Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_33.1544630530115100.0
Sklu_2075.334529812731e-178
KLLA0E09680g30729412321e-172
CAGL0B03883g30630411061e-153
CAGL0K12210g3113043453e-38
CAGL0D01606g3052863165e-34
Sklu_1926.23052893103e-33
YOR130C (ORT1)2922913033e-32
Sklu_2398.43092833017e-32
Scas_718.53242912974e-31
KLLA0E02772g2842762875e-30
Scas_667.223062902878e-30
YPR058W (YMC1)3072912851e-29
YBR104W (YMC2)3293022825e-29
Kwal_33.129883032822744e-28
Kwal_27.125993042942711e-27
Sklu_2127.52782742691e-27
Kwal_26.86692962802702e-27
Sklu_1275.13112842712e-27
CAGL0K10362g3012892702e-27
Kwal_55.213353172722693e-27
KLLA0B08503g3032992684e-27
ACR109W2992832674e-27
Scas_632.92922982631e-26
KLLA0F17864g3073132598e-26
AFR146W2812732542e-25
Kwal_56.230113032792492e-24
YOR222W (ODC2)3073042474e-24
ADL264C3292912432e-23
CAGL0J02002g3612902433e-23
KLLA0D07073g2972842394e-23
Scas_640.253063102352e-22
ADL009W3792902363e-22
Scas_714.183053092324e-22
Kwal_23.29133203122264e-21
Scas_709.93652912275e-21
ADL049W9122862281e-20
YIL006W3732872232e-20
KLLA0C13431g3282952212e-20
CAGL0J04114g3032872193e-20
Kwal_55.208683802952197e-20
CAGL0K02365g9192902201e-19
KLLA0E13453g9062882156e-19
YOR100C (CRC1)3273032099e-19
Scas_589.103162942062e-18
CAGL0B04543g3173032053e-18
YPR021C (AGC1)9022892084e-18
Kwal_47.173218812892085e-18
Sklu_2431.53703192055e-18
Scas_697.473282992001e-17
YPL134C (ODC1)3102931964e-17
KLLA0E23705g3683041975e-17
Kwal_27.120813693001922e-16
KLLA0D14036g4313171933e-16
YEL006W3352871852e-15
Scas_721.273743431817e-15
Sklu_2359.69022991838e-15
Scas_602.88852971821e-14
AEL253W3652971791e-14
Kwal_23.39653071841772e-14
Kwal_23.47313142941728e-14
AGL311C3623111675e-13
Sklu_2334.23193201665e-13
KLLA0F04697g3073051612e-12
Sklu_2037.23102991594e-12
CAGL0G03135g3073091514e-11
CAGL0J05522g5191801535e-11
YNL083W5451801525e-11
KLLA0C11363g5171801517e-11
Kwal_55.213383231671499e-11
CAGL0F04213g3063011489e-11
Scas_578.3*5241801482e-10
Scas_718.243371571462e-10
AER419W4931791472e-10
Kwal_14.22103152941452e-10
ACR260W3112921452e-10
Kwal_27.124813041341453e-10
Kwal_26.76533253261444e-10
CAGL0K08250g2973011434e-10
Sklu_2363.23233181426e-10
CAGL0K11616g3201851426e-10
AER366W2931641426e-10
YBR085W (AAC3)3072991426e-10
Scas_691.43343241418e-10
YBL030C (PET9)3181851418e-10
Scas_582.73292871419e-10
KLLA0D15015g3171691419e-10
CAGL0G08910g2892981401e-09
Scas_667.43083021401e-09
Scas_379.23012871401e-09
Sklu_1149.22963101391e-09
AER184W3052871391e-09
Sklu_2432.52882701382e-09
KLLA0E12353g3051571382e-09
CAGL0M05225g3813081392e-09
CAGL0J01661g3273071382e-09
YMR056C (AAC1)3091781373e-09
YJR095W (SFC1)3223121355e-09
CAGL0L05742g3052921355e-09
KLLA0B12826g3192981346e-09
Kwal_23.30425421791367e-09
Scas_716.293163011347e-09
Scas_662.123083091338e-09
Scas_489.42971681331e-08
Scas_721.1293233051331e-08
Sklu_2433.84201051321e-08
Scas_328.12271641291e-08
YBR192W (RIM2)3773231322e-08
YJL133W (MRS3)3142841312e-08
KLLA0F03212g3053211302e-08
AGL065C3352221302e-08
CAGL0M09020g3483351302e-08
YKL120W (OAC1)3243041302e-08
Kwal_26.79672972941293e-08
CAGL0L02079g2973051274e-08
Kwal_23.35293952871286e-08
Scas_717.203562311251e-07
AFR147C3152511241e-07
YBR291C (CTP1)2993101241e-07
Kwal_47.182163333461241e-07
YPR011C3263001241e-07
AAR036W3173101241e-07
Sklu_2374.75131801251e-07
Scas_715.453051901232e-07
Sklu_2430.103241851213e-07
AGL047C3162931214e-07
Kwal_47.192282811021194e-07
KLLA0E18810g3772891196e-07
KLLA0A00979g3431081196e-07
Sklu_2115.42991801188e-07
Kwal_33.140503142941188e-07
CAGL0K02915g3423461188e-07
YKR052C (MRS4)3042811161e-06
YER053C3001831161e-06
AFR253W3441071161e-06
YIL134W (FLX1)3112931161e-06
YGR096W (TPC1)3141641152e-06
CAGL0F07711g3681681143e-06
AGR383W2931671115e-06
YMR166C3683111116e-06
YGR257C (MTM1)3663261116e-06
KLLA0E15532g3262991107e-06
Sklu_2260.53021951063e-05
Scas_687.15*3281021053e-05
Kwal_26.79723581791036e-05
Scas_613.241771681006e-05
AAL014C2712821027e-05
YHR002W (LEU5)357651028e-05
Sklu_2127.4323671019e-05
KLLA0D09889g3642981011e-04
CAGL0G01166g2952741001e-04
Scas_645.93912781011e-04
AGL064W2961391001e-04
Scas_669.63731911001e-04
CAGL0F00231g307199992e-04
Sklu_2435.2344223992e-04
AFR131C344208992e-04
YLR348C (DIC1)298276982e-04
AFL196W361160973e-04
YPR128C (ANT1)328288965e-04
YJR077C (MIR1)311181948e-04
CAGL0D04774g322203949e-04
KLLA0D04290g188179910.001
CAGL0F08305g374275930.001
Scas_705.9323174900.003
AFR542W310257890.003
Kwal_33.15597305199890.004
ABL023W30955880.004
CAGL0H10538g297172880.005
Kwal_27.11419298172870.005
KLLA0E08877g29447870.006
CAGL0C02013g329102870.006
KLLA0E18788g38170870.006
Kwal_55.21106328219870.007
ADR036C34041860.007
Kwal_34.15907312260860.007
KLLA0B11319g355133860.008
Scas_673.17314181860.008
AGR191W29862850.010
YFR045W28555840.011
Kwal_27.1162629965830.015
Scas_562.12300150820.021
YDL198C (YHM1)30065820.023
YNL003C (PET8)284283820.024
KLLA0D04312g10378770.025
KLLA0A09383g366207810.031
Sklu_2117.229865810.032
Kwal_23.435434387800.041
KLLA0B14454g305146790.048
YMR241W (YHM2)314256780.065
KLLA0F08547g308262780.067
Sklu_2194.3312256780.072
CAGL0J09790g30065780.077
KLLA0F13464g30065770.084
Scas_702.10302276770.084
Sklu_1119.1307146770.090
Sklu_2442.8275287760.13
Scas_696.9312290750.17
YDL119C307167750.18
KLLA0E02750g30468710.60
KLLA0D04950g274284690.81
Sklu_1982.347635690.99
AER450C308182681.2
CAGL0H03839g282292671.6
Scas_558.228985662.1
Kwal_27.991226657652.5
CAGL0K07436g307173643.6
Kwal_23.5757307179644.0
Kwal_0.232274195626.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.15446
         (301 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.15446                                                         586   0.0  
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement               494   e-178
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...   479   e-172
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...   430   e-153
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...   137   3e-38
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...   126   5e-34
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement         124   3e-33
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...   121   3e-32
Sklu_2398.4 , Contig c2398 9476-10405                                 120   7e-32
Scas_718.5                                                            119   4e-31
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...   115   5e-30
Scas_667.22                                                           115   8e-30
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...   114   1e-29
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...   113   5e-29
Kwal_33.12988                                                         110   4e-28
Kwal_27.12599                                                         108   1e-27
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement        108   1e-27
Kwal_26.8669                                                          108   2e-27
Sklu_1275.1 , Contig c1275 314-1249                                   108   2e-27
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...   108   2e-27
Kwal_55.21335                                                         108   3e-27
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...   107   4e-27
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...   107   4e-27
Scas_632.9                                                            105   1e-26
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...   104   8e-26
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...   102   2e-25
Kwal_56.23011                                                         100   2e-24
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...   100   4e-24
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    98   2e-23
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    98   3e-23
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    97   4e-23
Scas_640.25                                                            95   2e-22
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    96   3e-22
Scas_714.18                                                            94   4e-22
Kwal_23.2913                                                           92   4e-21
Scas_709.9                                                             92   5e-21
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....    92   1e-20
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    91   2e-20
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    90   2e-20
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    89   3e-20
Kwal_55.20868                                                          89   7e-20
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...    89   1e-19
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...    87   6e-19
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    85   9e-19
Scas_589.10                                                            84   2e-18
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    84   3e-18
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...    85   4e-18
Kwal_47.17321                                                          85   5e-18
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            84   5e-18
Scas_697.47                                                            82   1e-17
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    80   4e-17
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    80   5e-17
Kwal_27.12081                                                          79   2e-16
KLLA0D14036g complement(1203522..1204817) some similarities with...    79   3e-16
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    76   2e-15
Scas_721.27                                                            74   7e-15
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                          75   8e-15
Scas_602.8                                                             75   1e-14
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    74   1e-14
Kwal_23.3965                                                           73   2e-14
Kwal_23.4731                                                           71   8e-14
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...    69   5e-13
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement         69   5e-13
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    67   2e-12
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         66   4e-12
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    63   4e-11
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    64   5e-11
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    63   5e-11
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    63   7e-11
Kwal_55.21338                                                          62   9e-11
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    62   9e-11
Scas_578.3*                                                            62   2e-10
Scas_718.24                                                            61   2e-10
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    61   2e-10
Kwal_14.2210                                                           60   2e-10
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    60   2e-10
Kwal_27.12481                                                          60   3e-10
Kwal_26.7653                                                           60   4e-10
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    60   4e-10
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          59   6e-10
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    59   6e-10
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    59   6e-10
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    59   6e-10
Scas_691.4                                                             59   8e-10
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    59   8e-10
Scas_582.7                                                             59   9e-10
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    59   9e-10
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    59   1e-09
Scas_667.4                                                             59   1e-09
Scas_379.2                                                             59   1e-09
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         58   1e-09
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    58   1e-09
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       58   2e-09
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    58   2e-09
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    58   2e-09
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    58   2e-09
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    57   3e-09
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...    57   5e-09
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    57   5e-09
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    56   6e-09
Kwal_23.3042                                                           57   7e-09
Scas_716.29                                                            56   7e-09
Scas_662.12                                                            56   8e-09
Scas_489.4                                                             56   1e-08
Scas_721.129                                                           56   1e-08
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       55   1e-08
Scas_328.1                                                             54   1e-08
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    55   2e-08
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    55   2e-08
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    55   2e-08
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    55   2e-08
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    55   2e-08
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    55   2e-08
Kwal_26.7967                                                           54   3e-08
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    54   4e-08
Kwal_23.3529                                                           54   6e-08
Scas_717.20                                                            53   1e-07
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    52   1e-07
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    52   1e-07
Kwal_47.18216                                                          52   1e-07
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    52   1e-07
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    52   1e-07
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       53   1e-07
Scas_715.45                                                            52   2e-07
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         51   3e-07
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    51   4e-07
Kwal_47.19228                                                          50   4e-07
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    50   6e-07
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    50   6e-07
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            50   8e-07
Kwal_33.14050                                                          50   8e-07
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    50   8e-07
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    49   1e-06
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    49   1e-06
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    49   1e-06
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    49   1e-06
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    49   2e-06
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    49   3e-06
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    47   5e-06
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    47   6e-06
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    47   6e-06
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    47   7e-06
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         45   3e-05
Scas_687.15*                                                           45   3e-05
Kwal_26.7972                                                           44   6e-05
Scas_613.24                                                            43   6e-05
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    44   7e-05
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    44   8e-05
Sklu_2127.4 , Contig c2127 6322-7293                                   44   9e-05
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    44   1e-04
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    43   1e-04
Scas_645.9                                                             44   1e-04
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    43   1e-04
Scas_669.6                                                             43   1e-04
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    43   2e-04
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         43   2e-04
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    43   2e-04
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    42   2e-04
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    42   3e-04
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    42   5e-04
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    41   8e-04
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    41   9e-04
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    40   0.001
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    40   0.001
Scas_705.9                                                             39   0.003
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    39   0.003
Kwal_33.15597                                                          39   0.004
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    39   0.004
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    39   0.005
Kwal_27.11419                                                          38   0.005
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    38   0.006
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    38   0.006
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    38   0.006
Kwal_55.21106                                                          38   0.007
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    38   0.007
Kwal_34.15907                                                          38   0.007
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    38   0.008
Scas_673.17                                                            38   0.008
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    37   0.010
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    37   0.011
Kwal_27.11626                                                          37   0.015
Scas_562.12                                                            36   0.021
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    36   0.023
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    36   0.024
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    34   0.025
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    36   0.031
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            36   0.032
Kwal_23.4354                                                           35   0.041
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    35   0.048
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    35   0.065
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    35   0.067
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            35   0.072
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    35   0.077
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    34   0.084
Scas_702.10                                                            34   0.084
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             34   0.090
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          34   0.13 
Scas_696.9                                                             33   0.17 
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    33   0.18 
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    32   0.60 
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    31   0.81 
Sklu_1982.3 YDL238C, Contig c1982 3793-5223                            31   0.99 
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    31   1.2  
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    30   1.6  
Scas_558.2                                                             30   2.1  
Kwal_27.9912                                                           30   2.5  
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    29   3.6  
Kwal_23.5757                                                           29   4.0  
Kwal_0.232                                                             28   6.5  

>Kwal_33.15446
          Length = 305

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/301 (95%), Positives = 286/301 (95%)

Query: 1   MSSRSDSNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLD 60
           MSSRSDSNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLD
Sbjct: 1   MSSRSDSNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLD 60

Query: 61  CVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCI 120
           CVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCI
Sbjct: 61  CVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCI 120

Query: 121 LSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVS 180
           LSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVS
Sbjct: 121 LSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVS 180

Query: 181 TLIFRTHFVYWWGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVI 240
           TLIFRTHFVYWWGSYELLTRWFKANTNLSDTAIN               AYPSDVIKQVI
Sbjct: 181 TLIFRTHFVYWWGSYELLTRWFKANTNLSDTAINFWAGGFSASFGFWTTAYPSDVIKQVI 240

Query: 241 LCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRVSGA 300
           LCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRVSGA
Sbjct: 241 LCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRVSGA 300

Query: 301 K 301
           K
Sbjct: 301 K 301

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score =  494 bits (1273), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 242/298 (81%), Positives = 266/298 (89%)

Query: 4   RSDSNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVY 63
           +SD     P+EAYSR+MGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQD+ RFKGPLDCVY
Sbjct: 46  KSDIQQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVY 105

Query: 64  QTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSG 123
           +T  QQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVY +EEKLPLSGCI+SG
Sbjct: 106 KTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISG 165

Query: 124 VLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183
           V+AGWSVSFIAAPVELAKAKLQVQYDA+TT+Y GP+DVIKKVY+++G+RG+YKGL STLI
Sbjct: 166 VMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225

Query: 184 FRTHFVYWWGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCN 243
           FRT+FV+WWGSYELLTRWFK +TN+SDTAIN               AYPSDVIKQV+LCN
Sbjct: 226 FRTNFVFWWGSYELLTRWFKEHTNMSDTAINFWSGGFSASFGFWTTAYPSDVIKQVVLCN 285

Query: 244 DKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRVSGAK 301
           DKYDG+ RSW+ AA DIWRTRG RGFFKGFVPSFLRSFPANAAALA+FEFVLR SGAK
Sbjct: 286 DKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPANAAALAAFEFVLRTSGAK 343

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score =  479 bits (1232), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 228/294 (77%), Positives = 258/294 (87%)

Query: 8   NAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMR 67
           N+++ NE YSR+MGFV+G+FSG+AKNAVGHPFDTIKVRLQTSQ+  RFKGPLDCVY+T R
Sbjct: 13  NSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFR 72

Query: 68  QQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAG 127
            QGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRML+ KYVY ++EKLPLSGCI+SGVLAG
Sbjct: 73  NQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAG 132

Query: 128 WSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTH 187
           WSVSFIA P+ELAKAKLQVQYD  TTRY+GPLDVIKK+Y+A GIRG+YKGL+STLIFRTH
Sbjct: 133 WSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTH 192

Query: 188 FVYWWGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYD 247
           FVYWWGSYELLTRWF+ NT +S+ AIN               AYPSDV+KQV+LCNDKYD
Sbjct: 193 FVYWWGSYELLTRWFRENTKMSEAAINFWAGGFSASFGFWTTAYPSDVVKQVVLCNDKYD 252

Query: 248 GSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRVSGAK 301
           GS +SWR A  DI++++GI GFFKGFVPSFLRSFPANAAALA+FEFVLR SGAK
Sbjct: 253 GSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPANAAALAAFEFVLRTSGAK 306

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score =  430 bits (1106), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 212/304 (69%), Positives = 249/304 (81%), Gaps = 12/304 (3%)

