Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_33.154481131135961e-81
Sklu_2075.21131062715e-32
KLLA0D09669g1351002327e-26
YJR012C207491812e-17
Scas_647.51161031387e-12
ACR033C95471262e-10
YGR261C (APL6)80932650.49
Kwal_33.1353977330621.2
CAGL0L07216g85842592.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.15448
         (113 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.15448                                                         234   1e-81
Sklu_2075.2 YJR012C, Contig c2075 940-1281                            108   5e-32
KLLA0D09669g 816343..816750 no similarity, hypothetical start          94   7e-26
YJR012C (YJR012C) [2915] chr10 complement(459709..460332) Protei...    74   2e-17
Scas_647.5                                                             58   7e-12
ACR033C [1081] [Homologous to ScYJR012C - SH] (420391..420678) [...    53   2e-10
YGR261C (APL6) [2207] chr7 complement(1014326..1016755) Beta-ada...    30   0.49 
Kwal_33.13539                                                          28   1.2  
CAGL0L07216g complement(799529..802105) similar to sp|P33775 Sac...    27   2.8  

>Kwal_33.15448
          Length = 113

 Score =  234 bits (596), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 113/113 (100%), Positives = 113/113 (100%)

Query: 1   MAGQQLTYEELVDHIINDKPVPNILAVPNITQDPSLITKSSLRPRAKPWEQKKEVTVTIE 60
           MAGQQLTYEELVDHIINDKPVPNILAVPNITQDPSLITKSSLRPRAKPWEQKKEVTVTIE
Sbjct: 1   MAGQQLTYEELVDHIINDKPVPNILAVPNITQDPSLITKSSLRPRAKPWEQKKEVTVTIE 60

Query: 61  GASDEAQAIDREAGAVSHSHSTESLSTYYAMETEFEQQMQSYLGGNEESRRSV 113
           GASDEAQAIDREAGAVSHSHSTESLSTYYAMETEFEQQMQSYLGGNEESRRSV
Sbjct: 61  GASDEAQAIDREAGAVSHSHSTESLSTYYAMETEFEQQMQSYLGGNEESRRSV 113

>Sklu_2075.2 YJR012C, Contig c2075 940-1281
          Length = 113

 Score =  108 bits (271), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 77/106 (72%), Gaps = 4/106 (3%)

Query: 3   GQQLTYEELVDHIINDKPVPNILAVPNITQDPSLITKSSLRPRAKPWEQKKEVTVTIEGA 62
            +QL+YEELVDHI+N+KPVPN+++VPNIT D S+ T+S L+PR KPWE+K +   T+E  
Sbjct: 2   NRQLSYEELVDHIVNNKPVPNVVSVPNITLDSSMRTESLLKPRLKPWERKAQ-GATVEEP 60

Query: 63  SD---EAQAIDREAGAVSHSHSTESLSTYYAMETEFEQQMQSYLGG 105
            +   +A+ I     +V+ + S ESLS YYA+E EFE+Q+Q ++ G
Sbjct: 61  QELIQKAKEITEHVESVNKTQSFESLSRYYAIEAEFEKQLQHFMDG 106

>KLLA0D09669g 816343..816750 no similarity, hypothetical start
          Length = 135

 Score = 94.0 bits (232), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 67/100 (67%), Gaps = 2/100 (2%)

Query: 5   QLTYEELVDHIINDKPVPNILAVPNITQDPSLITKSSLRPRAKPWEQKKEVTVT--IEGA 62
           +L+Y+EL+D I+N+KPVPN++ VP+I  D SL T+  L+PR KPWEQ K+V V   +   
Sbjct: 9   ELSYDELMDIIVNNKPVPNVVDVPDIILDQSLATEHHLKPRLKPWEQAKDVPVMGGLVRQ 68

Query: 63  SDEAQAIDREAGAVSHSHSTESLSTYYAMETEFEQQMQSY 102
            +E + +      V  S+S E L+ YYA+E EF++Q++ Y
Sbjct: 69  KEETKGLAENVELVKKSNSLEKLTNYYALEVEFQKQLKGY 108

