Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_33.1544939639118890.0
ACR034W39738310611e-143
YJR013W40338410411e-140
CAGL0B03905g43138910441e-140
KLLA0D09647g40237710321e-139
Scas_647.64234019701e-129
CAGL0H00220g40876646.0
YER140W55677646.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.15449
         (391 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.15449                                                         732   0.0  
ACR034W [1082] [Homologous to ScYJR013W - SH] complement(420791....   413   e-143
YJR013W (YJR013W) [2916] chr10 (460296..461507) Protein with mod...   405   e-140
CAGL0B03905g 385192..386487 similar to sp|P47088 Saccharomyces c...   406   e-140
KLLA0D09647g complement(814829..816037) some similarities with s...   402   e-139
Scas_647.6                                                            378   e-129
CAGL0H00220g complement(13625..14851) similar to sp|P41733 Sacch...    29   6.0  
YER140W (YER140W) [1569] chr5 (451560..453230) Protein of unknow...    29   6.3  

>Kwal_33.15449
          Length = 396

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/391 (93%), Positives = 364/391 (93%)

Query: 1   MSVDWAMVGLFSMSLVLRVGFFLYGMYQDQHFDVKYTDIDYFVFNDAARFVFNGMSPYLR 60
           MSVDWAMVGLFSMSLVLRVGFFLYGMYQDQHFDVKYTDIDYFVFNDAARFVFNGMSPYLR
Sbjct: 1   MSVDWAMVGLFSMSLVLRVGFFLYGMYQDQHFDVKYTDIDYFVFNDAARFVFNGMSPYLR 60

Query: 61  DTYRYTPLLSWLLVPNHYLNWIHFGKMVFVVMDLLTGVMILALLEIPNKRRRLILASLWL 120
           DTYRYTPLLSWLLVPNHYLNWIHFGKMVFVVMDLLTGVMILALLEIPNKRRRLILASLWL
Sbjct: 61  DTYRYTPLLSWLLVPNHYLNWIHFGKMVFVVMDLLTGVMILALLEIPNKRRRLILASLWL 120

Query: 121 LNIMVITISTRGNAESVICFLVLLSLYFLRFGNYVLAGAVLGLAIHFKIYPIIYTLPIAV 180
           LNIMVITISTRGNAESVICFLVLLSLYFLRFGNYVLAGAVLGLAIHFKIYPIIYTLPIAV
Sbjct: 121 LNIMVITISTRGNAESVICFLVLLSLYFLRFGNYVLAGAVLGLAIHFKIYPIIYTLPIAV 180

Query: 181 YIYFQKKDGLVSVVKIGLSVIAALTFSSYLMYHKYGTEYLEHAYLYHVLRTDHRHNFSVF 240
           YIYFQKKDGLVSVVKIGLSVIAALTFSSYLMYHKYGTEYLEHAYLYHVLRTDHRHNFSVF
Sbjct: 181 YIYFQKKDGLVSVVKIGLSVIAALTFSSYLMYHKYGTEYLEHAYLYHVLRTDHRHNFSVF 240

Query: 241 HMLLYFESALPAESYWAKLAFLPQAMITLGVVPXXXXXXXXXXXXXXXXIQTYAFVTYNK 300
           HMLLYFESALPAESYWAKLAFLPQAMITLGVVP                IQTYAFVTYNK
Sbjct: 241 HMLLYFESALPAESYWAKLAFLPQAMITLGVVPLCFRSSSFNNLLSVLFIQTYAFVTYNK 300

Query: 301 VCTSQYFIWYLIFLPFFLAHTTITARRGIAMGALWIATQAFWLLFGYLLEFKGQNVFYPG 360
           VCTSQYFIWYLIFLPFFLAHTTITARRGIAMGALWIATQAFWLLFGYLLEFKGQNVFYPG
Sbjct: 301 VCTSQYFIWYLIFLPFFLAHTTITARRGIAMGALWIATQAFWLLFGYLLEFKGQNVFYPG 360

Query: 361 XXXXXXXXXXXNVWIIGQFINDINKRSLQIS 391
                      NVWIIGQFINDINKRSLQIS
Sbjct: 361 LFLASLSFFLSNVWIIGQFINDINKRSLQIS 391

>ACR034W [1082] [Homologous to ScYJR013W - SH]
           complement(420791..421984) [1194 bp, 397 aa]
          Length = 397

 Score =  413 bits (1061), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 210/383 (54%), Positives = 270/383 (70%), Gaps = 7/383 (1%)