Query: 10  VVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQ-DTG---RFKGPLDCVYQT 65
           +V  E YSR+MGFV+GMFSG+AKN VGHPFDT+KVRLQTSQ  +G   +FKGPLDCVY+T
Sbjct: 1   MVSEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKT 60

Query: 66  MRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVL 125
           ++ QGIRG YLGFTPPL GWI+MDS +LG LHNYRMLL KYVY   +KLPLSGCI+SGV+
Sbjct: 61  LKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVM 120

Query: 126 AGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAA--------DGIRGMYKG 177
           AGW+VSFIAAPVELAKAKLQVQYDA+TT+Y GP+DV++KV+           G+R +YKG
Sbjct: 121 AGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKG 180

Query: 178 LVSTLIFRTHFVYWWGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIK 237
           L+STLIFR++FV+WWGSYEL+T+WF+ NTNLS  AIN               AYPSDV+K
Sbjct: 181 LISTLIFRSNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVK 240

Query: 238 QVILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRV 297
           QV+LCNDKYDGS +SWR A SDI+R RGI GFFKGF+PSFLRSFPANAAALA+FEFVLR 
Sbjct: 241 QVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPANAAALAAFEFVLRT 300

Query: 298 SGAK 301
           SGAK
Sbjct: 301 SGAK 304

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score =  137 bits (345), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 101/304 (33%), Positives = 148/304 (48%), Gaps = 23/304 (7%)

Query: 10  VVPNEAYSRMMGFV-SGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQ 68
           V P   Y R++  + +G   G+A+  VG PFDT KVRLQTS+      G ++ V   +R 
Sbjct: 17  VPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK---IGVIEVVQNLLRN 73

Query: 69  QGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVY-----QHEEKLPLSGCILSG 123
           +G   FY G   PL+G  +  SV  G   + +     Y       Q    LPL    L G
Sbjct: 74  EGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCG 133

Query: 124 VLAGWSVSFIAAPVELAKAKLQVQYDAQTTR-YRGPLDVIKKVYAADGIRGMYKGLVSTL 182
           +  G   SF+AAP+E  + +LQ Q      R ++GP D IKK+  A   + + +GL+ T+
Sbjct: 134 LTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA---KALMRGLLPTM 190

Query: 183 IFRTHFV-YWWGSYE-LLTRWFKANTNLSDT-AINXXXXXXXXXXXXXXXAYPSDVIKQV 239
           I   H +  ++ +YE L+ + F+  T  +   A                  YP DV+K V
Sbjct: 191 IRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSV 250

Query: 240 I----LCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVL 295
           +    + N KY  S+     A   +++  GI  FFKGFVP+ +R+ PANAA   SFE  +
Sbjct: 251 LQTDSIENPKYKNSII---KATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEMTM 307

Query: 296 RVSG 299
           RV G
Sbjct: 308 RVLG 311

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score =  126 bits (316), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 87/286 (30%), Positives = 135/286 (47%), Gaps = 17/286 (5%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPP 81
            ++G   GIA+  +G PFDT KVRLQTS+         + V   ++ +G +GFY G   P
Sbjct: 29  LLAGTAGGIAQVLIGQPFDTTKVRLQTSKVP---TSAAEVVKNLLKNEGPKGFYKGTLTP 85

Query: 82  LVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAK 141
           LVG     S+  G     +         H   L LS   L G+  G + SF+A+P+E  +
Sbjct: 86  LVGVGACVSIQFGVNEAMKRFFHARNVDHNATLSLSQYYLCGLTGGMTNSFLASPIEHVR 145

Query: 142 AKLQVQY-DAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFV-YWWGSYELLT 199
            +LQ Q        ++GP+D IKK+ +    +G+ +GL+ T++   H    ++  YE L 
Sbjct: 146 IRLQTQTGSGAQAEFKGPIDCIKKLRSQ---KGLMRGLIPTMLREGHGCGTYFLVYEALV 202

Query: 200 RWFKANTNLSDTAI---NXXXXXXXXXXXXXXXAYPSDVIKQVILC---NDKYDGSLRSW 253
              + N  L  T I                    YP DV+K V+     N   +G  ++ 
Sbjct: 203 SK-QINQGLKRTEIPPWKLCLYGALSGTALWLMVYPIDVVKSVMQTDNLNKPQNG--KNM 259

Query: 254 RNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRVSG 299
              A +++   G++ FFKGF P+ LR+ PAN    A+FE  +R+ G
Sbjct: 260 IQVARNLYAREGLKAFFKGFGPTMLRAAPANGGTFATFELAMRLLG 305

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score =  124 bits (310), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 93/289 (32%), Positives = 135/289 (46%), Gaps = 21/289 (7%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPP 81
            ++G   G+++  +G PFDT KVRLQTS         LD V + ++ +G RGFY G   P
Sbjct: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVP---TTALDVVKKLVKNEGFRGFYKGTLTP 83

Query: 82  LVGWILMDSVMLGCLHNYRMLLKKYVYQHE------EKLPLSGCILSGVLAGWSVSFIAA 135
           LVG     SV  G   N  M  K++ +         E L L    L G   G + SF+A+
Sbjct: 84  LVGVGACVSVQFGV--NEAM--KRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLAS 139

Query: 136 PVELAKAKLQVQY-DAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHF--VYWW 192
           P+E  + +LQ Q       ++ GPLD IKK+ A +    + +GL  T++  +H   VY+ 
Sbjct: 140 PIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNS---LMRGLTPTMLRESHGCGVYFL 196

Query: 193 GSYELLTRWFKANTNLSDTAI-NXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSL- 250
               L+        + S+                     YP DVIK V+  +        
Sbjct: 197 TYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQG 256

Query: 251 RSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRVSG 299
           ++    A  I+ TRG+  FFKGF P+ LR+ PAN A  A+FE  +RV G
Sbjct: 257 KNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVLG 305

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 81/178 (45%), Gaps = 13/178 (7%)

Query: 12  PNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTG---RFKGPLDCVYQTMRQ 68
           PNE    +  ++ G   G A + +  P + +++RLQT   TG   +F GPLDC+ +    
Sbjct: 114 PNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTAN 173

Query: 69  QGIRGFYLGFTPPLVGWILMDSVMLGC-LHNYRMLLKKYVYQ--HEEKLPLSGCILSGVL 125
             +     G TP +    L +S   G     Y  L+   +++     ++P     L G  
Sbjct: 174 NSL---MRGLTPTM----LRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGAT 226

Query: 126 AGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183
           +G ++  +  P+++ K+ +Q     Q  + +  L V K +Y+  G+   +KG   T++
Sbjct: 227 SGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTML 284

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score =  121 bits (303), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 86/291 (29%), Positives = 133/291 (45%), Gaps = 34/291 (11%)

Query: 19  MMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGI-RGFYLG 77
           ++  ++G  +G     +  PFDT+KVRLQT Q +  F     C+  T + +GI RGF+ G
Sbjct: 14  ILDIINGSIAGACGKVIEFPFDTVKVRLQT-QASNVFPTTWSCIKFTYQNEGIARGFFQG 72

Query: 78  FTPPLVGWILMDSVMLGCLHNYRMLLK-----KYVYQHEEKLPLSGCILSGVLAGWSVSF 132
              PLVG          CL N  + +      K++ +H    PL   ++SG +AG   S 
Sbjct: 73  IASPLVG---------ACLENATLFVSYNQCSKFLEKHTNVFPLGQILISGGVAGSCASL 123

Query: 133 IAAPVELAKAKLQV---QYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHF- 188
           +  PVEL K KLQV   Q  +  T++   L  IK +    G+ G+++G   T I R  F 
Sbjct: 124 VLTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFI-RESFG 182

Query: 189 -VYWWGSYELLTRWFKANTNLSDTAINXXX------XXXXXXXXXXXXAYPSDVIKQVIL 241
            V W+ +YE++ +  K   +L D   +                      +P+D +K V+ 
Sbjct: 183 GVAWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSVMQ 242

Query: 242 CNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFE 292
                     S  NA   I+   G++GF++G   +  R+ PANAA    FE
Sbjct: 243 TEH------ISLTNAVKKIFGKFGLKGFYRGLGITLFRAVPANAAVFYIFE 287

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score =  120 bits (301), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 89/283 (31%), Positives = 135/283 (47%), Gaps = 15/283 (5%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPP 81
            +SG   GIA+  VG PFD  KVR+QTS  +      +D V   ++ +GI GFY G   P
Sbjct: 27  ILSGTAGGIAQVLVGQPFDITKVRMQTSAGSAT---AVDVVTSLIKNEGILGFYKGTLAP 83

Query: 82  LVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAK 141
           LVG     S   G     +   ++      + L L    + GV +G + +F+A P+E  +
Sbjct: 84  LVGVGACVSCQFGVNEAMKRRFRRMNGDPSKPLSLKQYYVCGVASGCANAFLATPIEHVR 143

Query: 142 AKLQVQYDA-QTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTH-FVYWWGSYE-LL 198
            +LQ+Q  +     Y+G LD ++K+        + +G  +TL+   H F  ++ +YE L+
Sbjct: 144 IRLQLQTKSLANAEYQGSLDCMRKLLKQGA---LMRGFTATLMRTCHGFGIYFSTYEALI 200

Query: 199 TRWFKANTNLSDTAI-NXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSLRS---WR 254
               K      D A                  AYP DV+K  I+ +D+    +     W+
Sbjct: 201 ANQHKKGIPRKDIAPWKVCIFGAFSGACYWAMAYPIDVVKS-IMQSDRLVSPVHGTNVWQ 259

Query: 255 NAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRV 297
            A S I+ TRG R F KGF+P+ LRS P N A  A+FE  +R+
Sbjct: 260 VAKS-IYTTRGKRAFIKGFMPAMLRSLPVNGATFATFEMTMRL 301

>Scas_718.5
          Length = 324

 Score =  119 bits (297), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 87/291 (29%), Positives = 143/291 (49%), Gaps = 22/291 (7%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPP 81
            ++G   GI++  VG PFDT KVR+QTS  +    G LD + + ++ +G+  FY G   P
Sbjct: 43  ILAGTCGGISQVIVGQPFDTTKVRMQTSAKS---VGALDIIRKLVKNEGVWAFYKGSLIP 99

Query: 82  LVGWILMDSVMLGCLHNYRMLLKKYVY----QHEE-KLPLSGCILSGVLAGWSVSFIAAP 136
           +VG     SV  G     +   +++      QH +  L L    + G+  G   SF+A+P
Sbjct: 100 IVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASP 159

Query: 137 VELAKAKLQVQYDAQTTR-YRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFV-YWWGS 194
           +E  + +LQ Q      R ++GPLD I+K+      + + +GL   ++   H +  ++ +
Sbjct: 160 IEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGHGLGCYFLT 216

Query: 195 YE-LLTRWFKANTNLSDTAI-NXXXXXXXXXXXXXXXAYPSDVIKQVI----LCNDKYDG 248
           YE L+    K   + S+ A                   YP DV+K +I    L N ++  
Sbjct: 217 YEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKN 276

Query: 249 SLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRVSG 299
           S++   N  + ++R +GI  FFKGF P+ LR+ P N A   +FE V+R+ G
Sbjct: 277 SMK---NVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLLG 324

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score =  115 bits (287), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 83/276 (30%), Positives = 126/276 (45%), Gaps = 19/276 (6%)

Query: 25  GMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGI-RGFYLGFTPPLV 83
           G  +G     + +PFDT+KVRLQT Q    +     C+  T   +GI +GFY G   PL 
Sbjct: 14  GSVAGAIGKVIEYPFDTVKVRLQT-QPAHLYPTTWSCIRSTYTDEGIWKGFYQGIASPLF 72

Query: 84  GWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAK 143
           G  L ++V+    +     L ++     +  PL+  I SG  AG   SFI  PVEL K K
Sbjct: 73  GAALENAVLFVSFNQCTNFLDEFT----QLKPLTKTIYSGAFAGACASFILTPVELVKCK 128

Query: 144 LQVQYD----AQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRT-HFVYWWGSYELL 198
           LQV       +QTTR+      IK V    G+ G+++G +ST +        W+ +YE++
Sbjct: 129 LQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAVWFTTYEIM 188

Query: 199 TRWFKA--NTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSLRSWRNA 256
              F +       +                    +P+D +K V  C  ++     S  NA
Sbjct: 189 KMKFASLHPAEKENHTWELLVSGASAGVLFNASVFPADTVKSV--CQTEH----VSIVNA 242

Query: 257 ASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFE 292
              + RT GI GF++G   + +R+ PANA    ++E
Sbjct: 243 LKKVLRTHGITGFYRGLGITLIRAAPANATVFYTYE 278

>Scas_667.22
          Length = 306

 Score =  115 bits (287), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 89/290 (30%), Positives = 132/290 (45%), Gaps = 24/290 (8%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPP 81
            ++G   GIA+  VG PFDT KVRLQTS         ++ + + ++ +G +GFY G   P
Sbjct: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP---TTAMEVIRKLLKNEGPKGFYKGTLTP 85

Query: 82  LVGWILMDSVMLGCLHNY-RMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELA 140
           L+G     S+  G      R    +      + L L    + G+  G + SF+A+P+E  
Sbjct: 86  LIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHV 145

Query: 141 KAKLQVQY-DAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYWWGSYELLT 199
           + +LQ Q        ++GPLD I+K+ A  G     +GL  T++   H     G+Y L+ 
Sbjct: 146 RIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGF---MRGLTPTMLREGH---GCGTYFLVY 199

Query: 200 RWFKANT------NLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVI----LCNDKYDGS 249
               AN            A                  YP DVIK V+    L + KY  S
Sbjct: 200 EAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNS 259

Query: 250 LRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRVSG 299
           + S    A  ++   G+  FFKGF P+ LR+ PAN A  A+FE  +R+ G
Sbjct: 260 ISS---VAKTLYAKGGLGAFFKGFGPTMLRAAPANGATFATFELAMRLLG 306

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score =  114 bits (285), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 88/291 (30%), Positives = 129/291 (44%), Gaps = 25/291 (8%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPP 81
            ++G   GIA+  VG PFDT KVRLQTS         ++ V + +  +G RGFY G   P
Sbjct: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP---TTAMEVVRKLLANEGPRGFYKGTLTP 85

Query: 82  LVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAK 141
           L+G     S+  G     +             L L      GV  G   SF+A+P+E  +
Sbjct: 86  LIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVR 145

Query: 142 AKLQVQYDAQTT-RYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYWWGSYELLTR 200
            +LQ Q  + T   ++GPL+ IKK+      + + +GL  T++   H     G+Y L+  
Sbjct: 146 IRLQTQTGSGTNAEFKGPLECIKKLRHN---KALLRGLTPTILREGH---GCGTYFLVYE 199

Query: 201 WFKANTNLSDTAINXXXXX--------XXXXXXXXXXAYPSDVIKQVILCND----KYDG 248
              AN       +                         YP DVIK V+  ++    K+  
Sbjct: 200 ALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGN 259

Query: 249 SLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRVSG 299
           S+ S    A  ++   GI  FFKGF P+ LR+ PAN A  A+FE  +R+ G
Sbjct: 260 SISS---VAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELAMRLLG 307

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score =  113 bits (282), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 94/302 (31%), Positives = 133/302 (44%), Gaps = 36/302 (11%)

Query: 24  SGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLV 83
           +G   GIA+  VG PFDT KVRLQT+         L+ +   ++ +G+  FY G   PL+
Sbjct: 40  AGTIGGIAQVLVGQPFDTTKVRLQTATTRTTT---LEVLRNLVKNEGVFAFYKGALTPLL 96

Query: 84  GWILMDSVMLGCLHNYRMLLKKYV-------------YQHEEKLPLSGCILSGVLAGWSV 130
           G  +  SV  G     +   + Y                    LPLS   + G+  G   
Sbjct: 97  GVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVN 156

Query: 131 SFIAAPVELAKAKLQVQYDAQTTR-YRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFV 189
           SF+A+P+E  + +LQ Q      R ++GP D IKK+ A  G   + +GL  T+I   H  
Sbjct: 157 SFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGG---LMRGLFPTMIRAGH-- 211

Query: 190 YWWGSYELLTRWFKA---NTNLSDTAI---NXXXXXXXXXXXXXXXAYPSDVIKQVILCN 243
              G+Y L+     A    T L+   I                    YP DV+K +I  +
Sbjct: 212 -GLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQND 270

Query: 244 D----KYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRVSG 299
           D    KY  S+      A  I+   GIR FFKGF P+ +RS P N A   +FE V+R  G
Sbjct: 271 DLRKPKYKNSISY---VAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMRFLG 327

Query: 300 AK 301
            +
Sbjct: 328 EE 329

>Kwal_33.12988
          Length = 303

 Score =  110 bits (274), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 86/282 (30%), Positives = 125/282 (44%), Gaps = 13/282 (4%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPP 81
             +G   GIA+  VG PFD  KVRLQTS         L  V   ++ +G+RGFY G T P
Sbjct: 27  ITAGTTGGIAQVLVGQPFDITKVRLQTSSTP---TTALRVVQDLVKNEGLRGFYKGTTLP 83

Query: 82  LVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAK 141
           L+G  L  S   G     +    K        L L      G ++G + +F+A P+E  +
Sbjct: 84  LIGVGLCVSSQFGTNEAMKRYFHKRNNFQSTSLRLPEYYACGFVSGCANAFLATPIEHVR 143

Query: 142 AKLQVQYDAQT-TRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTH-FVYWWGSYE--L 197
             LQVQ  ++    Y+G +D IKK+        + +G   T++  +H F  ++ SYE  +
Sbjct: 144 ILLQVQTKSRADAEYQGAMDCIKKLLKEGK---LMRGFTPTILRTSHGFGVYFTSYEAMI 200

