V GP+   +R     +Q T+++ +   +   +E  +++     
Sbjct: 56  CNGSTLIESSKFSLLTSVYGPKS--IRGSF-TSQGTITIQL---KNGVVENYQTTE---- 105

Query: 96  RVLEMQTALVRTFEKNVMLHLYPRTQIDIQIHVLQQDGG----LMGSLINGITLALIDAG 151
            + E+ + LV  F   V L  YP++ IDI ++++    G    L+  LI GI LAL+D G
Sbjct: 106 -LKEVSSWLVGIFNSVVNLENYPKSGIDIFVNLIIDKQGDISKLIPFLIMGICLALVDGG 164

Query: 152 IAMYDYISG 160
           I + D ++G
Sbjct: 165 IEIIDIVTG 173

>AFR109W [3301] [Homologous to ScYGR158C (MTR3) - SH]
           complement(632965..633678) [714 bp, 237 aa]
          Length = 237

 Score = 45.1 bits (105), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 67/141 (47%), Gaps = 29/141 (20%)

Query: 36  SDGSSYLE----QGNNKIITLVNGPQEPKLRSQMNVNQATLSVAVNITRFSKI--ERSKS 89
           ++GSSYLE      N  ++T   GP+   +R     ++A +SV      F ++  ER  S
Sbjct: 54  ANGSSYLEVKAETHNTLLVTTAYGPR--PIRGSF-TSRAAISV-----HFKEVTLERWDS 105

Query: 90  SHKNERRVLEMQTALVRTFEKNVMLHLYPRTQIDIQIHVLQQD----------GGLMGSL 139
                  V EM   L   F   + +  YP++ IDI ++++Q              ++   
Sbjct: 106 GE-----VTEMCNFLNTVFSAAINVERYPKSGIDIFLNLIQHSNVRDDKTLNLAEVLPDC 160

Query: 140 INGITLALIDAGIAMYDYISG 160
           I+GITLAL+DAGI + D ++ 
Sbjct: 161 ISGITLALMDAGIELKDVVAA 181

>CAGL0E03223g complement(297800..298546) similar to sp|P48240
           Saccharomyces cerevisiae YGR158c MTR3 involved in mRNA
           transport, start by similarity
          Length = 248

 Score = 35.0 bits (79), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 61/147 (41%), Gaps = 37/147 (25%)

Query: 36  SDGSSYLEQGNNKI-------ITLVNGPQEPKLRSQMNVNQATLSVAVNITRFSKIERSK 88
            +GS+ +E  + KI       IT V GP+   +R     +QA+LS+ +      K E   
Sbjct: 51  CNGSALVEIKDTKITHHQTSLITSVYGPKS--VRGSF-TSQASLSIQLKNGLLEKYE--- 104

Query: 89  SSHKNERRVLEMQTALVRTFEKNVMLHLYPRTQIDIQIHVLQQDG--------------- 133
                 R + E+   L   F   + L  YP++ IDI I++  +                 
Sbjct: 105 -----SRELKEVANFLTSIFNSVINLKRYPKSGIDIFIYITYEKSLENFKEQEPAAPVRK 159

Query: 134 ----GLMGSLINGITLALIDAGIAMYD 156
                ++   I+ IT+ALIDA I + D
Sbjct: 160 SNIYKILPHCISSITMALIDADIEIID 186

>YGR158C (MTR3) [2112] chr7 complement(805272..806024) Protein
           involved in mRNA transport, component of the exosome
           complex responsible for 3'-5' degradation of mRNA and
           for 3'-end processing of multiple small RNA species [753
           bp, 250 aa]
          Length = 250

 Score = 33.5 bits (75), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 52/128 (40%), Gaps = 31/128 (24%)

Query: 49  IITLVNGPQEPKLRSQMNVNQATLSVAVNITRFSKIERSKSSHKNERRVLEMQTALVRTF 108
           +IT V GP+   +R     +Q T+S+ +      K         N   + E+ + L+  F
Sbjct: 73  LITAVYGPR--SIRGSF-TSQGTISIQLKNGLLEKY--------NTNELKEVSSFLMGIF 121