Query: 14  SLVLRVGFFLYGMYQDQHFDVKYTDIDYFVFNDAARFVFNGMSPYLRDTYRYTPLLSWLL 73
            L+ RVGFF YG+YQD HF VKYTDIDY VF+DAAR+V  G SPYLRDTYRYTPLLSW+L
Sbjct: 12  GLLARVGFFSYGIYQDAHFAVKYTDIDYHVFHDAARYVAQGNSPYLRDTYRYTPLLSWML 71

Query: 74  VPNHYLNWIHFGKMVFVVMDLLTGVMILALLEIPNKRRRLILASLWLLNIMVITISTRGN 133
           VPNH+L W+HFGK +FV+ DLL GVM++ LL    +RR+LILASLWLLN +VIT+STRGN
Sbjct: 72  VPNHWLQWVHFGKFIFVLFDLLAGVMVMNLLGKCGRRRKLILASLWLLNPVVITVSTRGN 131

Query: 134 AESVICFLVLLSLYFLRFGNYVLAGAVLGLAIHFKIYPIIYTLPIAVYIYFQKKDG---L 190
           AESV+ FL++  L  LR   + L+G V G+AIHFKIYPIIY LPI++YI  +  +G    
Sbjct: 132 AESVMAFLIMWFLVHLRNRQFALSGFVYGVAIHFKIYPIIYALPISIYI--RSSEGSRWF 189

Query: 191 VSVVKIGLSVIAALTFSSYLMYHKYGTEYLEHAYLYHVLRTDHRHNFSVFHMLLYFESA- 249
           + ++ +G++ +A L      MY+ YG E+LEHAY+YH  RTDHRHNFS+++MLLY +S+ 
Sbjct: 190 LRLLTMGIATLATLVGCGIGMYYIYGWEFLEHAYIYHFTRTDHRHNFSLWNMLLYLDSSG 249

Query: 250 -LPAESYWAKLAFLPQAMITLGVVPXXXXXXXXXXXXXXXXIQTYAFVTYNKVCTSQYFI 308
            +P    WA+ AFLPQ  I   V                  +QT+AFVTYNKVCTSQYFI
Sbjct: 250 VVPTTINWAEFAFLPQLFICAAVTYVLWEAPTFQNMQCVLFLQTFAFVTYNKVCTSQYFI 309

Query: 309 WYLIFLPFFLAHTTITARRGIAMGALWIATQAFWLLFGYLLEFKGQNVFYPGXXXXXXXX 368
           WYL+FLP FL  TT++  +GI +  LW+ TQA+WL  GYLLEF+G+N+FYP         
Sbjct: 310 WYLLFLPSFLLDTTLSGAKGIFLIFLWVGTQAWWLYNGYLLEFEGKNMFYPRLFSACVTF 369

Query: 369 XXXNVWIIGQFINDINKRSLQIS 391
              NV+++ QFI D  +R+ Q +
Sbjct: 370 FLANVYLLAQFILDCRRRNYQTN 392

>YJR013W (YJR013W) [2916] chr10 (460296..461507) Protein with
           moderate similarity to mannosyltransferase I
           (glycosylphosphatidylinositol mannosyltransferase I, rat
           Pigm), which transfers the first mannose to
           glycosylphosphatidylinositol (GPI) during the
           biosynthesis of GPI membrane anchors [1212 bp, 403 aa]
          Length = 403

 Score =  405 bits (1041), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 211/384 (54%), Positives = 276/384 (71%), Gaps = 8/384 (2%)

Query: 9   GLFSMSLVLRVGFFLYGMYQDQHFDVKYTDIDYFVFNDAARFVFNGMSPYLRDTYRYTPL 68
           GL  +S ++RVGFFL+G+YQD +F V+YTDIDYFVF+DAA++V+ G SPY RDTYRYTPL
Sbjct: 7   GLTVLSFLVRVGFFLFGIYQDANFKVRYTDIDYFVFHDAAKYVYEGKSPYARDTYRYTPL 66

Query: 69  LSWLLVPNHYLNWIHFGKMVFVVMDLLTGVMILALL-EIPNKRRRLILASLWLLNIMVIT 127
           LSWLLVPNHY  W H GK++FV+ DL+TG++I+ LL +  +++R LIL S+WLLN MVIT
Sbjct: 67  LSWLLVPNHYFGWFHLGKVIFVIFDLVTGLIIMKLLNQAISRKRALILESIWLLNPMVIT 126