Query: 198 LTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSLRSWR--N 255
            +   K        A                  YP DVIK V + +DK    +       
Sbjct: 201 CSEQRKGIARKDIPAWKLCLYGAFSGSLLWAMVYPFDVIKSV-MQSDKLRTPVYGTNVFQ 259

Query: 256 AASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRV 297
            A +I+  RG + F KGF P+ LRS P N A   +FE  +R+
Sbjct: 260 VAKNIYNERGPKAFVKGFGPTMLRSLPVNGATFTAFEMAMRI 301

>Kwal_27.12599
          Length = 304

 Score =  108 bits (271), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 86/294 (29%), Positives = 133/294 (45%), Gaps = 13/294 (4%)

Query: 12  PNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGI 71
           P+++   +   ++G   G+A+  VG PFDT KVRLQTS         ++ V + ++ +G+
Sbjct: 18  PHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTP---TTAVEVVKKLVKNEGL 74

Query: 72  RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVS 131
           RGFY G   PLVG     S   G     +   +       + L L    + G + G + S
Sbjct: 75  RGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANS 134

Query: 132 FIAAPVELAKAKLQVQYDAQTT-RYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTH-FV 189
           F+A+P+E  + +LQ Q  + T   ++GPLD I K+ A      + +GL  T++       
Sbjct: 135 FLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANG---ALMRGLSPTILREAQGCA 191

Query: 190 YWWGSYE-LLTRWFKANTNLSDT-AINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYD 247
            ++ +YE L+          SD  A                  YP DVIK  ++  D   
Sbjct: 192 TYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKS-LMQTDNLK 250

Query: 248 GSLRSWR--NAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRVSG 299
             +R       A  +    G + FFKGF P+ LR+ PAN A  A+FE  +R  G
Sbjct: 251 NPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAMRFLG 304

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score =  108 bits (269), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 84/274 (30%), Positives = 126/274 (45%), Gaps = 19/274 (6%)

Query: 25  GMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGI-RGFYLGFTPPLV 83
           G  +G     + +PFDT+KVRLQT Q    F     C+  T   +G+ RGFY G   PL 
Sbjct: 13  GSIAGAVGKVIEYPFDTVKVRLQT-QPAHMFPTTWSCIKFTYDNEGLWRGFYQGIGSPLA 71

Query: 84  GWILMDSVMLGCLHNYRMLLKKYVYQHEEKL--PLSGCILSGVLAGWSVSFIAAPVELAK 141
           G  L ++V+    +  + LL        E L  PLS  + +G  AG   SF+  PVEL K
Sbjct: 72  GAALENAVLFVSFNQAKRLLDV------ESLLSPLSKTVWAGAFAGACASFVLTPVELIK 125

Query: 142 AKLQVQYDAQT-TRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRT-HFVYWWGSYELLT 199
            KLQV   + T T +   L  IK V +  G  G+++G   T I  +     W+ +YE++ 
Sbjct: 126 CKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTYEVVK 185

Query: 200 RWFKANTNLS-DTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSLRSWRNAAS 258
            +  +      +T                   +P+D IK   +  D  D S     +A  
Sbjct: 186 NYLASRRQAEQNTTWELLASGASAGLAFNASIFPADTIKST-MQTDHIDLS-----SATR 239

Query: 259 DIWRTRGIRGFFKGFVPSFLRSFPANAAALASFE 292
            I+  +GI GF++G   + +R+ PANAA   ++E
Sbjct: 240 KIYARQGIAGFYRGLGITLIRAVPANAAIFYTYE 273

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 68/171 (39%), Gaps = 28/171 (16%)

Query: 24  SGMFSGIAKNAVGHPFDTIKVRLQTSQ----DTGRFKGPLDCVYQTMRQQGIRGFYLGFT 79
           +G F+G   + V  P + IK +LQ S      T   K  L  +   + ++G  G + G +
Sbjct: 106 AGAFAGACASFVLTPVELIKCKLQVSNLSTTKTSHTK-ILPTIKSVLSERGFLGLWQGQS 164

Query: 80  PPLV-------GWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSF 132
              +        W     V+   L + R   +   ++          + SG  AG + + 
Sbjct: 165 GTFIRESGGGAAWFTTYEVVKNYLASRRQAEQNTTWE---------LLASGASAGLAFNA 215

Query: 133 IAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183
              P +  K+ +Q  +   ++  R       K+YA  GI G Y+GL  TLI
Sbjct: 216 SIFPADTIKSTMQTDHIDLSSATR-------KIYARQGIAGFYRGLGITLI 259

>Kwal_26.8669
          Length = 296

 Score =  108 bits (270), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 82/280 (29%), Positives = 129/280 (46%), Gaps = 19/280 (6%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTG---RFKGPLDCVYQTMRQQGIRGFYLGF 78
           F +G  +GI++  V +P D +K R+Q     G   ++KG +DC+ Q + ++G    Y G 
Sbjct: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGI 72

Query: 79  TPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVE 138
           + P++      +    C   ++ + K+      EKL  S  ILSG  AG   +F+  P E
Sbjct: 73  SSPVLMEAPKRATKFACNDEFQKIYKREF--GVEKLTQSLSILSGASAGCCEAFVVVPFE 130

Query: 139 LAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYWWGSYELL 198
           L K +LQ   D  ++ Y+GP+DV++K+ A +G+  MY GL STL    H V+  G + ++
Sbjct: 131 LVKIRLQ---DVSSS-YKGPIDVVRKIIAQEGVLAMYNGLESTL--WRHGVWNAGYFGII 184

Query: 199 TR---WFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSLR---- 251
            +         + S    N               + P DV+K  I       G  R    
Sbjct: 185 FQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNW 244

Query: 252 SWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASF 291
           SW +  + I++  G R  +KGFVP  LR  P     L  F
Sbjct: 245 SWPSIFT-IYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 81/172 (47%), Gaps = 7/172 (4%)

Query: 14  EAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRG 73
           E  ++ +  +SG  +G  +  V  PF+ +K+RLQ    +  +KGP+D V + + Q+G+  
Sbjct: 104 EKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSS--YKGPIDVVRKIIAQEGVLA 161

Query: 74  FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFI 133
            Y G    L    + ++   G +   R LL +   + ++       +++G + G   S +
Sbjct: 162 MYNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQT---RNDLIAGSIGGTIGSLM 218

Query: 134 AAPVELAKAKLQ--VQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183
           + P ++ K+++Q          +Y      I  +Y  +G R +YKG V  ++
Sbjct: 219 STPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVL 270

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 114 LPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQT-TRYRGPLDVIKKVYAADGIR 172
           LP      +G +AG S   +  P+++ K ++Q+Q       +Y+G +D IK++ A +G  
Sbjct: 7   LPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGAS 66

Query: 173 GMYKGLVSTLIFR 185
            +YKG+ S ++  
Sbjct: 67  RLYKGISSPVLME 79

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score =  108 bits (271), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 86/284 (30%), Positives = 131/284 (46%), Gaps = 19/284 (6%)

Query: 23  VSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPL 82
           +SG   GIA+  VG PFD  KVR+QTS  +      ++ +   ++ +G+  FY G   PL
Sbjct: 28  ISGTSGGIAQVLVGQPFDITKVRMQTSSGS---PTAIEVIKNLVKNEGLLAFYKGTLVPL 84

Query: 83  VGWILMDSVMLG---CLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVEL 139
           +G     S   G    +  Y + +  Y  QH   L    C   G ++G + +F+A P+E 
Sbjct: 85  IGVGACVSCQFGVNEAMKRYFLRVNGYKDQHLSLLQYYTC---GFVSGSANAFLATPIEH 141

Query: 140 AKAKLQVQYDA-QTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTH-FVYWWGSYEL 197
            + +LQ+Q  A     YRG LD +KK+      + + +G  +TL+  +H F  ++ +YE 
Sbjct: 142 VRIRLQLQTKALAKAEYRGSLDCMKKLLKQ---KALMRGFTATLMRTSHGFGVYFLTYEA 198

Query: 198 LTRWFKANTNLSDTAI--NXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSL--RSW 253
           L      N  L                        YP DV+K  I+  D+    +  ++ 
Sbjct: 199 LIMNQNKNGVLRKDIPPWKVCVFGAFSGAFFWAMTYPFDVVKS-IMQADRLVSPVHGKNV 257

Query: 254 RNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRV 297
              A  I  TRG   F KGFVP+ LRS P N A  A+FE  +R+
Sbjct: 258 FQVAKSIHATRGWGAFVKGFVPTMLRSLPVNGATFATFEVTMRL 301

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score =  108 bits (270), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 77/289 (26%), Positives = 128/289 (44%), Gaps = 33/289 (11%)

Query: 25  GMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGI-RGFYLGFTPPLV 83
           G  +G     + +PFDT+KVRLQT Q    F     C+  T + +GI +GF+ G   PL 
Sbjct: 20  GSIAGALGKVIEYPFDTVKVRLQT-QGRHVFPDTWSCITYTYKNEGIIKGFFQGIASPLA 78

Query: 84  GWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAK 143
           G  + ++ +    +     L+ Y    +    L+  ++SG  AG   SF+  PVEL K K
Sbjct: 79  GAAIENAALFLSYNQCSKFLQHYTNVSD----LTNILISGAFAGSCASFVLTPVELIKCK 134

Query: 144 LQVQY-----------DAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHF--VY 190
           LQV             +  T R+   +  I+ V    G  G+++G   T I R  F  V 
Sbjct: 135 LQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFI-RESFGGVA 193

Query: 191 WWGSYELLTRWFKANTNLSDTAI-------NXXXXXXXXXXXXXXXAYPSDVIKQVILCN 243
           W+ +YEL+ ++ K+  N+ D ++                        +P+D +K ++   
Sbjct: 194 WFATYELMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPADTVKSMMQTE 253

Query: 244 DKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFE 292
                     + A   I+  +G+RGF++G   + +R+ PANA     +E
Sbjct: 254 H------LGLKTAIKKIFVEKGLRGFYRGLGITLIRAIPANATVFYVYE 296

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 73/183 (39%), Gaps = 32/183 (17%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQ-------------DTGRFKGPLDCVYQTMRQ 68
            +SG F+G   + V  P + IK +LQ S               T R    +  +   ++ 
Sbjct: 111 LISGAFAGSCASFVLTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKN 170

Query: 69  QGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQ----HEEKLPLSG----CI 120
           +G  G + G +    G  + +S           L+KKY+       +  LP        +
Sbjct: 171 RGFIGLWQGQS----GTFIRESFGGVAWFATYELMKKYLKSRHNIEDPSLPNDNKTWELL 226

Query: 121 LSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVS 180
            SG  AG + +    P +  K+ +Q       T + G    IKK++   G+RG Y+GL  
Sbjct: 227 ASGASAGLAFNASIFPADTVKSMMQ-------TEHLGLKTAIKKIFVEKGLRGFYRGLGI 279

Query: 181 TLI 183
           TLI
Sbjct: 280 TLI 282

>Kwal_55.21335
          Length = 317

 Score =  108 bits (269), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 80/272 (29%), Positives = 124/272 (45%), Gaps = 15/272 (5%)

Query: 25  GMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQG-IRGFYLGFTPPLV 83
           G  +G A   + +P DTIKVRLQT Q    F     C+  T +++G ++GFY G   PLV
Sbjct: 52  GSIAGAAGKVIEYPLDTIKVRLQT-QPAHVFPTSWSCIKYTYQKEGFVKGFYQGVASPLV 110

Query: 84  GWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAK 143
           G  L ++V+    +  +  L++Y    E   PLS  +LSG  AG   S++  PVEL K  
Sbjct: 111 GAALENAVLFVTFNRAQNFLQQY----ESVSPLSQTVLSGAFAGACTSYVLTPVELIKCT 166

Query: 144 LQV-QYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTH-FVYWWGSYELLTRW 201
           LQV   +  TTR+      +K +    GI G+++G  ST I        W+ +YE L  +
Sbjct: 167 LQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVWFTTYESLKSY 226

Query: 202 FKANTNLSDTAI-NXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSLRSWRNAASDI 260
                N ++                     +P+D IK       ++ G +    +A   I
Sbjct: 227 LARRRNDTENHTWELLASGASAGVAFNASIFPADTIKST--AQTQHLGIV----DATKRI 280

Query: 261 WRTRGIRGFFKGFVPSFLRSFPANAAALASFE 292
               G  G ++G   + +R+ PANA    ++E
Sbjct: 281 LARSGPAGLYRGLGITLIRAAPANAIVFYTYE 312

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 69/167 (41%), Gaps = 18/167 (10%)

Query: 23  VSGMFSGIAKNAVGHPFDTIKVRLQTSQDTG---RFKGPLDCVYQTMRQQGIRGFYLGFT 79
           +SG F+G   + V  P + IK  LQ S   G   R       V   ++ +GI G + G +
Sbjct: 144 LSGAFAGACTSYVLTPVELIKCTLQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQS 203

Query: 80  PPLVGWILMDSVMLGC---LHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAP 136
              +      +V       L +Y    +     H  +L     + SG  AG + +    P
Sbjct: 204 STFIRECAGGAVWFTTYESLKSYLARRRNDTENHTWEL-----LASGASAGVAFNASIFP 258

Query: 137 VELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183
            +  K+  Q       T++ G +D  K++ A  G  G+Y+GL  TLI
Sbjct: 259 ADTIKSTAQ-------TQHLGIVDATKRILARSGPAGLYRGLGITLI 298

 Score = 31.2 bits (69), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 76/186 (40%), Gaps = 26/186 (13%)

Query: 120 ILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADG-IRGMYKGL 178
           IL G +AG +   I  P++  K +LQ Q       +      IK  Y  +G ++G Y+G+
Sbjct: 49  ILYGSIAGAAGKVIEYPLDTIKVRLQTQ---PAHVFPTSWSCIKYTYQKEGFVKGFYQGV 105

Query: 179 VSTLI-----FRTHFVYWWGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPS 233
            S L+         FV +  +   L + +++ + LS T ++                 P 
Sbjct: 106 ASPLVGAALENAVLFVTFNRAQNFLQQ-YESVSPLSQTVLSGAFAGACTSYVLT----PV 160

Query: 234 DVIKQVILCNDKYDGSLRSWRNAASDIWRT-------RGIRGFFKGFVPSFLRSFPANAA 286
           ++IK  +  ++    + R      S IW T       +GI G ++G   +F+R     A 
Sbjct: 161 ELIKCTLQVSNLEGATTRH-----SKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAV 215

Query: 287 ALASFE 292
              ++E
Sbjct: 216 WFTTYE 221

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score =  107 bits (268), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 90/299 (30%), Positives = 143/299 (47%), Gaps = 23/299 (7%)

Query: 12  PNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGI 71
           P++    +   ++G   GIA+  VG PFDT KVRLQTS+ +      +  +   ++ +G 
Sbjct: 17  PHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETS---TNAVKVIKDLIKNEGP 73

Query: 72  RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVS 131
            GFY G   PLVG     S+  G     +     +     + L L    + GV  G++ S
Sbjct: 74  MGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNS 133

Query: 132 FIAAPVELAKAKLQVQY-DAQTTRYRGPLDVIKKVYAADGIRG-MYKGLVSTLIFRTHF- 188
           F+A+P+E  + +LQ Q     T  ++GP+D IKK+     + G + +GL  T++  +H  
Sbjct: 134 FLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLR----VNGQLMRGLTPTMLRESHGC 189

Query: 189 -VYWWGSYELLTRWFKANTNLSDT-AINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKY 246
            VY+     L+    K+     D  A                  YP DVIK V+  ++  
Sbjct: 190 GVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDN-- 247

Query: 247 DGSLRSWRNAAS--DIWRT----RGIRGFFKGFVPSFLRSFPANAAALASFEFVLRVSG 299
              L++ +N  +   + RT    +G+ G FKGF P+ LR+ PANAA  A+FE  +R+ G
Sbjct: 248 ---LKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLRAAPANAATFATFETAMRLLG 303

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score =  107 bits (267), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 79/283 (27%), Positives = 130/283 (45%), Gaps = 17/283 (6%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTG---RFKGPLDCVYQTMRQQGIRGFYLGF 78
           F +G  +G+++  V +P D +K R+Q     G    + G +DC+ + +  +G+   Y G 
Sbjct: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGI 74

Query: 79  TPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVE 138
           + P++      +    C   ++ L K+     +   PLS  +L+G  AG   +F+  P E
Sbjct: 75  SSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLS--MLAGASAGCVEAFVVVPFE 132

Query: 139 LAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYWWGSYELL 198
           L K +LQ   DA ++ Y+GP+DV++K+ A +G+  MY GL STL    H ++  G + ++
Sbjct: 133 LVKIRLQ---DASSS-YKGPVDVVRKIVAREGVLAMYNGLESTL--WRHALWNGGYFGII 186

Query: 199 TR---WFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSLRSWR- 254
            +      A  N +    N               + P DV+K  I       G +R +  
Sbjct: 187 FQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNW 246

Query: 255 --NAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVL 295
              +   I+R  G R  +KGFVP  LR  P     L  F  VL
Sbjct: 247 SLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVL 289

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 79/172 (45%), Gaps = 7/172 (4%)

Query: 14  EAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRG 73
           E  S+ +  ++G  +G  +  V  PF+ +K+RLQ +  +  +KGP+D V + + ++G+  
Sbjct: 106 EKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSS--YKGPVDVVRKIVAREGVLA 163

Query: 74  FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFI 133
            Y G    L    L +    G +   R LL      H +   ++  ++S  +       +
Sbjct: 164 MYNGLESTLWRHALWNGGYFGIIFQARALLPA---AHNKTQCITNDLISDSIGCSIGCML 220

Query: 134 AAPVELAKAKLQ--VQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183
           + P ++ K+++Q          +Y   L  +  +Y  +G R +YKG V  ++
Sbjct: 221 STPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVL 272

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 40/76 (52%), Gaps = 1/76 (1%)