Query: 109 EKNVMLHLYPRTQIDIQIHVL--------------------QQDGGLMGSLINGITLALI 148
              V L  YP++ IDI +++                      Q   L+   I  ITLAL 
Sbjct: 122 NSVVNLSRYPKSGIDIFVYLTYDKDLTNNPQDDDSQSKMMSSQISSLIPHCITSITLALA 181

Query: 149 DAGIAMYD 156
           DAGI + D
Sbjct: 182 DAGIELVD 189

>KLLA0C09735g 841867..844221 similar to sgd|S0005782 Saccharomyces
           cerevisiae YOR256c, start by similarity
          Length = 784

 Score = 32.7 bits (73), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 49/239 (20%), Positives = 97/239 (40%), Gaps = 49/239 (20%)

Query: 1   MSRLEIYSPEGLRVDGRRWNELRRLECAINTHANASDGSSYLEQGNNKIITLVNGPQEPK 60
           M+ L+++     + D   W  LR      N +  + DG+ Y   G  ++           
Sbjct: 454 MALLQLFQQTKYKYD---WRPLR------NIYFISYDGAQYNHVGATEL----------- 493

Query: 61  LRSQMNVNQATLSVAVNITRFSKIERSKSSHKNERRVLEMQ-TALVRTFEKNVMLHLYPR 119
           + ++MN  ++ +   ++I++ S   ++       RR L++Q T L+++  KN        
Sbjct: 494 METEMNQLKSEVYAFIDISQLSVDPKA-------RRALDVQATPLLQSLFKNT------- 539

Query: 120 TQIDIQIHVLQQDGGLMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNSVEE 179
            Q D+ +  + Q G     L NGI  A++ +   +            + TP +   S + 
Sbjct: 540 KQFDVTVRNIAQYGDWTAYLANGIPTAVLSSPFVL------------NQTPPISTCSDDF 587

Query: 180 NAMSSVTLGVVGKSEKLSLLLVEDKIPLDRL--ESVLAIGIAGSHRIRELMDQELRKHG 236
              S    G  G  E+++  L+     L RL  E +L   +       +++ Q+L+K G
Sbjct: 588 QHWSEEIKGTEGAWEQVADTLIYTYEMLLRLIDEPLLPFNVRDYVSNLDILFQDLQKQG 646

>AAR035C [221] [Homologous to ScYGR095C (RRP46) - SH]
           (406091..406849) [759 bp, 252 aa]
          Length = 252

 Score = 32.0 bits (71), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 40/97 (41%), Gaps = 11/97 (11%)

Query: 37  DGSSYLEQGNNKIITLVNGPQEPKLRSQMNVNQATLSVAVNITRFSKIERSKSSHKNERR 96
           DGSS         I  V+GP EPK R ++  + A L V V         R K     E +
Sbjct: 48  DGSSKFSTAAASAICGVSGPIEPKARQEIPQHLA-LDVIVRPAAGPPTTREK---LLEDK 103

Query: 97  VLEMQTALVRTFEKNVMLHLYPRTQIDIQIHVLQQDG 133
           V    T +V TF       L+PR    I + VL+  G
Sbjct: 104 VRATITPVVETF-------LHPRQLCQITLQVLKSVG 133

>KLLA0A06017g complement(555280..556650) weakly similar to sp|P36146
           Saccharomyces cerevisiae YKR063c LAS1 involved in cell
           morphogenesis, cytoskeletal regulation and bud formation
           singleton, start by similarity
          Length = 456

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 3/82 (3%)

Query: 22  LRRLECAINTHANASDGSS--YLE-QGNNKIITLVNGPQEPKLRSQMNVNQATLSVAVNI 78
           +R ++C +N    A DG    YL+ Q    +I  VNG  +P  ++Q  +   TL+  + +
Sbjct: 53  VRLMQCQLNDPGEAQDGDDMEYLKWQYCMVLIRFVNGMLDPVQQAQFAIPLHTLAENIGL 112