Query: 128 ISTRGNAESVICFLVLLSLYFLRFGNYVLAGAVLGLAIHFKIYPIIYTLPIAVYIYFQKK 187
           ISTRGNAESV+C L++ +L+FL+   Y LAG + GL+IHFKIYPIIY +PIA++IY+ K+
Sbjct: 127 ISTRGNAESVLCCLIMFTLFFLQKSRYTLAGILYGLSIHFKIYPIIYCIPIAIFIYYNKR 186

Query: 188 D-----GLVSVVKIGLSVIAALTFSSYLMYHKYGTEYLEHAYLYHVLRTDHRHNFSVFHM 242
           +      L S++ IGLS +  L    + MY  YG E+L+ AYLYH+ RTDHRHNFSV++M
Sbjct: 187 NQGPRTQLTSLLNIGLSTLTTLLGCGWAMYKIYGYEFLDQAYLYHLYRTDHRHNFSVWNM 246

Query: 243 LLYFESALP--AESYWAKLAFLPQAMITLGVVPXXXXXXXXXXXXXXXXIQTYAFVTYNK 300
           LLY +SA     ES  ++ AF+PQ ++ L                    +QT+AFVTYNK
Sbjct: 247 LLYLDSANKENGESNLSRYAFVPQLLLVLVTGCLEWWNPTFDNLLRVLFVQTFAFVTYNK 306

Query: 301 VCTSQYFIWYLIFLPFFLAHTTITARRGIAMGALWIATQAFWLLFGYLLEFKGQNVFYPG 360
           VCTSQYF+WYLIFLPF+L+ T I  ++G+ M  LW+ TQ  WL  GY LEF+G+NVFYPG
Sbjct: 307 VCTSQYFVWYLIFLPFYLSRTHIGWKKGLLMATLWVGTQGIWLSQGYYLEFEGKNVFYPG 366

Query: 361 XXXXXXXXXXXNVWIIGQFINDIN 384
                      NVW++GQFI DI 
Sbjct: 367 LFIASVLFFVTNVWLLGQFITDIK 390

>CAGL0B03905g 385192..386487 similar to sp|P47088 Saccharomyces
           cerevisiae YJR013w, hypothetical start
          Length = 431

 Score =  406 bits (1044), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 213/389 (54%), Positives = 267/389 (68%), Gaps = 14/389 (3%)

Query: 8   VGLFSMSLVLRVGFFLYGMYQDQHFDVKYTDIDYFVFNDAARFVFNGMSPYLRDTYRYTP 67
           +GL S++++LR+ FFL+G+YQD+HF VKYTDIDY VFNDAA FV +  SPY RDTYRYTP
Sbjct: 7   IGLLSLAVLLRIAFFLFGVYQDEHFTVKYTDIDYQVFNDAAWFVAHRKSPYNRDTYRYTP 66

Query: 68  LLSWLLVPNHYLNWIHFGKMVFVVMDLLTGVMILALLEIPNKR------RRLILASLWLL 121
           LLSWLL+PNH + W HFGK++FV+ DL TGV+IL +L+    +      R  I+A++WLL
Sbjct: 67  LLSWLLLPNHMIPWFHFGKLIFVLCDLATGVLILQMLKKLKSKYRYGTDRMTIMAAIWLL 126

Query: 122 NIMVITISTRGNAESVICFLVLLSLYFLRFGNYVLAGAVLGLAIHFKIYPIIYTLPIAVY 181
           N MVITISTRGNAESV+CFL+L  LY      Y+L G + GL+IHFKIYPIIY LPIA+Y
Sbjct: 127 NPMVITISTRGNAESVLCFLILSFLYCFLCEQYLLGGLLFGLSIHFKIYPIIYALPIAIY 186

Query: 182 IYFQKKDGLVSVVK-------IGLSVIAALTFSSYLMYHKYGTEYLEHAYLYHVLRTDHR 234
           +     +   SV K       +G S +  L   +  MY  YG ++++  YLYH+ RTDHR
Sbjct: 187 VAAAHYNKTQSVFKSSFKLFLVGFSTLIVLILLTVFMYMLYGDKFIDQTYLYHIYRTDHR 246

Query: 235 HNFSVFHMLLYFESALPAESYWAKLAFLPQAMITLGV-VPXXXXXXXXXXXXXXXXIQTY 293
           HNFSV++MLLYF SALP  S  +K  FLPQ +I L + +                 ++T+
Sbjct: 247 HNFSVWNMLLYFNSALPKTSELSKFVFLPQMIIVLAISLTQLRRPSSFPLLCNVLFLETF 306