Query: 112 EKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQT-TRYRGPLDVIKKVYAADG 170
           + LP      +G +AG S   +  P+++ K ++Q+Q        Y G +D +KK+ A +G
Sbjct: 7   KSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEG 66

Query: 171 IRGMYKGLVSTLIFRT 186
           +  +YKG+ S ++   
Sbjct: 67  VGRLYKGISSPILMEA 82

>Scas_632.9
          Length = 292

 Score =  105 bits (263), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 81/298 (27%), Positives = 134/298 (44%), Gaps = 20/298 (6%)

Query: 3   SRSDSNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCV 62
           S S  + +  +   + +   V+G  +G     + +PFDT+KVRLQT Q +  F     C+
Sbjct: 2   SESIDHPIEKSSVQNALSDIVNGSIAGAFGKIIEYPFDTVKVRLQT-QGSHIFPTTWSCI 60

Query: 63  YQTMRQQGI-RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCIL 121
             T   +G+ RGF+ G   PL G  L ++ +    +    +L+K+        PLS  +L
Sbjct: 61  KYTYHNEGVWRGFFQGIGSPLFGAALENATLFVSYNQCSNVLEKFTNVS----PLSNILL 116

Query: 122 SGVLAGWSVSFIAAPVELAKAKLQVQYDAQTT-----RYRGPLDVIKKVYAADGIRGMYK 176
           SG  AG   SF+  PVEL K KLQV  + QT      ++   +  +  V    GI G+++
Sbjct: 117 SGAFAGSCASFVLTPVELIKCKLQVS-NLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQ 175

Query: 177 GLVSTLIFRT-HFVYWWGSYELLTRWFKA-NTNLSDTAINXXXXXXXXXXXXXXXAYPSD 234
           G  ST I  +   V W+ +YE++ +  K    +  +                    +P+D
Sbjct: 176 GQSSTFIRESLGGVAWFATYEVMKQGLKDRRKDTENKTWELLVSGASAGLAFNASIFPAD 235

Query: 235 VIKQVILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFE 292
            +K ++           +  NA   +  T GI GF++G   + +R+ PANA     +E
Sbjct: 236 TVKSMMQTEH------ITLINAVKKVLTTYGITGFYRGLGITLIRAVPANATVFYMYE 287

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score =  104 bits (259), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 89/313 (28%), Positives = 139/313 (44%), Gaps = 29/313 (9%)

Query: 5   SDSNAVVPN--EAYSRMMGF-------VSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRF 55
           SD   + P   E  + + GF        SG   G+A+  VG PFD IKVRLQT       
Sbjct: 2   SDELLITPQVVEDLTDLHGFRKTLKDVFSGTVGGVAQVLVGQPFDIIKVRLQTMPGNAT- 60

Query: 56  KGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLG---CLHNYRMLLKKYVYQHEE 112
               + +   ++ +G  GFY G   PLVG     S   G    +  Y   L +    ++ 
Sbjct: 61  --AWEAITDLVKYEGFMGFYKGTMAPLVGVGACVSCQFGINEAMKRYFRDLNRSRGIYDN 118

Query: 113 KLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDA-QTTRYRGPLDVIKKVYAADGI 171
            L L      G ++G + + +A P+E  + +LQ+Q +A     Y+  LD  +K+      
Sbjct: 119 TLSLGQYYTCGFVSGSANALLATPIEHVRIRLQLQKEALANAEYKSTLDCTEKLLKQGS- 177

Query: 172 RGMYKGLVSTLIFRTH-FVYWWGSYE-LLTRWFKANTNLSD-TAINXXXXXXXXXXXXXX 228
             + +G  +TL+  +H F  ++ +YE L+           D +A                
Sbjct: 178 --LMRGFTATLMRTSHGFGIYFLTYETLIASQLAHGFRREDISAWKACMFGALSGAFFWA 235

Query: 229 XAYPSDVIKQVI----LCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPAN 284
             YP DV+K V+    L N  Y  ++      A +I+R RG+R F KGF+P+ LRS P N
Sbjct: 236 MTYPFDVVKSVMQADKLVNPAYGTNVV---QVAKNIYRERGLRAFTKGFMPTMLRSLPVN 292

Query: 285 AAALASFEFVLRV 297
            A  A+FE  +++
Sbjct: 293 GATFAAFEVTMQM 305

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score =  102 bits (254), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 76/273 (27%), Positives = 120/273 (43%), Gaps = 16/273 (5%)

Query: 25  GMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGI-RGFYLGFTPPLV 83
           G  +G     V +PFDT+KVRLQT Q    F     CV  T +Q+G+ RGFY G   P+ 
Sbjct: 15  GGVAGSLGKLVEYPFDTVKVRLQT-QSAALFPTTWSCVSHTYKQEGLWRGFYQGMASPVF 73

Query: 84  GWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAK 143
           G  L  +V+    +  + +L+   Y      PL   + +G +AG   S++  PVEL K K
Sbjct: 74  GAFLEHAVLFVSFNRAQAVLEN-CYSCG---PLEKVVFAGAIAGACTSYVLTPVELVKCK 129

Query: 144 LQVQ--YDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTH-FVYWWGSYELLTR 200
           LQV         RY   L  ++ +   +G+ G+++G   T I  +     W+ +YE+L  
Sbjct: 130 LQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQSGTFIRESAGGAVWFTAYEVLKG 189

Query: 201 WF-KANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSLRSWRNAASD 259
           W  +   +  +T                   +P+D +K  +       G       A   
Sbjct: 190 WLARRRGSTENTVWELLASGAGAGAAFHASIFPADTVKSTMQTEHLGLGP------AVRT 243

Query: 260 IWRTRGIRGFFKGFVPSFLRSFPANAAALASFE 292
           + +  G  GF++G   + LR+ PANA     +E
Sbjct: 244 VLKKHGPTGFYRGVGITLLRALPANAVIFYVYE 276

 Score = 28.5 bits (62), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 4/58 (6%)

Query: 24  SGMFSGIAKNAVGHPFDTIKVRLQTSQDTG----RFKGPLDCVYQTMRQQGIRGFYLG 77
           +G  +G   + V  P + +K +LQ S  TG    R+   L  +   ++Q G+ G + G
Sbjct: 108 AGAIAGACTSYVLTPVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQG 165

>Kwal_56.23011
          Length = 303

 Score =  100 bits (249), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 80/279 (28%), Positives = 122/279 (43%), Gaps = 13/279 (4%)

Query: 25  GMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVG 84
           G   G+A+  VG PFD  KVRLQTS            +   ++ +G+  FY G   PL G
Sbjct: 30  GTVGGVAQVLVGQPFDITKVRLQTSPVP---TTAAQVIKSLVKNEGLLAFYKGTLAPLAG 86

Query: 85  WILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKL 144
                S   G     +   +K     ++ L L      G ++G + +F+A P+E  + +L
Sbjct: 87  VGACVSCQFGVNEALKKWFRKKDGNFDQPLALRQYYACGFVSGTANAFLATPIEHVRIRL 146

Query: 145 QVQY-DAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTH-FVYWWGSYELLTRWF 202
           Q+Q   +    Y G LD  +K+        + +G  +T +  +H F  ++ +YE L    
Sbjct: 147 QLQTASSSAAEYHGSLDCARKLLKQGA---LMRGFTATTLRTSHGFGIYFLTYETLIANQ 203

Query: 203 KANTNLSDT--AINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSL--RSWRNAAS 258
             +  L +   A                  YP DV+K V+   DK    +  R+    A 
Sbjct: 204 AHHGVLRENIPAWKVCVYGAFSGAFFWAMTYPFDVVKSVMQA-DKLKNPVYGRNPLAVAK 262

Query: 259 DIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRV 297
            I+R RG R F KGF P+ LRS P N A  A+FE  +R+
Sbjct: 263 AIYRERGPRAFTKGFTPTMLRSLPVNGATFAAFEITMRL 301

 Score = 34.7 bits (78), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 2/63 (3%)

Query: 23  VSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKG--PLDCVYQTMRQQGIRGFYLGFTP 80
           V G FSG    A+ +PFD +K  +Q  +      G  PL       R++G R F  GFTP
Sbjct: 220 VYGAFSGAFFWAMTYPFDVVKSVMQADKLKNPVYGRNPLAVAKAIYRERGPRAFTKGFTP 279

Query: 81  PLV 83
            ++
Sbjct: 280 TML 282

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 99.8 bits (247), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 78/304 (25%), Positives = 132/304 (43%), Gaps = 30/304 (9%)

Query: 5   SDSNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQ----------TSQDTGR 54
           SDSNA    +    +  F+SG  +GI++  V +P D +K R Q            +   R
Sbjct: 3   SDSNA----KPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVER 58

Query: 55  FKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKL 114
           + G +DC+ + ++++G    Y G + P++      +    C   Y+ + K     +E   
Sbjct: 59  YNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQ 118

Query: 115 PLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGM 174
            +S  I +G  AG + + +  P EL K ++Q   D +++ Y GP+D +KK    +GI G+
Sbjct: 119 KIS--IAAGASAGMTEAAVIVPFELIKIRMQ---DVKSS-YLGPMDCLKKTIKNEGIMGL 172

Query: 175 YKGLVSTLIFRTHFVYWWGSYELLTRWFKANTNLSDT----AINXXXXXXXXXXXXXXXA 230
           YKG+ ST+ +R     W G Y  +    + +  ++ T      N                
Sbjct: 173 YKGIESTM-WRNAL--WNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLN 229

Query: 231 YPSDVIKQVILCNDKYDGSLRSWRNAASD---IWRTRGIRGFFKGFVPSFLRSFPANAAA 287
            P DV+K  I   D    +++ +         I+R  G R  +KGFVP   R  P  +  
Sbjct: 230 TPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLM 289

Query: 288 LASF 291
           L  F
Sbjct: 290 LVVF 293

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 39/89 (43%), Gaps = 8/89 (8%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQT----SQDTGRFKGPLDCVYQTMRQQGIRGFYLG 77
            ++G   G     +  PFD +K R+Q+    S    ++   L  +    R++G R  Y G
Sbjct: 215 LIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKG 274

Query: 78  FTPPLV----GWILMDSVMLGCLHNYRML 102
           F P +     G  LM  V  G ++ +R L
Sbjct: 275 FVPKVCRLAPGGSLMLVVFTGMMNFFRDL 303

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 98.2 bits (243), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 77/291 (26%), Positives = 121/291 (41%), Gaps = 23/291 (7%)

Query: 13  NEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGI- 71
           N  Y       +G   G+     GHPFD +KVR Q++Q +G        + +   Q G+ 
Sbjct: 42  NALYENAKSLAAGAVGGVCAVLTGHPFDLLKVRCQSNQASGTVDAVRKILVEARAQSGLS 101

Query: 72  -----RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEE-KLPLSGCILSGVL 125
                RGFY G  PPL+G   + +V       Y +  K   +     KL  +    +G +
Sbjct: 102 AVNMMRGFYKGVIPPLLGVTPIFAV---SFWGYDVGKKLVTWNDNSGKLTTAQLATAGFI 158

Query: 126 AGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFR 185
           +    + + AP E  K  LQ Q +             K + A  G+R +++G ++TL   
Sbjct: 159 SAIPTTLVMAPTERVKVVLQTQSNHSLG------SAAKHILATGGVRSLFRGSLATLARD 212

Query: 186 -THFVYWWGSYELLTRWFKANTNLSDTAI-NXXXXXXXXXXXXXXXAYPSDVIKQVILCN 243
                 ++ SYE    +  A +  ++ +I N                +P D IK  +  +
Sbjct: 213 GPGSALYFASYEATKAYLNARSGTNELSIKNVCLAGGMAGVSMWVGVFPIDTIKTELQSS 272

Query: 244 DKYDGSLRSWRNAASDIWRTRG-IRGFFKGFVPSFLRSFPANAAALASFEF 293
           +     + + R     I+ TRG I+GFF G  P+ LRSFPANAA     E 
Sbjct: 273 NTRQTMMEATR----KIYNTRGGIKGFFPGIGPALLRSFPANAATFLGVEL 319

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 98.2 bits (243), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 72/290 (24%), Positives = 122/290 (42%), Gaps = 26/290 (8%)

Query: 23  VSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGR------FKGPLDCVYQTMRQQGIRGFYL 76
           +SG  +G+    V  P D  K RLQ      R      ++G +  +   +R +G+RG Y 
Sbjct: 73  ISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYK 132

Query: 77  GFTPPLVG----WILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSF 132
           G  P ++G    W++  SV   C  N R     + +             S + AG   + 
Sbjct: 133 GLVPIIMGYFPTWMIYFSVYEFCKDNLRTNSSNWSFVSHS--------FSAITAGAVSTV 184

Query: 133 IAAPVELAKAKLQVQYD--AQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVY 190
           +  P+ + K +L +Q    + TT Y+G  D  KK+   +G++ +Y GLV +L+   H   
Sbjct: 185 VTNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPSLLGLLHVAI 244

Query: 191 WWGSYELLTRWFKA---NTNLSDTAINXX---XXXXXXXXXXXXXAYPSDVIKQVILCND 244
            +  YE L   FK    + + +++ IN                  +YP ++++  +    
Sbjct: 245 HFPVYERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILRTRLQLKS 304

Query: 245 KYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFV 294
                 R         +   GI GF+ GF  +  R+ PA+A  L SFE+V
Sbjct: 305 DLPSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFEYV 354

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 34/79 (43%), Gaps = 1/79 (1%)

Query: 28  SGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPL-DCVYQTMRQQGIRGFYLGFTPPLVGWI 86
           S +  + + +P + ++ RLQ   D    +  L   +  T  Q+GI GFY GF   L   +
Sbjct: 282 SKMVASVLSYPHEILRTRLQLKSDLPSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRTL 341

Query: 87  LMDSVMLGCLHNYRMLLKK 105
              ++ L      R  L K
Sbjct: 342 PASAITLVSFEYVRNFLNK 360

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 96.7 bits (239), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 77/284 (27%), Positives = 130/284 (45%), Gaps = 19/284 (6%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIK--VRLQTSQDTG-RFKGPLDCVYQTMRQQGIRGFYLGF 78
           F++G  +G+++  V +P D +K  ++LQ S  +G ++KG  DC+ Q   ++G    Y G 
Sbjct: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72

Query: 79  TPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVE 138
           + P++      +    C   ++ + K      +   PLS  ILSG  AG   SF+  P E
Sbjct: 73  SSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLS--ILSGASAGICESFVVVPFE 130

Query: 139 LAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYWWGSYELL 198
           L K +LQ      ++++  P+ V+K +   +GI  MY GL ST+    H ++  G + ++
Sbjct: 131 LVKIRLQ----DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTM--WRHGIWNAGYFGII 184

Query: 199 TR----WFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSLRSWR 254
            +      KA+T  S+   N               + P DV+K  +       G  R + 
Sbjct: 185 FQVRALLPKASTK-SEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYN 243

Query: 255 ---NAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVL 295
               A + I++  G +  +KGFVP  LR  P     L  F  V+
Sbjct: 244 WSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVM 287

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 80/172 (46%), Gaps = 7/172 (4%)

Query: 14  EAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRG 73
           E  ++ +  +SG  +GI ++ V  PF+ +K+RLQ    + +F  P+  V   + ++GI  
Sbjct: 104 EKLTQPLSILSGASAGICESFVVVPFELVKIRLQDV--SSKFTSPIAVVKNIVEKEGILA 161

Query: 74  FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFI 133
            Y G    +    + ++   G +   R LL K   + E+       +L+G + G   S +
Sbjct: 162 MYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQT---RNDLLAGTVGGTLSSLL 218

Query: 134 AAPVELAKAKLQ--VQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183
           + P ++ K+++Q          +Y      +  +Y  +G + +YKG V  ++
Sbjct: 219 STPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVL 270

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 42/76 (55%), Gaps = 1/76 (1%)

Query: 111 EEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQT-TRYRGPLDVIKKVYAAD 169
           ++ LP     ++G +AG S   +  P+++ K  +Q+Q    +  +Y+G  D +K++ A +
Sbjct: 4   QKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKE 63

Query: 170 GIRGMYKGLVSTLIFR 185
           G   +YKG+ S ++  
Sbjct: 64  GPSRLYKGISSPILME 79

>Scas_640.25
          Length = 306

 Score = 95.1 bits (235), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 79/310 (25%), Positives = 137/310 (44%), Gaps = 25/310 (8%)

Query: 1   MSSRSDSNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTG------- 53
           MSS  ++ A +P         F++G  +GI++  V +P D +K R+Q    TG       
Sbjct: 1   MSSNHNTQAPLPFRYQ-----FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASAT 55

Query: 54  RFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEK 113
            +KG +DC+ Q ++++G    Y G + P++      +V       +  L K       ++
Sbjct: 56  HYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVF--GTKQ 113

Query: 114 LPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRG 173
           L     +LSG  AG + + +  P EL K +LQ       ++++GP++V+K +   DG++G
Sbjct: 114 LTQQISVLSGASAGITEALVIVPFELVKIRLQ----DVNSKFKGPVEVLKHIIKQDGLKG 169

Query: 174 MYKGLVSTLIFRTHF--VYWWGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAY 231
           +Y G+ ST ++R       ++G    +        +  +   N                 
Sbjct: 170 LYSGVEST-VWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNT 228

Query: 232 PSDVIKQVILC--NDKYDGSLR-SWR-NAASDIWRTRGIRGFFKGFVPSFLRSFPANAAA 287
           P DV+K  I    N+  +G  + +W   +   I+   G R  +KGFVP  LR  P  A  
Sbjct: 229 PFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVL 288

Query: 288 LASFEFVLRV 297
           L  F  V+ V
Sbjct: 289 LVVFTNVMNV 298

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 95.5 bits (236), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 75/290 (25%), Positives = 119/290 (41%), Gaps = 31/290 (10%)