>YJR012C (YJR012C) [2915] chr10 complement(459709..460332) Protein
           of unknown function [624 bp, 207 aa]
          Length = 207

 Score = 74.3 bits (181), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 40/49 (81%)

Query: 2   AGQQLTYEELVDHIINDKPVPNILAVPNITQDPSLITKSSLRPRAKPWE 50
           AG +L+YEEL+DHI+N+KP+PNI+ VPN+T D  L +  SLRPR +PWE
Sbjct: 78  AGGELSYEELLDHILNNKPIPNIVEVPNVTLDEGLASTPSLRPRPRPWE 126

>Scas_647.5
          Length = 116

 Score = 57.8 bits (138), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 59/103 (57%), Gaps = 14/103 (13%)

Query: 4   QQLTYEELVDHIINDKPVPNILAVPNITQDPSLITKSSLRPRAKPWEQKKEVTVTIEGAS 63
           ++L+Y++LV+HI+ +KP+PN++ VP+   D  L ++  L  R KPWEQ       +E A 
Sbjct: 3   EELSYDDLVEHIVLNKPIPNVVQVPDTVLDSKLGSQPRLTQRIKPWEQ-------VEVAG 55

Query: 64  DEAQAIDREAGAVSHSHST------ESLSTYYAMETEFEQQMQ 100
           +E    D   G V+ S ++      ++LS  YA+E ++   +Q
Sbjct: 56  EETPTNDN-FGLVNLSTNSDLSKDMDNLSKLYALEADYIATLQ 97

>ACR033C [1081] [Homologous to ScYJR012C - SH] (420391..420678)
          [288 bp, 95 aa]
          Length = 95

 Score = 53.1 bits (126), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%)

Query: 4  QQLTYEELVDHIINDKPVPNILAVPNITQDPSLITKSSLRPRAKPWE 50
          Q+L+Y++LVD I+N KPVPN++ V +   D S  ++S L PR KPWE
Sbjct: 15 QELSYDQLVDIIVNGKPVPNLVEVADQVHDESQCSESKLCPRKKPWE 61

>YGR261C (APL6) [2207] chr7 complement(1014326..1016755)
          Beta-adaptin, large subunit of the clathrin-associated
          protein (AP) complex [2430 bp, 809 aa]
          Length = 809

 Score = 29.6 bits (65), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 19/32 (59%)

Query: 59 IEGASDEAQAIDREAGAVSHSHSTESLSTYYA 90
          I  A D A+ I REA AV+ S   ES  TYY+
Sbjct: 8  IASALDTAKVITREAAAVATSKLGESSYTYYS 39

>Kwal_33.13539
          Length = 773

 Score = 28.5 bits (62), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 19/30 (63%)

Query: 26  AVPNITQDPSLITKSSLRPRAKPWEQKKEV 55
            +P   QD S +TKS L+   K W+Q+K++
Sbjct: 738 GLPTKNQDGSDVTKSMLKKLKKQWDQQKKL 767

>CAGL0L07216g complement(799529..802105) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase or sp|P52867 Saccharomyces
           cerevisiae YDL093w, hypothetical start
          Length = 858

 Score = 27.3 bits (59), Expect = 2.8,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 23  NILAVPNITQDPSLITKSSLRPRAKPWEQKKEVTVT-IEGAS 63
           N   VP IT D +     ++ P A+P +Q+K+  V+ + GA+
Sbjct: 753 NYTYVPKITTDEATTDVQNVVPAAEPEQQEKKAVVSDVNGAA 794

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.307    0.123    0.334 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,544,176
Number of extensions: 126468
Number of successful extensions: 438
Number of sequences better than 10.0: 24
Number of HSP's gapped: 436
Number of HSP's successfully gapped: 24
Length of query: 113
Length of database: 16,596,109
Length adjustment: 83
Effective length of query: 30
Effective length of database: 13,722,815
Effective search space: 411684450
Effective search space used: 411684450
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 54 (25.4 bits)