Query: 294 AFVTYNKVCTSQYFIWYLIFLPFFLAHTTITARRGIAMGALWIATQAFWLLFGYLLEFKG 353
           AFVT+NKVCTSQYFIWYLIFLPF L +T I+ RRGI M  +W+ATQA WL  GYLLEF+G
Sbjct: 307 AFVTFNKVCTSQYFIWYLIFLPFVLYNTRISMRRGIVMLVVWVATQALWLRQGYLLEFEG 366

Query: 354 QNVFYPGXXXXXXXXXXXNVWIIGQFIND 382
           QNVFYPG           N WI+GQFI D
Sbjct: 367 QNVFYPGLFCASVGFFVSNAWILGQFIED 395

>KLLA0D09647g complement(814829..816037) some similarities with
           sp|P47088 Saccharomyces cerevisiae YJR013w singleton,
           hypothetical start
          Length = 402

 Score =  402 bits (1032), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 204/377 (54%), Positives = 269/377 (71%), Gaps = 8/377 (2%)

Query: 18  RVGFFLYGMYQDQHFDVKYTDIDYFVFNDAARFVFNGMSPYLRDTYRYTPLLSWLLVPNH 77
           R+GFF YG++QD HFDVKYTDIDYFVF+DAA +V NG SPYLRDTYRYTPLLS+LL+PN+
Sbjct: 16  RIGFFSYGIFQDSHFDVKYTDIDYFVFHDAAGYVNNGQSPYLRDTYRYTPLLSFLLLPNY 75

Query: 78  YLNWIHFGKMVFVVMDLLTGVMILALLEIPNK-RRRLILASLWLLNIMVITISTRGNAES 136
           YL WIH GK+ FV+ DL+TGVMI+ LL+   +  ++LILAS+WLLN +VITISTRGNAES
Sbjct: 76  YLKWIHMGKVFFVLFDLITGVMIIKLLQGSCQLTKQLILASIWLLNPIVITISTRGNAES 135

Query: 137 VICFLVLLSLYFLRFGNYVLAGAVLGLAIHFKIYPIIYTLPIAVYIYF--QKKDGLVSVV 194
           V+CFL++ +LYFL+    +++G   GL+IHFKIYPIIY LPI +Y+      ++ +  + 
Sbjct: 136 VLCFLIICALYFLKRDRLLISGLFYGLSIHFKIYPIIYALPIGIYLLLSSHNRNCIWRLF 195

Query: 195 KIGLSVIAALTFSSYLMYHKYGTEYLEHAYLYHVLRTDHRHNFSVFHMLLYFESA---LP 251
            IG+S +  +T  +Y MY  YG+E++EH+Y+YH+ RTDHRHNFS+++++L  ESA   L 
Sbjct: 196 MIGISTLIGITAPTYFMYKLYGSEFIEHSYMYHLTRTDHRHNFSIWNLVLLLESAGIHLS 255

Query: 252 AESYWAKLAFLPQAMITLGVVPXXX-XXXXXXXXXXXXXIQTYAFVTYNKVCTSQYFIWY 310
                +KLAF+PQ  +   V+P                 +QTYAFVT+NKVCTSQYFIWY
Sbjct: 256 QSIELSKLAFVPQLTLC-AVLPYLLWKSQTFENLMNVLFVQTYAFVTFNKVCTSQYFIWY 314

Query: 311 LIFLPFFLAHTTITARRGIAMGALWIATQAFWLLFGYLLEFKGQNVFYPGXXXXXXXXXX 370
           L+  PF+ A+TTIT R+G+    LWI +QA WL   YLLEFKGQNVF+P           
Sbjct: 315 LVLSPFYFANTTITWRKGVVCIFLWILSQAVWLSQAYLLEFKGQNVFFPNLFFGNIVFFL 374

Query: 371 XNVWIIGQFINDINKRS 387
            NV+++G FI DI  R+
Sbjct: 375 INVYLLGVFITDIKSRT 391

>Scas_647.6
          Length = 423

 Score =  378 bits (970), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 200/401 (49%), Positives = 270/401 (67%), Gaps = 23/401 (5%)

Query: 14  SLVLRVGFFLYGMYQDQHFDVKYTDIDYFVFNDAARFVFNGM-----------SPYLRDT 62
            L++RV F+L+G+YQD HF V+YTDIDYFVF+DAA +V+  +           SPY RDT
Sbjct: 14  GLLIRVVFYLFGIYQDAHFKVRYTDIDYFVFHDAAGYVYEKLINLNSNFPVNGSPYQRDT 73