Query: 23  VSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGR----FKGPLDCVYQTMRQQGIRGFYLGF 78
           VSG  +G     +  P D  K RLQ +Q  G     ++G +  +   +R +G+ G Y G 
Sbjct: 89  VSGALAGFVSGIMVCPLDVAKTRLQ-AQGAGSGERYYRGIVGTLSAILRDEGVAGLYKGL 147

Query: 79  TPPLVG----WILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIA 134
            P ++G    W+L  SV   C   Y   L      H           S + AG   + + 
Sbjct: 148 APIVLGYFPTWMLYFSVYEKCKQRYPSYLPGGFVSHAA---------SALTAGAISTALT 198

Query: 135 APVELAKAKLQVQYDA--QTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYWW 192
            P+ + K +L +Q D    +T YR  LD  +K+Y ++G++  Y GLV +L    H    +
Sbjct: 199 NPIWVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLFGLFHVAIHF 258

Query: 193 GSYELLTRWFKANTNLSD---------TAINXXXXXXXXXXXXXXXAYPSDVIKQVILCN 243
             YE L  W   NT  +D                             YP ++++  +   
Sbjct: 259 PVYEKLKIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSKVVASVITYPHEILRTRM--Q 316

Query: 244 DKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEF 293
            ++ G   S  N    I  + G  GF+ GF  + +R+ PA+   L SFE+
Sbjct: 317 VRHSGVPPSLLNLLGRIRASEGYVGFYSGFATNLVRTVPASVITLVSFEY 366

 Score = 28.9 bits (63), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 37/83 (44%), Gaps = 1/83 (1%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPP 81
            V+   S +  + + +P + ++ R+Q  + +G     L+ + +    +G  GFY GF   
Sbjct: 291 IVASCLSKVVASVITYPHEILRTRMQV-RHSGVPPSLLNLLGRIRASEGYVGFYSGFATN 349

Query: 82  LVGWILMDSVMLGCLHNYRMLLK 104
           LV  +    + L     +R  L+
Sbjct: 350 LVRTVPASVITLVSFEYFRKYLR 372

>Scas_714.18
          Length = 305

 Score = 94.0 bits (232), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 131/309 (42%), Gaps = 35/309 (11%)

Query: 8   NAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMR 67
           NAV      + +   ++G  +G     + +PFDT+KVRLQT Q+   F     C+  T  
Sbjct: 2   NAVEEGGFGAALREILAGSIAGAIGKFIEYPFDTVKVRLQT-QEAYMFPSTWSCIKYTYE 60

Query: 68  QQGI-RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLA 126
            +GI  GFY G   PL+G  L ++++    +     L  +     E       ++S   A
Sbjct: 61  NEGILEGFYQGIESPLIGAALENAILFLAYNQCSSFLNAFT----EFSAFLIILISAGFA 116

Query: 127 GWSVSFIAAPVELAKAKLQV---QYDAQTT-------------------RYRGPLDVIKK 164
           G   SF+  PVEL K KLQ+    Y                        R+   +  IK 
Sbjct: 117 GSCASFVLTPVELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKS 176

Query: 165 VYAADGIRGMYKGLVSTLIFRT-HFVYWWGSYELLTRWFKANTNLSDTAINXXXXXXXXX 223
           +    G+ G+++G  ST I  +   V W+ +YEL+ +  +   +  +T            
Sbjct: 177 IIKEKGLFGLWQGQSSTFIRESIGSVVWFATYELMKQTLRDPKSEVNTTWQLLISGATAG 236

Query: 224 XXXXXXAYPSDVIKQVILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPA 283
                  +P+D +K ++    ++   + + R+    I    G+ GF++G   + LR+ P+
Sbjct: 237 LAFNGSVFPADTVKSIM--QTEHLALMETVRS----ILERDGVAGFYRGLGITLLRAVPS 290

Query: 284 NAAALASFE 292
           NAA   ++E
Sbjct: 291 NAAVFYTYE 299

>Kwal_23.2913
          Length = 320

 Score = 91.7 bits (226), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 79/312 (25%), Positives = 131/312 (41%), Gaps = 32/312 (10%)

Query: 5   SDSNAVVPNEAYSRMM-----GFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPL 59
           +D NA +   + S  +        +G   G+     GHPFD +KVR Q++Q +G      
Sbjct: 10  ADLNAKIEQASNSHTLRDSFESLAAGGVGGVCAVLTGHPFDLLKVRCQSNQASGTLDAIS 69

Query: 60  DCVYQTMRQQG------IRGFYLGFTPPLVGWILMDSVML-GCLHNYRML------LKKY 106
             +++   + G      I+GFY G  PPL+G   + +V   G     R++      +   
Sbjct: 70  RVLHEAKSKSGPLPLNQIKGFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDI 129

Query: 107 VYQHEEKLPL--SGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKK 164
                +  PL  S   L+G  +    + I AP E  K  LQ      T+     L   + 
Sbjct: 130 AGSSSKLTPLTTSQLALAGFFSAIPTTLITAPTERVKVVLQ------TSESGSFLGAART 183

Query: 165 VYAADGIRGMYKGLVSTLIFR-THFVYWWGSYELLTRWFKANTNLSD-TAINXXXXXXXX 222
           +    G+R +++G ++TL         ++ SYE+  R+   N +    + ++        
Sbjct: 184 LIREGGVRSLFQGTLATLARDGPGSALYFASYEVSKRFLSRNQDTDALSVVSICVAGGVA 243

Query: 223 XXXXXXXAYPSDVIKQVILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFP 282
                   +P D IK  +  + +     +S   AA +I+   G+RGFF G  P+ +RSFP
Sbjct: 244 GMSMWIGVFPIDTIKTKLQSSSRS----QSMVQAAREIYTRAGLRGFFPGLGPALMRSFP 299

Query: 283 ANAAALASFEFV 294
           ANAA     EF 
Sbjct: 300 ANAATFLGVEFT 311

>Scas_709.9
          Length = 365

 Score = 92.0 bits (227), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 74/291 (25%), Positives = 126/291 (43%), Gaps = 29/291 (9%)

Query: 23  VSGMFSGIAKNAVGHPFDTIKVRLQT----SQDTGRFKGPLDCVYQTMRQQGIRGFYLGF 78
           +SG  +G     +  P D  K RLQ     S +   ++G L  +   +  +G+RG Y G 
Sbjct: 69  LSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGLYKGL 128

Query: 79  TPPLVG----WILMDSVMLGCLHNY-RMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFI 133
            P ++G    W++  SV       Y R+L       H        C  S + AG + + +
Sbjct: 129 IPIILGYFPTWMIYFSVYEFAKDLYPRVLPNSDFISH-------SC--SAITAGAASTVL 179

Query: 134 AAPVELAKAKLQVQ--YDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYW 191
             P+ + K +L +Q       T YRG +D  KK+   +G+R +Y GLV ++    H    
Sbjct: 180 TNPIWVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMFGLLHVAIH 239

Query: 192 WGSYELLTRWFKANT-----NLSDTAINXXXXXXXXXXXXXXXA---YPSDVIK-QVILC 242
           +  YE L      +T     N  + +++               +   YP ++++ ++ L 
Sbjct: 240 FPVYEKLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILRTRMQLK 299

Query: 243 NDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEF 293
           +DK   S     +     +R  G+ GF+ GF  + LR+ PA+A  L SFE+
Sbjct: 300 SDKLLISKHKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSFEY 350

 Score = 32.0 bits (71), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 38/85 (44%), Gaps = 2/85 (2%)

Query: 28  SGIAKNAVGHPFDTIKVRLQTSQDTGRFKGP--LDCVYQTMRQQGIRGFYLGFTPPLVGW 85
           S +  + + +P + ++ R+Q   D         LD + +T R +G+ GFY GF   L+  
Sbjct: 278 SKMLASILTYPHEILRTRMQLKSDKLLISKHKLLDLIKRTYRYEGLLGFYSGFATNLLRT 337

Query: 86  ILMDSVMLGCLHNYRMLLKKYVYQH 110
           +   ++ L     +R  L K    H
Sbjct: 338 VPASAITLVSFEYFRNALLKINQDH 362

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score = 92.4 bits (228), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 78/286 (27%), Positives = 127/286 (44%), Gaps = 15/286 (5%)

Query: 16  YSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFY 75
           +  +  F  G  +G     V +P D +K R+Q  +D  ++K  +DC+ + + ++G+RG Y
Sbjct: 522 FDSIYNFTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFSKYKNSIDCLLKILSKEGVRGLY 581

Query: 76  LGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAA 135
            G  P L+G     ++ L    + R  L       + KL L   I+SG  AG        
Sbjct: 582 SGLGPQLIGVAPEKAIKLTVNDHMRATLAG----RDGKLSLPCEIISGATAGACQVVFTN 637

Query: 136 PVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHF--VYWWG 193
           P+E+ K +LQV+ D      R  ++ I  V    G+ G+Y+G  + L+    F  +Y+  
Sbjct: 638 PLEIVKIRLQVKSDYVADAARNSVNAI-SVIKNLGLIGLYRGAGACLLRDIPFSAIYFPT 696

Query: 194 SYELLTRWFKANTNLSD--TAINXXXXXXXXXXXXXXXAY---PSDVIKQVILCNDKYDG 248
              + +  F  +   SD    +N               A+   P DVIK  +  + K   
Sbjct: 697 YAHIKSNVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGE 756

Query: 249 SLRS--WRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFE 292
           S+ +  W +AA  I +  GI+ FFKG     LRS P     LA++E
Sbjct: 757 SVYNGIW-DAARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAYE 801

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 90.5 bits (223), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 70/287 (24%), Positives = 124/287 (43%), Gaps = 24/287 (8%)

Query: 23  VSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGP-----LDCVYQTMRQQGIRGFYLG 77
           +SG F+G        P D  K RLQ      RF+ P     +  +   +R +G RG Y G
Sbjct: 82  LSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKG 141

Query: 78  FTPPLVG----WILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFI 133
             P ++G    W++  SV            KK+ +    +        + + AG + + +
Sbjct: 142 LVPIVLGYFPTWMIYFSVY--------EFSKKFFHGIFPQFDFVAQSCAAITAGAASTTL 193

Query: 134 AAPVELAKAKLQVQYD--AQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYW 191
             P+ + K +L +Q +     T Y+G  D  +K++  +G + +Y GLV +L+   H    
Sbjct: 194 TNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGLFHVAIH 253

Query: 192 WGSYELLTRWFKANTNLSDT-AINXX---XXXXXXXXXXXXXAYPSDVIK-QVILCNDKY 246
           +  YE L   F   +  ++T +IN                   YP ++++ ++ L +D  
Sbjct: 254 FPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQLKSDIP 313

Query: 247 DGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEF 293
           D   R         +   G++GF+ GF  + +R+ PA+A  L SFE+
Sbjct: 314 DSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFEY 360

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 6/82 (7%)

Query: 28  SGIAKNAVGHPFDTIKVRLQTSQDT----GRFKGPLDCVYQTMRQQGIRGFYLGFTPPLV 83
           S +  +AV +P + ++ R+Q   D      R   PL  +  T  Q+G++GFY GFT  LV
Sbjct: 288 SKMIASAVTYPHEILRTRMQLKSDIPDSIQRRLFPL--IKATYAQEGLKGFYSGFTTNLV 345

Query: 84  GWILMDSVMLGCLHNYRMLLKK 105
             I   ++ L     +R  L+ 
Sbjct: 346 RTIPASAITLVSFEYFRNRLEN 367

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 89.7 bits (221), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 79/295 (26%), Positives = 122/295 (41%), Gaps = 31/295 (10%)

Query: 19  MMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQ-------QGI 71
           +    +G   G+     GHPFD +KVR Q++Q        +  + Q  RQ         +
Sbjct: 29  LKSLAAGGVGGVCAVLTGHPFDLVKVRCQSNQARSAMDA-VSHILQAARQAAGPTSLNAV 87

Query: 72  RGFYLGFTPPLVGWILMDSVML-------GCLHNYRMLLKKYVYQHEEKLPLSGCILSGV 124
           RGFY G  PPL+G   + +V           + +            E +L LS    +G 
Sbjct: 88  RGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVEPELTLSQMAAAGF 147

Query: 125 LAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGP-LDVIKKVYAADGIRGMYKGLVSTLI 183
           ++    + + AP E  K  LQ      TT+ +   LD  K++    G + ++KG ++TL 
Sbjct: 148 ISAIPTTLVTAPTERVKVVLQ------TTQGKASFLDAAKQIVRTQGFQSLFKGSLATLS 201

Query: 184 FR-THFVYWWGSYELLTRWF-KANTNLSD--TAINXXXXXXXXXXXXXXXAYPSDVIKQV 239
                   ++ SYE+   +  KA+ + S   +  N                +P D +K  
Sbjct: 202 RDGPGSALYFASYEICKEYLNKASGHTSGELSITNVCISGGMAGVSMWVVVFPIDTVKTQ 261

Query: 240 ILCNDKYDGSLRSWRNAASDIWRTRG-IRGFFKGFVPSFLRSFPANAAALASFEF 293
           +  + K    L   R     I+ TRG I+GFF G  P+ LRSFPANAA     E 
Sbjct: 262 LQSSSKRQSMLEVTRM----IYNTRGGIKGFFPGVGPAILRSFPANAATFLGVEL 312

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 89.0 bits (219), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 76/287 (26%), Positives = 122/287 (42%), Gaps = 26/287 (9%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGR-----FKGPLDCVYQTMRQQGIRGFYL 76
           FVSG  +G+++  V +P D +K R+Q    +G      + G +DC+ Q ++++G    Y 
Sbjct: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71

Query: 77  GFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAP 136
           G + P++      +    C  +Y+ + K       +KL     ILSG LAG + + +  P
Sbjct: 72  GISSPMLMEAPKRATKFACNDSYQKMFKDLY--GVDKLTQQISILSGSLAGVTEACVIVP 129

Query: 137 VELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYWWGSY- 195
            EL K +LQ       +++ GP++V+ K     GI  +Y GL ST+ +R  F  W G Y 
Sbjct: 130 FELVKIRLQ----DVNSKFNGPMEVVFKTIRETGILSLYNGLESTM-WRNAF--WNGGYF 182

Query: 196 ----ELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKY---DG 248
               ++     KA TN   T  +                    V+K  I         DG
Sbjct: 183 GVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADG 242

Query: 249 SLRSWRN----AASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASF 291
           ++    N    +   I+   G    +KGF+P  LR  P     L  F
Sbjct: 243 TVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVF 289

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 82/178 (46%), Gaps = 14/178 (7%)

Query: 14  EAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRG 73
           +  ++ +  +SG  +G+ +  V  PF+ +K+RLQ      +F GP++ V++T+R+ GI  
Sbjct: 105 DKLTQQISILSGSLAGVTEACVIVPFELVKIRLQDVNS--KFNGPMEVVFKTIRETGILS 162

Query: 74  FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFI 133
            Y G    +      +    G +   R LL K     E+    +  +++G + G+   + 
Sbjct: 163 LYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKT---TNDLIAGTIGGY-CRYS 218

Query: 134 AAPVELAKAKLQVQYDAQTT--------RYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183
                L+  K ++Q  A TT        +Y      + K+Y+ +G   +YKG +  ++
Sbjct: 219 TEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKIL 276

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 111 EEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQT---TRYRGPLDVIKKVYA 167
           E+ LP     +SG  AG S   +  P+++ K ++Q+Q  + T     Y G +D + ++  
Sbjct: 3   EKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVK 62

Query: 168 ADGIRGMYKGLVSTLIFR 185
            +G   +YKG+ S ++  
Sbjct: 63  REGFSRLYKGISSPMLME 80

>Kwal_55.20868
          Length = 380

 Score = 89.0 bits (219), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 69/295 (23%), Positives = 117/295 (39%), Gaps = 32/295 (10%)

Query: 23  VSGMFSGIAKNAVGHPFDTIKVRLQT----SQDTGRFKGPLDCVYQTMRQQGIRGFYLGF 78
           +SG  +G        P D  K RLQ     S  +  +KG L  +   +R +G RG Y G 
Sbjct: 80  LSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGLYKGL 139

Query: 79  TPPLVG----WILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIA 134
            P ++G    W++  SV       Y  +   + +             S + AG   + + 
Sbjct: 140 VPIIMGYFPTWMIYFSVYERSKKLYPRIFPSFDFISHSA--------SALTAGTVSTILT 191

Query: 135 APVELAKAKL--QVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYWW 192
            PV + K +L  Q   +  +T Y    D   K+Y  +G+R  Y GL+ +L+   H    +
Sbjct: 192 NPVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLLGLFHVAIHF 251

Query: 193 GSYELLTRWFKANTNLS---DTAINXX---XXXXXXXXXXXXXAYPSDVIKQVILCNDKY 246
             YE L  W     ++S   D  +N                   YP ++++  +      
Sbjct: 252 PIYEKLKVWLHCTPSMSRTEDHNLNLARLIIASSASKMVASTLTYPHEILRTRMQLKAYP 311

Query: 247 DGSLRSWRNAA--------SDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEF 293
              L + +  +           +++ G+RGF+ GF  +  R+ PA+A  L SFE+
Sbjct: 312 TDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSFEY 366

 Score = 34.7 bits (78), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 39/88 (44%), Gaps = 11/88 (12%)

Query: 28  SGIAKNAVGHPFDTIKVRLQTS----------QDTGRFKGPLDCVYQTMRQQGIRGFYLG 77
           S +  + + +P + ++ R+Q            Q T R  G +  +  T + +G+RGFY G
Sbjct: 287 SKMVASTLTYPHEILRTRMQLKAYPTDPLAALQKTSR-HGLIRLIKHTYKSEGLRGFYSG 345