Query: 79  TRFSKIERSKSSHKNERRVLEM 100
             +    R  S+H+ E   LEM
Sbjct: 113 PSWFVELRHLSTHERELPSLEM 134

>YLR092W (SUL2) [3507] chr12 (323545..326226) High-affinity sulfate
           transporter, member of the sulfate permease family of
           membrane transporters [2682 bp, 893 aa]
          Length = 893

 Score = 29.3 bits (64), Expect = 3.2,   Method: Composition-based stats.
 Identities = 31/104 (29%), Positives = 48/104 (46%), Gaps = 7/104 (6%)

Query: 22  LRRLECAINTHANA---SDGSSYLEQGNNKIITLVNGPQEPKLRSQMNVNQATLSVAVNI 78
           L R+E A  T A     SD  SY+ + NN I TL +G ++ K  S   V  ++  +  N+
Sbjct: 580 LGRVEVAEVTDAYVRPDSDVVSYVSENNNGISTLEDGGEDDKESSTKYVTNSSKKIETNV 639

Query: 79  TRFSKIERSKSSHKNERRVLEMQTALVRTFEKNVMLHLYPRTQI 122
              +K   S SS  ++ R+ +  T  +  F+      L P  QI
Sbjct: 640 Q--TKGFDSPSSSISQPRI-KYHTKWI-PFDHKYTRELNPDVQI 679

>Kwal_27.11900
          Length = 726

 Score = 28.5 bits (62), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 48/106 (45%), Gaps = 9/106 (8%)

Query: 4   LEIYS--PEGLRVD-GRRWNELRRLECAINTHANASDGSSYLEQGNNKIITLVNGP-QEP 59
           L IYS  P  LR D G         E  +    NA  GS+  +Q   + I LV+ P Q P
Sbjct: 515 LNIYSGDPRLLRYDAGSNIAVTDNDETGVQAIINALGGSN-CQQSRTENIFLVDNPNQSP 573

Query: 60  KLRSQMNVNQATLSVAVNITRFSKIERSKSS---HKNERRVLEMQT 102
            + +  ++NQ TLS  +N   F  I  S +S   + + R +  M T
Sbjct: 574 WVIAMQSLNQCTLSSVIN-GVFVSIGISAASSQLYASSRTLYSMAT 618

>ACR193C [1240] [Homologous to ScYPR031W - SH] (687668..689857)
           [2190 bp, 729 aa]
          Length = 729

 Score = 28.1 bits (61), Expect = 8.6,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 4/77 (5%)

Query: 163 IGLYDTTPLLDLNS---VEENAMSSVTLGVVGKSEKLSLLLVE-DKIPLDRLESVLAIGI 218
           + ++D T    ++S   ++  A + V L  + K ++LS LLV   +    RL++V  I  
Sbjct: 522 VRIFDPTSFNSMDSADILKRVAFADVLLNDLAKLDELSTLLVRRQQAAQARLDAVDIIND 581

Query: 219 AGSHRIRELMDQELRKH 235
            G H +R L+ + +  H
Sbjct: 582 LGFHPVRHLVQKNVTTH 598

>YHR082C (KSP1) [2372] chr8 complement(268460..271549)
           Serine/threonine kinase that suppresses prp20 mutant
           when oveproduced [3090 bp, 1029 aa]
          Length = 1029

 Score = 28.1 bits (61), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 55  GPQEPKLRSQMNVNQATLSVAVNITRFSKIERSKSSHKNERRVLEMQTALVR 106
           G Q P +  + + N+ATLSV+ N   F     S+ S  NE   L M  AL +
Sbjct: 849 GTQVPPMNMKTS-NEATLSVSHNSVNFGGSYNSRRSSANESNPLHMNKALEK 899

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,156,564
Number of extensions: 283986
Number of successful extensions: 902
Number of sequences better than 10.0: 34
Number of HSP's gapped: 889
Number of HSP's successfully gapped: 34
Length of query: 242
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 143
Effective length of database: 13,168,927
Effective search space: 1883156561
Effective search space used: 1883156561
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)