Query: 63  YRYTPLLSWLLVPNHYLNWIHFGKMVFVVMDLLTGVMILALLEIPNKR----RRLILASL 118
           YRYTPLLSWLLVP+HY +  H GK +F++ DL TG++I+ +L+  + +    +  +L+S+
Sbjct: 74  YRYTPLLSWLLVPDHYFDLFHLGKFLFMIFDLFTGIVIMKMLKNISPKISSLKLGLLSSI 133

Query: 119 WLLNIMVITISTRGNAESVICFLVLLSLYFLRFGNYVLAGAVLGLAIHFKIYPIIYTLPI 178
           WLLN MVITISTRGNAES++CFLV+LSLYFL+   Y LAG + GL+IHFKIYPIIY L I
Sbjct: 134 WLLNPMVITISTRGNAESILCFLVMLSLYFLQKRRYWLAGIIYGLSIHFKIYPIIYCLAI 193

Query: 179 AVYIYFQKKDG------LVSVVKIGLSVIAALTFSSYLMYHKYGTEYLEHAYLYHVLRTD 232
           ++Y+     +       L +++ +G + +  +     LMY  YG E+L+ AY YH+ RTD
Sbjct: 194 SIYLVCASHNNATVSSKLKNLIIVGATTLFTIVGLGTLMYSIYGFEFLDQAYFYHLYRTD 253

Query: 233 HRHNFSVFHMLLYFESALPAESY--WAKLAFLPQAMITLGVVPXXXXXXXXXXXXXXXXI 290
           HRHNFS++++LLYF+SA    S    +K +F PQ +IT+ +                  +
Sbjct: 254 HRHNFSLWNILLYFDSASDPNSVSLLSKFSFAPQMLITIVLTYLEYLQPTFANLLNVLFL 313

Query: 291 QTYAFVTYNKVCTSQYFIWYLIFLPFFLAHTTITARRGIAMGALWIATQAFWLLFGYLLE 350
           QT+AFVTYNKVCTSQYF+WYLIFLPF L +TTI+ +RG+AM  +W+ TQA WL  GY LE
Sbjct: 314 QTFAFVTYNKVCTSQYFVWYLIFLPFSLINTTISMKRGVAMLLVWVGTQALWLSQGYYLE 373

Query: 351 FKGQNVFYPGXXXXXXXXXXXNVWIIGQFINDINKRSLQIS 391
           F+G+NVFYPG           NVW +GQFI+DI    L+ S
Sbjct: 374 FEGRNVFYPGIFFGAVAFFAGNVWTLGQFIDDITSTILKSS 414

>CAGL0H00220g complement(13625..14851) similar to sp|P41733
           Saccharomyces cerevisiae YLR459w CDC91 cell division
           control protein, hypothetical start
          Length = 408

 Score = 29.3 bits (64), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/76 (22%), Positives = 37/76 (48%)

Query: 102 ALLEIPNKRRRLILASLWLLNIMVITISTRGNAESVICFLVLLSLYFLRFGNYVLAGAVL 161
            +L++  K+  +++  ++ LN +++  +  G+      F +  +LYF   G Y  +   +
Sbjct: 108 TILQLLQKKDHILIGIIYALNPLLVLSNISGSTVIFTHFAISSALYFSSKGRYTTSTFFM 167

Query: 162 GLAIHFKIYPIIYTLP 177
            LA    IY I+  +P
Sbjct: 168 ALASSLSIYSILLVIP 183

>YER140W (YER140W) [1569] chr5 (451560..453230) Protein of unknown
           function, has low similarity to uncharacterized C.
           albicans Orf6.3303p [1671 bp, 556 aa]
          Length = 556

 Score = 29.3 bits (64), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 13/77 (16%)

Query: 99  MILALLEIPNKRRRLILASL--WLLNIMVITISTRGNAESVI---CFLVLLSLYFLRFGN 153
           M+ ++LE+ +K    +LASL   LL +M+    +R N+E ++   C LV +SL ++    
Sbjct: 186 MLFSVLEMADK----MLASLGQSLLTVML----SRKNSERILLHKCLLVSMSLTYVTIHG 237

Query: 154 YVLAGAVLGLAIHFKIY 170
           YVL    + L I    Y
Sbjct: 238 YVLVYQAISLNIAVNSY 254

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.333    0.145    0.464 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,406,604
Number of extensions: 451327
Number of successful extensions: 1062
Number of sequences better than 10.0: 18
Number of HSP's gapped: 1072
Number of HSP's successfully gapped: 18
Length of query: 391
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 287
Effective length of database: 12,995,837
Effective search space: 3729805219
Effective search space used: 3729805219
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (22.0 bits)
S2: 62 (28.5 bits)