Query: 78  FTPPLVGWILMDSVMLGCLHNYRMLLKK 105
           FT  L   +   ++ L     +R  L K
Sbjct: 346 FTANLARTLPASAITLVSFEYFRKYLTK 373

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score = 89.4 bits (220), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 77/290 (26%), Positives = 128/290 (44%), Gaps = 20/290 (6%)

Query: 16  YSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFY 75
           +  +  F  G  +G     + +P D +K R+Q  +   ++K  +DC  + + ++GIRG Y
Sbjct: 541 FDSLYNFSLGSVAGCIGATIVYPIDFVKTRMQAQRSLSQYKNSIDCFLKILSREGIRGVY 600

Query: 76  LGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAA 135
            G  P L+G     ++ L  +++Y   ++  +     KL L   I+SG  AG        
Sbjct: 601 SGLGPQLIGVAPEKAIKL-TVNDY---MRNKLKDKNGKLGLLSEIISGASAGACQVIFTN 656

Query: 136 PVELAKAKLQV--QYDAQTTRYRG--PLDVIKKVYAADGIRGMYKGLVSTLIFRTHF-VY 190
           P+E+ K +LQV  +Y A+         L +IK++    G+ G+YKG  + L+    F   
Sbjct: 657 PLEIVKIRLQVKGEYVAENAENAKLTALQIIKRL----GLPGLYKGAAACLLRDVPFSAI 712

Query: 191 WWGSYELLTR---WFKANTNLSDTAINXXXXXXXXXXXXXXXAY---PSDVIKQVILCND 244
           ++ +Y  L R    F  N     + +N               AY   P DVIK  +  + 
Sbjct: 713 YFPTYAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRLQIDP 772

Query: 245 KYDGSL-RSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEF 293
           K   ++ +   +AA  I R    + FFKG     LRS P     LA++E 
Sbjct: 773 KKGETIYKGIIHAARTILREESFKSFFKGGAARVLRSSPQFGFTLAAYEL 822

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score = 87.4 bits (215), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 124/288 (43%), Gaps = 19/288 (6%)

Query: 16  YSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFY 75
           +  +  F  G  +G     V +P D +K R+Q  +++ ++K  +DCV +  + +GIRG Y
Sbjct: 502 FDSIHNFTLGSIAGCIGATVVYPIDLVKTRMQAQRNSVQYKNSIDCVVKIFQTKGIRGLY 561

Query: 76  LGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAA 135
            G  P L+G     ++ L         +++Y       +     ILSG  AG        
Sbjct: 562 SGLGPQLIGVAPEKAIKLTV----NDFMRQYFMNKSRTIKWYQEILSGATAGACQVVFTN 617

Query: 136 PVELAKAKLQVQYDAQTTRYR---GPLDVIKKVYAADGIRGMYKGLVSTLIFRTHF-VYW 191
           P+E+ K +LQ++ D      R   G + +I+++    G+RG+YKG  + L+    F   +
Sbjct: 618 PLEIVKIRLQMRSDYVGENARPQLGAVGIIRQL----GLRGLYKGAAACLLRDVPFSAIY 673

Query: 192 WGSYELLTR---WFKANTNLSDTAINXXXXXXXXXXXXXXXAY---PSDVIKQVILCND- 244
           + +Y  L +    F  N       +                AY   P DVIK  +  +  
Sbjct: 674 FPTYAHLKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQIDPR 733

Query: 245 KYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFE 292
           K + +     +AA  I +   I+ FFKG     LRS P     LA+FE
Sbjct: 734 KGETTYTGVIHAARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAFE 781

 Score = 29.3 bits (64), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 7/68 (10%)

Query: 230 AYPSDVIK---QVILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAA 286
            YP D++K   Q    + +Y  S+    +    I++T+GIRG + G  P  +   P  A 
Sbjct: 522 VYPIDLVKTRMQAQRNSVQYKNSI----DCVVKIFQTKGIRGLYSGLGPQLIGVAPEKAI 577

Query: 287 ALASFEFV 294
            L   +F+
Sbjct: 578 KLTVNDFM 585

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 85.1 bits (209), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 78/303 (25%), Positives = 120/303 (39%), Gaps = 35/303 (11%)

Query: 13  NEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQD-------TGRFKGPLDCVYQT 65
           N     +  FV+G   G+     GHPFD IKVR Q  Q        T   K     V  T
Sbjct: 30  NPVRENIKSFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEAKTQVKGT 89

Query: 66  MRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEE----KLPLSGCIL 121
           +    ++GFY G  PPL+G   + +V       Y +  K   + +++    +L +     
Sbjct: 90  LFTNSVKGFYKGVIPPLLGVTPIFAV---SFWGYDVGKKLVTFNNKQGGSNELTMGQMAA 146

Query: 122 SGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGP-LDVIKKVYAADGIRGMYKGLVS 180
           +G ++    + + AP E  K  LQ       T  +G  +   K +    GI  ++KG ++
Sbjct: 147 AGFISAIPTTLVTAPTERVKVVLQ-------TSSKGSFIQAAKTIVKEGGIASLFKGSLA 199

Query: 181 TLIFR-THFVYWWGSYELLTRWFKANTNLSDTA-------INXXXXXXXXXXXXXXXAYP 232
           TL         ++ SYE+   +  +     D         +N                +P
Sbjct: 200 TLARDGPGSALYFASYEISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFP 259

Query: 233 SDVIKQVILCNDKYDGSLRSWRNAASDIWRTRG-IRGFFKGFVPSFLRSFPANAAALASF 291
            D IK  +  +      L    +A  +I+  RG I+GFF G  P+ LRSFPANAA     
Sbjct: 260 IDTIKTKLQASSTRQNML----SATKEIYLQRGGIKGFFPGLGPALLRSFPANAATFLGV 315

Query: 292 EFV 294
           E  
Sbjct: 316 EMT 318

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 2/69 (2%)

Query: 38  PFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLH 97
           P DTIK +LQ S            +Y  +++ GI+GF+ G  P L+     ++     + 
Sbjct: 259 PIDTIKTKLQASSTRQNMLSATKEIY--LQRGGIKGFFPGLGPALLRSFPANAATFLGVE 316

Query: 98  NYRMLLKKY 106
               L KKY
Sbjct: 317 MTHSLFKKY 325

>Scas_589.10
          Length = 316

 Score = 84.0 bits (206), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 76/294 (25%), Positives = 123/294 (41%), Gaps = 30/294 (10%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQ--------TSQDTGRFKGP-----LDCVYQTMRQ 68
           F+SG  +G+++  + +P D +K R Q         +      K P     L C+ + +++
Sbjct: 17  FISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILKE 76

Query: 69  QGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGW 128
           +G +  Y G +PPL+  +   +V       ++ ++ K     E    ++  +L+G  AG 
Sbjct: 77  EGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVT--LLAGTFAGI 134

Query: 129 SVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHF 188
           + S I  P EL K +LQ   DAQ+  YR P+   + +    G+ G+Y G  ST+   T  
Sbjct: 135 TESLIVVPFELVKIRLQ---DAQSD-YRSPIRCTRTIIENQGLFGIYAGFESTIWRNT-- 188

Query: 189 VYWWGSYELLTRWFK-----ANTNLSDTAI-NXXXXXXXXXXXXXXXAYPSDVIKQVILC 242
             W  SY  L    K     A +      I N               + P DV+K  +  
Sbjct: 189 -IWNASYFGLIFQVKKFIPRAKSTTKFQGIRNDFLVGAIAGCMSCFLSVPFDVVKTRMQG 247

Query: 243 NDKYD-GSLRSWR-NAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFV 294
           + K   G    W   +   I+RT GI+G +KG +P   R  P     L  F  V
Sbjct: 248 SKKTSSGMCYGWAWQSVFLIYRTEGIKGIYKGILPIICRYGPGGGLLLVVFNGV 301

 Score = 35.4 bits (80), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 19/84 (22%), Positives = 38/84 (45%), Gaps = 11/84 (13%)

Query: 113 KLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQT-----------TRYRGPLDV 161
           KLP     +SG +AG S + +  P+++ K + Q+Q + +              +   L  
Sbjct: 10  KLPFIYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSC 69

Query: 162 IKKVYAADGIRGMYKGLVSTLIFR 185
           + K+   +G + +YKG+   L+  
Sbjct: 70  LSKILKEEGFKNLYKGMSPPLLME 93

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 83.6 bits (205), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 75/303 (24%), Positives = 122/303 (40%), Gaps = 43/303 (14%)

Query: 18  RMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQ--------- 68
            M   V+G   G+     GHPFD IKVR Q++Q     K  +D V   +++         
Sbjct: 21  NMKALVAGGVGGVCAVLTGHPFDLIKVRCQSNQA----KSTMDAVSIILKEARSLSTVNG 76

Query: 69  ---------QGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGC 119
                      ++GFY G  PPL+G   + +V       Y +  +   ++     PL+  
Sbjct: 77  SLTTSLFFKNSVKGFYKGVIPPLIGVTPIFAV---SFWGYDIGKRLVTWKQASDAPLTTA 133

Query: 120 ILS--GVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGP-LDVIKKVYAADGIRGMYK 176
            ++  G ++    + + AP E  K  LQ       + ++G  +   K + +  G++ ++ 
Sbjct: 134 QMATAGFISAIPTTLVTAPTERIKVVLQTN-----SEFKGSFIKAAKHIVSTGGVKSLFN 188

Query: 177 GLVSTLIFR-THFVYWWGSYELLTRWFKANTNLSD----TAINXXXXXXXXXXXXXXXAY 231
           G ++TL         ++ SYEL   +   +    D       N                +
Sbjct: 189 GSLATLARDGPGSALYFASYELSKAFLNKSVAKKDKDEVNLANVCLAGGIAGMSMWLVVF 248

Query: 232 PSDVIKQVILCNDKYDGSLRSWRNAASDIWRTRG-IRGFFKGFVPSFLRSFPANAAALAS 290
           P D IK  +    +   +  S   A  DI+  RG I+GFF G  P+ LRSFPANAA    
Sbjct: 249 PIDTIKTRL----QVATTPISMVQATKDIYIQRGGIKGFFPGLGPALLRSFPANAATFLG 304

Query: 291 FEF 293
            E 
Sbjct: 305 VEL 307

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score = 84.7 bits (208), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 72/289 (24%), Positives = 119/289 (41%), Gaps = 20/289 (6%)

Query: 16  YSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFY 75
           +  +  F  G  +G     V +P D IK R+Q  +   ++K  +DC+ + + ++GI+G Y
Sbjct: 528 FDSLYNFSLGSIAGCIGATVVYPIDFIKTRMQAQRSLAQYKNSIDCLLKIISREGIKGLY 587

Query: 76  LGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAA 135
            G  P L+G     ++ L         ++  +     KL L   I+SG  AG        
Sbjct: 588 SGLGPQLIGVAPEKAIKLTV----NDFMRNRLTDKNGKLSLFPEIISGASAGACQVIFTN 643

Query: 136 PVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHF-VYWWGS 194
           P+E+ K +LQVQ D      +   +   ++    G+RG+Y G+ + L+    F   ++ +
Sbjct: 644 PLEIVKIRLQVQSDYVGENIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYFPT 703

Query: 195 YELLTR---WFKANTNLSDTAINXXXXXXXXXXXXXXXAY---PSDVIKQVILCN----- 243
           Y  L +    F  N       +                A+   P DVIK  +  +     
Sbjct: 704 YAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDPRKGE 763

Query: 244 DKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFE 292
            KY+G   + R     I +    R FFKG     LRS P     LA++E
Sbjct: 764 TKYNGIFHAIRT----ILKEESFRSFFKGGGARVLRSSPQFGFTLAAYE 808

>Kwal_47.17321
          Length = 881

 Score = 84.7 bits (208), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 78/289 (26%), Positives = 130/289 (44%), Gaps = 25/289 (8%)

Query: 16  YSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFY 75
           Y+ ++G V+G     A     +P D +K R+Q  ++  ++K  +DC  +   ++GIRG Y
Sbjct: 502 YNFLLGSVAGCIGATA----VYPIDLVKTRMQAQRNFSQYKNSIDCFVKIFSREGIRGIY 557

Query: 76  LGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAA 135
            G  P LVG     ++ L  +++Y   ++K +     +L L   I+SG  AG        
Sbjct: 558 SGLGPQLVGVAPEKAIKL-TVNDY---VRKLLMDENNRLTLPLEIISGAAAGACQVIFTN 613

Query: 136 PVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHF-VYWWGS 194
           P+E+ K +LQV+ +   +  +  L  +  V +  G+RG+YKGLV+ L+    F   ++ +
Sbjct: 614 PLEIVKIRLQVRSEYADSLPKSQLTALGVVKSL-GLRGLYKGLVACLMRDVPFSAIYFPT 672

Query: 195 YELLTR---WFKANTNLSDTAINXXXXXXXXXXXXXXXAY---PSDVIKQVILCN----- 243
           Y  L R    +          ++               AY   P DVIK  +  +     
Sbjct: 673 YAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGE 732

Query: 244 DKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFE 292
            +Y G L    +AA  I +    + FFKG     LRS P     LA++E
Sbjct: 733 TRYTGIL----HAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAYE 777

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/188 (20%), Positives = 79/188 (42%), Gaps = 5/188 (2%)

Query: 20  MGFVSGMFSGIAKNAVGHPFDTIKVRLQT-SQDTGRFKGPLDCVYQTMRQQGIRGFYLGF 78
           +  +SG  +G  +    +P + +K+RLQ  S+               ++  G+RG Y G 
Sbjct: 596 LEIISGAAAGACQVIFTNPLEIVKIRLQVRSEYADSLPKSQLTALGVVKSLGLRGLYKGL 655

Query: 79  TPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEK---LPLSGCILSGVLAGWSVSFIAA 135
              L+  +   ++      + +  +  Y  Q + K   L     + +G LAG   +++  
Sbjct: 656 VACLMRDVPFSAIYFPTYAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTT 715

Query: 136 PVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRT-HFVYWWGS 194
           P ++ K +LQ+      TRY G L   + +   +  +  +KG  + ++  +  F +   +
Sbjct: 716 PFDVIKTRLQIDPRKGETRYTGILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAA 775

Query: 195 YELLTRWF 202
           YE+    F
Sbjct: 776 YEIFQNMF 783

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 74/176 (42%), Gaps = 2/176 (1%)

Query: 121 LSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVS 180
           L G +AG   +    P++L K ++Q Q +   ++Y+  +D   K+++ +GIRG+Y GL  
Sbjct: 505 LLGSVAGCIGATAVYPIDLVKTRMQAQRNF--SQYKNSIDCFVKIFSREGIRGIYSGLGP 562

Query: 181 TLIFRTHFVYWWGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVI 240
            L+          +     R    + N   T                    P +++K  +
Sbjct: 563 QLVGVAPEKAIKLTVNDYVRKLLMDENNRLTLPLEIISGAAAGACQVIFTNPLEIVKIRL 622

Query: 241 LCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLR 296
               +Y  SL   +  A  + ++ G+RG +KG V   +R  P +A    ++  + R
Sbjct: 623 QVRSEYADSLPKSQLTALGVVKSLGLRGLYKGLVACLMRDVPFSAIYFPTYAHLKR 678

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 83.6 bits (205), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 76/319 (23%), Positives = 126/319 (39%), Gaps = 49/319 (15%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQT----------------------SQDTGRFKGPL 59
           FV+G   G+A   V  PFD +K RLQ+                      +Q    FK   
Sbjct: 56  FVAGGIGGMAGAVVTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETF 115

Query: 60  DCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGC 119
             +    R +G R  + G  P LVG I   S+        + +  K +   +E + +   
Sbjct: 116 GIISNVYRNEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKTLNNGQEAVWIH-- 173

Query: 120 ILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLV 179
           +++   AGW+ S    P+ L K +LQ+     T +Y+   D +K V   +GI G+YKGL 
Sbjct: 174 LMAAATAGWATSTATNPIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQKEGILGLYKGLS 233

Query: 180 STLIFRTHFVYWWGSYELLTRWFKANT-----NLSDTAINXXXXXXX----------XXX 224
           ++ +     +  W  YE +    K  +     N+S+   +                    
Sbjct: 234 ASYLGSVEGILQWVLYEQMKHIIKQRSMEKFGNISEVEKSTSDKIKEWCQRSGSAGLAKF 293

Query: 225 XXXXXAYPSDVI----KQVILCND--KYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFL 278
                 YP +V+    +Q  L N   KY G ++S R     I +  G+   + G  P  L
Sbjct: 294 VASIITYPHEVVRTRLRQAPLENGKLKYTGLVQSIR----VIIKEEGLASMYGGLTPHLL 349

Query: 279 RSFPANAAALASFEFVLRV 297
           R+ P +     ++E V+R+
Sbjct: 350 RTVPNSIIMFGTWELVIRL 368

>Scas_697.47
          Length = 328

 Score = 81.6 bits (200), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 79/299 (26%), Positives = 121/299 (40%), Gaps = 29/299 (9%)

Query: 13  NEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGR-------FKGPLDCVYQT 65
           N     +   V+G   G+     GHPFD IKVR Q+ Q +          K         
Sbjct: 31  NAIRDNLKSLVAGGVGGVCAVLTGHPFDLIKVRCQSGQASSTIHAIKIILKDARAIPTSN 90

Query: 66  MRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEE---KLPLSGCILS 122
           M    ++GFY G  PPL+G   + +V       Y  + KK V + +    +L +     +
Sbjct: 91  MLVNSVKGFYKGVIPPLLGVTPIFAV---SFWGYD-VGKKIVTRSDSSSAQLTMGQMAAA 146

Query: 123 GVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTL 182
           G ++    + + AP E  K  LQ       T + G     K +    G++ ++KG ++TL
Sbjct: 147 GFISAIPTTLVTAPTERIKVVLQTAGANSKTSFIG---AAKNIVKDGGVKSLFKGSLATL 203

Query: 183 IFR-THFVYWWGSYELLTRWFK-----ANTNLSDTAI-NXXXXXXXXXXXXXXXAYPSDV 235
                    ++ SYE+  ++       A +   +  I N                +P D 
Sbjct: 204 ARDGPGSALYFASYEISKKFLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPIDT 263

Query: 236 IKQVILCNDKYDGSLRSWRNAASDIWRTRG-IRGFFKGFVPSFLRSFPANAAALASFEF 293
           IK  +       GS +S   A  +I+  RG I+GFF G  P+ LRSFPANAA     E 
Sbjct: 264 IKTKL---QSSSGS-QSMVAATREIYVKRGGIKGFFPGLGPALLRSFPANAATFLGVEL 318

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 80.1 bits (196), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 65/293 (22%), Positives = 122/293 (41%), Gaps = 28/293 (9%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDT-------------GRFKGPLDCVYQTMRQ 68
           F +G  +G+++  V +P D +K R+Q    T               + G +DC+ + +++
Sbjct: 15  FTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKIVKK 74

Query: 69  QGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGW 128
           +G    Y G T P++      ++       ++   KK       ++     I SG  AG 
Sbjct: 75  EGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQKIAIYSGASAGA 134

Query: 129 SVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHF 188
             +F+ AP EL K +LQ       ++++ P++V+K      G+  ++ GL +T I+R H 
Sbjct: 135 VEAFVVAPFELVKIRLQ----DVNSQFKTPIEVVKNSVVKGGVLSLFNGLEAT-IWR-HV 188

Query: 189 VYWWGSYELL---TRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDK 245
           ++  G + ++    +   A    ++   N                 P DV+K  I    +
Sbjct: 189 LWNAGYFGIIFQIRKLLPAAKTSTEKTRNDLIAGAIGGTVGCLLNTPFDVVKSRI---QR 245

Query: 246 YDGSLRSWRNAASDI---WRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVL 295
             G LR +  +   +   +R  G +  +KGF P  +R  P     L  F  V+
Sbjct: 246 SSGPLRKYNWSLPSVLLVYREEGFKALYKGFAPKVMRLAPGGGLLLVVFTNVM 298

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/172 (21%), Positives = 77/172 (44%), Gaps = 6/172 (3%)

Query: 12  PNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGI 71
           PN   ++ +   SG  +G  +  V  PF+ +K+RLQ      +FK P++ V  ++ + G+
Sbjct: 116 PNGEMTQKIAIYSGASAGAVEAFVVAPFELVKIRLQDVNS--QFKTPIEVVKNSVVKGGV 173

Query: 72  RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVS 131
              + G    +   +L ++   G +   R LL       E+       +++G + G    
Sbjct: 174 LSLFNGLEATIWRHVLWNAGYFGIIFQIRKLLPAAKTSTEKT---RNDLIAGAIGGTVGC 230

Query: 132 FIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183
            +  P ++ K+++Q +      +Y   L  +  VY  +G + +YKG    ++
Sbjct: 231 LLNTPFDVVKSRIQ-RSSGPLRKYNWSLPSVLLVYREEGFKALYKGFAPKVM 281

 Score = 35.4 bits (80), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 37/83 (44%), Gaps = 11/83 (13%)

Query: 114 LPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQ-----------TTRYRGPLDVI 162
           LP      +G +AG S   +  P+++ K ++Q+Q   +              Y G +D +
Sbjct: 9   LPFIYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCL 68

Query: 163 KKVYAADGIRGMYKGLVSTLIFR 185
            K+   +G   +YKG+ S ++  
Sbjct: 69  TKIVKKEGFSHLYKGITSPILME 91

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 80.5 bits (197), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 73/304 (24%), Positives = 120/304 (39%), Gaps = 51/304 (16%)

Query: 38  PFDTIKVRLQTS-----------QDTG------------RFKGPLDCVYQTMRQQGIRGF 74
           PFD +K RLQ+            Q+ G             FK     +    RQ+G R  
Sbjct: 70  PFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGFRSL 129

Query: 75  YLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIA 134
           + G  P LVG I   S+        + +  + +   +E   +   +L+   AGW+ S + 
Sbjct: 130 FKGLGPNLVGVIPARSINFLTYGTTKDIYSRTLNNGQEAPWIH--LLAAATAGWATSTVT 187

Query: 135 APVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYWWGS 194
            P+ L K +LQ+   A T  Y+  LD IK V   +G+ G+YKGL ++ +     +  W  
Sbjct: 188 NPIWLVKTRLQLD-KAGTKTYKNSLDCIKSVVKNEGVLGLYKGLSASYLGSVEGILQWIL 246

Query: 195 YELLTRWFKANT------------NLSDTA---INXXXXXXXXXXXXXXXAYPSDVI--- 236
           YE + R  K  +            + SD                       YP +V+   
Sbjct: 247 YEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGLAKFVASIVTYPHEVVRTR 306

Query: 237 -KQVILCND--KYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEF 293
            +Q    N   KY G ++S+R     I +  G+   + G  P  LR+ P +     ++E 
Sbjct: 307 LRQAPTENGKLKYTGLVQSFRV----IIKEEGLVSMYSGLTPHLLRTVPNSIIMFGTWEL 362

Query: 294 VLRV 297
           V+++
Sbjct: 363 VIKL 366

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 93/201 (46%), Gaps = 30/201 (14%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQ-DTGRFKGPLDCVYQTMRQQGIRGFYLGFTP 80
            ++   +G A + V +P   +K RLQ  +  T  +K  LDC+   ++ +G+ G Y G + 
Sbjct: 173 LLAAATAGWATSTVTNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYKGLSA 232

Query: 81  PLVG-------WILMDSVMLGCLHNYRML----LKKYVYQHEEKLPLSG-----CILSGV 124
             +G       WIL + +        R++    ++K+ + HE+    S      C  SG 
Sbjct: 233 SYLGSVEGILQWILYEQMK-------RIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGS 285

Query: 125 --LAGWSVSFIAAPVELAKAKL-QVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVST 181
             LA +  S +  P E+ + +L Q   +    +Y G +   + +   +G+  MY GL   
Sbjct: 286 AGLAKFVASIVTYPHEVVRTRLRQAPTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPH 345

Query: 182 LIFRT--HFVYWWGSYELLTR 200
           L+ RT  + +  +G++EL+ +
Sbjct: 346 LL-RTVPNSIIMFGTWELVIK 365

>Kwal_27.12081
          Length = 369

 Score = 78.6 bits (192), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/300 (22%), Positives = 118/300 (39%), Gaps = 46/300 (15%)

Query: 38  PFDTIKVRLQT-------------------SQDTGRFKGPLDCVYQTMRQQGIRGFYLGF 78
           PFD +K RLQ+                   S     F+     +    + +G R  + G 
Sbjct: 72  PFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSLFKGL 131

Query: 79  TPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVE 138
            P LVG I   S+        + +  +  + + E+ P    I S   AGW+ S    P+ 
Sbjct: 132 GPNLVGVIPARSINFFTYGTTKQIYSR-AFNNGEEAPWIHLI-SAATAGWATSTATNPIW 189

Query: 139 LAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYWWGSYELL 198
           L K +LQ+     T +Y+   D +K +   +G  G+YKGL ++ +     +  W  YE +
Sbjct: 190 LIKTRLQLDKAGHTRQYKNSWDCLKHIIQKEGFFGLYKGLSASYLGSVEGILQWLLYEQM 249

Query: 199 TRWFKANT-----NLSDTAINXXXXXXX----------XXXXXXXXAYPSDVI----KQV 239
            +  K  +     ++S+   N                          YP +V+    +Q 
Sbjct: 250 KQMIKMRSIEKFGHISEGEKNTSEKIKEWCQRSGSAGLAKFLASIVTYPHEVVRTRLRQA 309

Query: 240 ILCND--KYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRV 297
            L ND  KY G ++S+R     I +  G+   + G  P  LR+ P +     ++E V+++
Sbjct: 310 PLENDKLKYTGLIQSFR----VIIKEEGLASMYGGLTPHLLRTVPNSIIMFGTWELVIKL 365

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 91/198 (45%), Gaps = 23/198 (11%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQ--DTGRFKGPLDCVYQTMRQQGIRGFYLGFT 79
            +S   +G A +   +P   IK RLQ  +   T ++K   DC+   ++++G  G Y G +
Sbjct: 171 LISAATAGWATSTATNPIWLIKTRLQLDKAGHTRQYKNSWDCLKHIIQKEGFFGLYKGLS 230

Query: 80  PPLVG-------WILMDSVMLGCLHNYRMLLK-KYVYQHE----EKLPLSGCILSGV--L 125
              +G       W+L +   +  +   R + K  ++ + E    EK+    C  SG   L
Sbjct: 231 ASYLGSVEGILQWLLYE--QMKQMIKMRSIEKFGHISEGEKNTSEKIK-EWCQRSGSAGL 287

Query: 126 AGWSVSFIAAPVELAKAKL-QVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIF 184
           A +  S +  P E+ + +L Q   +    +Y G +   + +   +G+  MY GL   L+ 
Sbjct: 288 AKFLASIVTYPHEVVRTRLRQAPLENDKLKYTGLIQSFRVIIKEEGLASMYGGLTPHLL- 346

Query: 185 RT--HFVYWWGSYELLTR 200
           RT  + +  +G++EL+ +
Sbjct: 347 RTVPNSIIMFGTWELVIK 364

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 79.0 bits (193), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 76/317 (23%), Positives = 121/317 (38%), Gaps = 57/317 (17%)

Query: 23  VSGMFSGIAKNAVGHPFDTIKVRLQTS--QDTGRFKGPLDCVYQT--------------- 65
           +SG  +G     +  P D  K RLQ    Q  G    P+  V  T               
Sbjct: 108 LSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTLTT 167

Query: 66  -MRQQGIRGFYLGFTPPLVG----WILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCI 120
            +R + IRG Y G  P ++G    W++  SV   C  +Y     +Y + + E L  S   
Sbjct: 168 IVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSY----PRY-FNNSEFLSHS--- 219

Query: 121 LSGVLAGWSVSFIAAPVELAKAKLQVQYDAQT---TRYRGPLDVIKKVYAADGIRGMYKG 177
           +S + AG   + +  P+ + K +L +Q        T Y+  LD   K+Y  +GI+  Y G
Sbjct: 220 MSALTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYSG 279

Query: 178 LVSTLIFRTHFVYWWGSYELLTRWF---------------KANTNLSDTAINX------X 216
           L+ +L    H    +  YE L +                   N+N   T           
Sbjct: 280 LIPSLFGLLHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNFQLGRLI 339

Query: 217 XXXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPS 276
                         YP ++++  +        S++S        +   GIRGF+ GF+ +
Sbjct: 340 VASCGSKMIASTLTYPHEILRTRLQLKSDMKPSIKSIIRTT---YAKEGIRGFYSGFLTN 396

Query: 277 FLRSFPANAAALASFEF 293
             R+ PA+A  L SFE+
Sbjct: 397 MFRTVPASAITLVSFEY 413

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 86/213 (40%), Gaps = 43/213 (20%)

Query: 23  VSGMFSGIAKNAVGHPFDTIKVRL-----QTSQDTGRFKGPLDCVYQTMRQQGIRGFYLG 77
           +S + +G     + +P   +K RL     +  +    +K  LD   +  + +GI+ FY G
Sbjct: 220 MSALTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYSG 279

Query: 78  FTPPLVGWILMDSVMLGCLHNYRMLLKKYVY--QHEEKLPLSG----------------C 119
             P L G +L  ++        + +L  Y     ++E + ++G                 
Sbjct: 280 LIPSLFG-LLHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNFQLGRL 338

Query: 120 ILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKG-- 177
           I++   +    S +  P E+ + +LQ++ D + +       +I+  YA +GIRG Y G  
Sbjct: 339 IVASCGSKMIASTLTYPHEILRTRLQLKSDMKPSIK----SIIRTTYAKEGIRGFYSGFL 394

Query: 178 -------------LVSTLIFRTHFVYWWGSYEL 197
                        LVS   FR HF  W  S E+
Sbjct: 395 TNMFRTVPASAITLVSFEYFRKHFKLWNDSIEV 427

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 75.9 bits (185), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/287 (22%), Positives = 112/287 (39%), Gaps = 20/287 (6%)

Query: 23  VSGMFSGIAKNAVGHPFDTIKVRLQT------SQDTGRFKGPLDCVYQTMRQQGIRGFYL 76
           +SG  SG     +  PFD  K RLQ       +  +  +KG         + +G  G Y 
Sbjct: 43  ISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYK 102

Query: 77  GFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAP 136
           G  P ++G+I    +            +KY        P      S + AG   +    P
Sbjct: 103 GLQPTVLGYIPTLMIYFSVYD----FCRKYSVDIFPHSPFLSNASSAITAGAISTVATNP 158

Query: 137 VELAKAKLQVQ--YDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYWWGS 194
           + + K +L +Q      +T Y+G +D  +K+   +G + +Y GLV  L+   +    +  
Sbjct: 159 IWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALLGMLNVAIQFPL 218

Query: 195 YELLTRWF--KANTNLSDTAINXX-----XXXXXXXXXXXXXAYPSDVIK-QVILCNDKY 246
           YE L   F    +T++S    +                     YP ++++ ++ L +D  
Sbjct: 219 YENLKIRFGYSESTDVSTDVTSSNFQKLILASMLSKMVASTVTYPHEILRTRMQLKSDLP 278

Query: 247 DGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEF 293
           +   R         +R  G  GF+ GF  + +R+ PA    L SFE+
Sbjct: 279 NTVQRHLLPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSFEY 325

>Scas_721.27
          Length = 374

 Score = 74.3 bits (181), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 74/343 (21%), Positives = 134/343 (39%), Gaps = 56/343 (16%)

Query: 5   SDSNAVVPNEAYSRM---MGFVSGMFSGIAKNAVGHPFDTIKVRLQTS------------ 49
            DS   +  E++  +   + FV+G   G+A   V  PFD +K RLQ+             
Sbjct: 36  EDSTKKIKPESHPNVKPWVHFVAGGIGGMAGAVVTCPFDLVKTRLQSDIYQSVYKSKAAT 95

Query: 50  --------------QDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGC 95
                         Q    FK     +    +++G R  + G  P LVG I   S+    
Sbjct: 96  VTAAHNSKIANSLVQAGTHFKETFGILGNVYKREGFRSLFKGLGPNLVGVIPARSINFFT 155

Query: 96  LHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRY 155
               + +  K  + + ++ PL   ++S   AGW+ S    P+ + K ++Q+     T +Y
Sbjct: 156 YGTTKEIYSK-AFNNGQETPLIH-LMSAATAGWATSTATNPIWMIKTRVQLDKAGTTRKY 213

Query: 156 RGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYWWGSYELLTRWF------------- 202
           +   D +K V  ++GI G+Y+GL ++ +     +  W  YE +                 
Sbjct: 214 KNSWDCLKTVLKSEGIYGLYRGLSASYLGSIEGILQWLLYEQMKHLIKQRSIEKFGHEGQ 273

Query: 203 --KANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVI----KQVILCN--DKYDGSLRSWR 254
             K+ T                        YP +V+    +Q+ + N   KY G ++S+R
Sbjct: 274 LTKSRTEKIKEWCQRSGSAGVAKFIASIVTYPHEVVRTRLRQMPMENGKPKYTGLVQSFR 333

Query: 255 NAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRV 297
                I +  G+   + G  P  +R+ P +     ++E V+R+
Sbjct: 334 ----VIIKEEGLASMYSGLTPHLMRTVPNSIIMFGTWELVIRL 372

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score = 75.1 bits (183), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 79/299 (26%), Positives = 122/299 (40%), Gaps = 41/299 (13%)

Query: 16  YSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFY 75
           +  +  F  G  +G     V +P D +K R+Q  +   ++K  +DC  +   ++GIRG Y
Sbjct: 516 FDSIYNFTLGSIAGCIGATVVYPIDLVKTRMQAQRSFSQYKNSIDCFAKIFSREGIRGIY 575

Query: 76  LGFTPPLVG-------WILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGW 128
            G  P L+G        + ++  M G L +    LK Y             ILSG  AG 
Sbjct: 576 SGLGPQLIGVAPEKAIKLTVNDYMRGRLMDKHANLKWYFE-----------ILSGACAGA 624

Query: 129 SVSFIAAPVELAKAKLQV--QYDAQTTRYR-GPLDVIKKVYAADGIRGMYKGLVSTLIFR 185
                  P+E+ K +LQV  +Y     + +   L VIK++    GI+G+YKG+ + L+  
Sbjct: 625 CQVVFTNPLEVVKIRLQVRSEYAGDVLKSQVTALGVIKQL----GIKGLYKGIAACLMRD 680

Query: 186 THF--VYWWGSYELLTRWFKAN--TNLSDTAINXXXXXXXXXXXXXXXAY---PSDVIKQ 238
             F  +Y+     L    FK +         +                AY   P DVIK 
Sbjct: 681 VPFSAIYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKT 740

Query: 239 VILCN-----DKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFE 292
            +  +      +Y+G       AA  I +    + FFKG     LRS P     LA++E
Sbjct: 741 RLQIDPRKGETRYEGIFH----AARTILKEESFKSFFKGGSARVLRSSPQFGFTLAAYE 795

 Score = 53.9 bits (128), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 83/190 (43%), Gaps = 15/190 (7%)

Query: 23  VSGMFSGIAKNAVGHPFDTIKVRLQT-SQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPP 81
           +SG  +G  +    +P + +K+RLQ  S+  G            ++Q GI+G Y G    
Sbjct: 617 LSGACAGACQVVFTNPLEVVKIRLQVRSEYAGDVLKSQVTALGVIKQLGIKGLYKGIAAC 676

Query: 82  LVGWILMDSVMLGCLHNYRMLLKKYVYQHE-------EKLPLSGCILSGVLAGWSVSFIA 134
           L+  +   ++      +    LKK V++++        KL     +++G LAG   +++ 
Sbjct: 677 LMRDVPFSAIYFPTYAH----LKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLT 732

Query: 135 APVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRT--HFVYWW 192
            P ++ K +LQ+      TRY G     + +   +  +  +KG  S  + R+   F +  
Sbjct: 733 TPFDVIKTRLQIDPRKGETRYEGIFHAARTILKEESFKSFFKG-GSARVLRSSPQFGFTL 791

Query: 193 GSYELLTRWF 202
            +YE+    F
Sbjct: 792 AAYEIFQNMF 801

>Scas_602.8
          Length = 885

 Score = 74.7 bits (182), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 125/297 (42%), Gaps = 36/297 (12%)

Query: 16  YSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFY 75
           +  +  F  G  +G     + +P D IK R+Q  +   ++K  +DC+ +   ++GIRG Y
Sbjct: 496 FDSIFNFSLGSVAGCIGATLVYPIDFIKTRMQAQRSLTKYKNSIDCLVKIFGKEGIRGLY 555

Query: 76  LGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAA 135
            G  P L+G     ++ L         ++K +   +  L L   +LSG  AG        
Sbjct: 556 SGLGPQLIGVAPEKAIKLTV----NDFMRKSLVDKKGNLQLGAEVLSGATAGACQVVFTN 611

Query: 136 PVELAKAKLQVQYD--------AQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTH 187
           P+E+ K +LQV+ +        +Q T ++    +IK++     + G+YKG+ + L+    
Sbjct: 612 PLEIVKIRLQVKSEYTNAMIPKSQLTAFQ----IIKEL----KLIGLYKGVGACLLRDVP 663

Query: 188 F--VYWWGSYELLTRWFKANTNLSD--TAINXXXXXXXXXXXXXXXAY---PSDVIKQVI 240
           F  +Y+     L    F+ + N  D    +                A+   P DVIK  +
Sbjct: 664 FSAIYFPTYAHLKKNVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRL 723

Query: 241 -----LCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFE 292
                +   +Y G L + R     I +    R FFKG     +RS P     LA++E
Sbjct: 724 QIEPGVGETRYTGILHAVRT----ILKEESFRSFFKGGAARVMRSSPQFGFTLAAYE 776

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 73.6 bits (179), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 65/297 (21%), Positives = 117/297 (39%), Gaps = 39/297 (13%)

Query: 38  PFDTIKVRLQT--------SQDTGR----------FKGPLDCVYQTMRQQGIRGFYLGFT 79
           PFD +K RLQ+        +Q T R          F+  +  +     Q+G R  + G  
Sbjct: 69  PFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGLG 128

Query: 80  PPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVEL 139
           P LVG I   S+        +    + +   +E   +    L+G  AGW+ S    P+ L
Sbjct: 129 PNLVGVIPARSINFFTYGVTKDTASRLLNDGQEAPWIH--FLAGATAGWATSTATNPIWL 186

Query: 140 AKAKLQVQY--DAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYWWGSYEL 197
            K +LQ+    D ++ RY+   D +K V   +GI G+YKGL ++ +     +  W  YE 
Sbjct: 187 VKTRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGLSASYLGSVESILQWVLYEQ 246

Query: 198 LTRWFKANT-----NLSDTA----------INXXXXXXXXXXXXXXXAYPSDVIKQVILC 242
           +    +  +     ++S+                              YP +V++  +  
Sbjct: 247 MKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAAKLFASILTYPHEVVRTRLRQ 306

Query: 243 NDKYDGSLR--SWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRV 297
             K +G L+      + S I +  G    + G  P  +R+ P +     ++E V+++
Sbjct: 307 APKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVPNSIIMFGTWELVIKL 363

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 83/199 (41%), Gaps = 23/199 (11%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQ----DTGRFKGPLDCVYQTMRQQGIRGFY-- 75
           F++G  +G A +   +P   +K RLQ  +     + R+K   DC+   MR +GI G Y  
Sbjct: 167 FLAGATAGWATSTATNPIWLVKTRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKG 226

Query: 76  -----LGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPL----SGCILSGVLA 126
                LG    ++ W+L +   +  +   R + +      E K         C  SG   
Sbjct: 227 LSASYLGSVESILQWVLYEQ--MKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAG 284

Query: 127 GWSV--SFIAAPVELAKAKL-QVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183
              +  S +  P E+ + +L Q   +    +Y G       +   +G   MY GL   L+
Sbjct: 285 AAKLFASILTYPHEVVRTRLRQAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLM 344

Query: 184 FRT--HFVYWWGSYELLTR 200
            RT  + +  +G++EL+ +
Sbjct: 345 -RTVPNSIIMFGTWELVIK 362

>Kwal_23.3965
          Length = 307

 Score = 72.8 bits (177), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 91/184 (49%), Gaps = 6/184 (3%)

Query: 112 EKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGI 171
           +++P+   +++G L+G S   + AP++  K +LQ+Q  A   +Y G L   K++   +G+
Sbjct: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQL-ANEAQYGGILVTFKRLVRQEGV 68

Query: 172 RGMYKGLVSTL-IFRTHFVYWWGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXA 230
           R ++KG V  + ++  +    + SY +L +    +   +   I+               +
Sbjct: 69  RALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQ--IHTGMVGALSGTCSAIAS 126

Query: 231 YPSDVIKQVILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALAS 290
           YP DV++   + N   +  L +  + A +IWR  G RGFFKG   S +    A ++ LA+
Sbjct: 127 YPCDVLRTRFIANHSRE--LSTMLSTAQEIWRHEGFRGFFKGVSSSIVSIAVATSSILAT 184

Query: 291 FEFV 294
           +E V
Sbjct: 185 YESV 188

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/298 (20%), Positives = 118/298 (39%), Gaps = 34/298 (11%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTS-QDTGRFKGPLDCVYQTMRQQGIRGFYLGFTP 80
            V+G  SGI+   V  P DT+K+RLQ    +  ++ G L    + +RQ+G+R  + G  P
Sbjct: 18  LVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVP 77

Query: 81  PLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPL---SGCILSGVLAGWSVSFIAAPV 137
            +  +IL  S           LL K       +LP    +G +  G L+G   +  + P 
Sbjct: 78  AMAMYILYGSTQFTSYAILNKLLSK------SQLPAQIHTGMV--GALSGTCSAIASYPC 129

Query: 138 ELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLI-FRTHFVYWWGSYE 196
           ++ + +    +  + +     L   ++++  +G RG +KG+ S+++           +YE
Sbjct: 130 DVLRTRFIANHSRELSTM---LSTAQEIWRHEGFRGFFKGVSSSIVSIAVATSSILATYE 186

Query: 197 LLTRWFKANTNLSDTAINXXXXXXXXXX--XXXXXAYPSDVIK---QVI---------LC 242
            +  + +   +   + I                   +P D ++   QVI           
Sbjct: 187 SVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHT 246

Query: 243 NDKYDG----SLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLR 296
           N  Y      +  ++   A  I    G+   + G+     +S P+   +L  +E+ LR
Sbjct: 247 NKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEWCLR 304

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 62/140 (44%), Gaps = 6/140 (4%)

Query: 7   SNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTM 66
           S + +P + ++ M+G +SG  S IA     +P D ++ R   +  +      L    +  
Sbjct: 101 SKSQLPAQIHTGMVGALSGTCSAIA----SYPCDVLRTRF-IANHSRELSTMLSTAQEIW 155

Query: 67  RQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLA 126
           R +G RGF+ G +  +V   +  S +L    + ++  ++   +    + L     S V+A
Sbjct: 156 RHEGFRGFFKGVSSSIVSIAVATSSILATYESVKIFCEQRPDRDSSVIQLLESSAS-VIA 214

Query: 127 GWSVSFIAAPVELAKAKLQV 146
           G     I  P++  + + QV
Sbjct: 215 GIVSKTIVFPIDTVRKRYQV 234

>Kwal_23.4731
          Length = 314

 Score = 70.9 bits (172), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 62/294 (21%), Positives = 117/294 (39%), Gaps = 25/294 (8%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQG-----IRGFYL 76
            ++G+ +G       HP D +K+RLQ   +T    G  + +   +R         R  Y 
Sbjct: 17  IIAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVIKTIIRDSKADSNVFREAYR 76

Query: 77  GFTPPLVGWILMDSVMLGCLHNYRMLLKKY-----------VYQHEEKLPLSGCILSGVL 125
           G    L+G  +   +  G     + ++ +Y            +Q ++ +  S  + S  L
Sbjct: 77  GLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLYLASAAL 136

Query: 126 AGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFR 185
           +G   + +  P+ + K ++       + RY+   D I+KVYA +G  G ++GLV +L   
Sbjct: 137 SGLGTAILTNPIWVIKTRIMSTSSQASERYKTTWDGIRKVYAHEGFSGFWRGLVPSLFGV 196

Query: 186 THFVYWWGSYELLTRWFKANTNLSDTA----INXXXXXXXXXXXXXXXAYPSDVIK---Q 238
                ++  Y+ L   + A   +++      +                 YP  ++K   Q
Sbjct: 197 AQGAIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSVSKMLSVTAVYPFQLLKSNLQ 256

Query: 239 VILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFE 292
                +K D S R W N    I +  G++G +KG   + LR+ P+       +E
Sbjct: 257 SFAAVEKRD-SYRFW-NLVKSIHQKEGLQGLYKGLSANLLRAIPSTCITFCIYE 308

 Score = 32.3 bits (72), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 45/94 (47%), Gaps = 10/94 (10%)

Query: 115 PLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVY---AADG- 170
           PL   I++G+ AG   +    P++L K +LQ+  +  TT   G  +VIK +     AD  
Sbjct: 12  PLQREIIAGLAAGTLTTIATHPLDLVKLRLQLLVN--TTHSHGYKEVIKTIIRDSKADSN 69

Query: 171 -IRGMYKGLVSTLIFRTHFVYWWGSYELLTRWFK 203
             R  Y+GL   LI  +     WG Y  L R+ K
Sbjct: 70  VFREAYRGLGVNLIGNS---IAWGLYFGLYRFTK 100

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score = 68.9 bits (167), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 74/311 (23%), Positives = 123/311 (39%), Gaps = 31/311 (9%)

Query: 1   MSSRSDSNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQT---SQDTGRFKG 57
           MSS+  +N  V           V+G  +G+ +    HP DTIKVR+Q    + +  +  G
Sbjct: 49  MSSKKSTNPAV---------NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPG 99

Query: 58  PLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLS 117
            L         +G+  FY G    ++G I   ++       YR LL     +    +   
Sbjct: 100 FLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLAD---RQTGVVSTG 156

Query: 118 GCILSGVLAGWSVS-FIAAPVELAKAKLQVQY---DAQTTRYRGPLDVIKKVYAADGIRG 173
              L+GV AG + +  +  P+E+ K +LQ Q+    A+  +YR  +     +   +GI  
Sbjct: 157 NTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGA 216

Query: 174 MYKGLVSTLIFR-----THFVYWWGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXX 228
           +Y+G+  T   +      +F  +    E L + +  + NL     +              
Sbjct: 217 LYRGVSLTAARQATNQGANFTVYSKLMERL-QEYHGSQNLPSWETSLIGLVSGAIGPFSN 275

Query: 229 XAYPSDVIKQVILCNDKYDGSLRSWRNAAS---DIWRTRGIRGFFKGFVPSFLRSFPANA 285
              P D IK   L  DK   +L +W    +    + +  G R  +KG  P  +R  P  A
Sbjct: 276 A--PLDTIK-TRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQA 332

Query: 286 AALASFEFVLR 296
                +EFV R
Sbjct: 333 VTFTVYEFVRR 343

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score = 68.6 bits (166), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 73/320 (22%), Positives = 120/320 (37%), Gaps = 50/320 (15%)

Query: 1   MSSRSDSNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTG----RFK 56
           MSS+  S+    N A + + G  +G+F  +      HP DTIKVR+Q  + +     +  
Sbjct: 1   MSSKKKSS----NPAVNLIAGGTAGLFEALC----CHPLDTIKVRMQIYRRSALEGIKPP 52

Query: 57  GPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPL 116
           G +        ++G+   Y G    ++G I   ++       YR  L     +    +  
Sbjct: 53  GFIKTGRNIYTEEGLLALYKGLGAVVIGIIPKMAIRFSSYEFYRSALAD---KQTGSVST 109

Query: 117 SGCILSGVLAGWSVS-FIAAPVELAKAKLQVQY----DAQTTRYRGPLDVIKKVYAADGI 171
               L+GV AG + +  +  P+E+ K +LQ Q+     A + RYR  L     +   +GI
Sbjct: 110 GNTFLAGVGAGTTEAVLVVNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGI 169

Query: 172 RGMYKGLVSTLIFRT--------------HFVYWWGSYELLTRWFKANTNLSDTAINXXX 217
             +Y+G+  T   +                F+      + L  W  +   L   AI    
Sbjct: 170 GALYRGVSLTAARQATNQGANFTVYSKLKEFLQEHHKTDALPSWETSCIGLISGAIGPFS 229

Query: 218 XXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSLRSWRNAAS---DIWRTRGIRGFFKGFV 274
                         P D IK   L  DK   ++  W    +    + +  G R  +KG  
Sbjct: 230 NA------------PLDTIK-TRLQKDKSTANMSGWSRIVTIGKQLIKEEGFRALYKGIT 276

Query: 275 PSFLRSFPANAAALASFEFV 294
           P  +R  P  A     +EFV
Sbjct: 277 PRVMRVAPGQAVTFTVYEFV 296

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/305 (20%), Positives = 123/305 (40%), Gaps = 41/305 (13%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMR-----QQGIRGFYL 76
            +SG+ +G     V HP D IK+RLQ +    +     + V + ++     QQ ++  Y 
Sbjct: 16  IISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQVQRIIKDGSGTQQLLKEAYR 75

Query: 77  GFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQ------------HEEKLPLSGCILSGV 124
           G    ++G    ++V  G         K  VY             ++ K+  S  ++S  
Sbjct: 76  GLGINIIG----NAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYLVSAG 131

Query: 125 LAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIF 184
            +G + + +  P+ + K ++     +Q   Y   L+ I ++Y  +G++  ++GLV +L  
Sbjct: 132 ASGLATALLTNPMWVIKTRIMSTKSSQG--YTSILNAITRIYTEEGLKTFWRGLVPSLFG 189

Query: 185 RTHFVYWWGSYELLT-RWFKANTNLSD---TAINXXXXXXXXXXXXXXXAYPSDVIKQVI 240
            T    ++  Y+ L  ++     ++ +    A+                 YP  ++K  +
Sbjct: 190 VTQGALYFAIYDTLKLKYLHDRNDIQERRLNAVETIGIISLSKMISVSSVYPLQLLKTNL 249

Query: 241 LC-------NDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEF 293
                    N K +  +RS       IW T GI GF+KG   + +R+ P+       +E 
Sbjct: 250 QTFRTEHNENSKMNSLIRS-------IWHTNGIAGFYKGLFANLVRAIPSTCITFGVYEH 302

Query: 294 VLRVS 298
              +S
Sbjct: 303 FKHIS 307

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 68/183 (37%), Gaps = 26/183 (14%)

Query: 115 PLSGCILSGVLAGWSVSFIAAPVELAKAKLQV--------QYDAQTTRY----RGPLDVI 162
           PL   I+SG+ AG   + +  P++L K +LQ+         Y  Q  R      G   ++
Sbjct: 11  PLQKEIISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQVQRIIKDGSGTQQLL 70

Query: 163 KKVYAADGIR--------GMYKGLVSTLIFRTHFVYWWGSYELLTRWFKANTNLSDTAIN 214
           K+ Y   GI         G+Y GL          VY   S   L   F  +  ++ +   
Sbjct: 71  KEAYRGLGINIIGNAVAWGLYFGLYRC---SKDVVYSLSSEPALQNKFMNDRKMTSSM-- 125

Query: 215 XXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFV 274
                            P  VIK  I+      G   S  NA + I+   G++ F++G V
Sbjct: 126 YLVSAGASGLATALLTNPMWVIKTRIMSTKSSQG-YTSILNAITRIYTEEGLKTFWRGLV 184

Query: 275 PSF 277
           PS 
Sbjct: 185 PSL 187

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 62/299 (20%), Positives = 122/299 (40%), Gaps = 36/299 (12%)

Query: 23  VSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGF----YLGF 78
           +SG+ +G       HP D +KVRLQ      + +G  D V + ++      F    Y G 
Sbjct: 13  ISGLTAGTITTVSTHPLDLVKVRLQLLATNKKPQGYYDVVKRIVKDSKQHSFFRETYRGL 72

Query: 79  TPPLVGWILMDSVMLGCLHNYRMLLKKYVYQ--------------HEEKLPLSGCILSGV 124
              L+G    +SV  G         K +V+Q              +++++     +L+  
Sbjct: 73  GVNLLG----NSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLMYLLAAA 128

Query: 125 LAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIF 184
           ++G + S +  P+ + K ++       +  YR  +D IKK+Y  +G+ G ++GLV +L  
Sbjct: 129 MSGVATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGIKKLYRIEGLAGFWRGLVPSLFG 188

Query: 185 RTHFVYWWGSYELLTRWFKANTNLSD----TAINXXXXXXXXXXXXXXXAYPSDVIKQVI 240
            +    ++  Y+ L   + A  ++      + +                 YP  ++K  +
Sbjct: 189 VSQGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLSKMVSVTAVYPLQLLKSNL 248

Query: 241 -------LCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFE 292
                  + N K   S R W+   + I+   G+ G +KG + + +R+ P+       +E
Sbjct: 249 QSFEVSTVINPK--TSHRVWK-LITTIYVRDGVTGLYKGLLANLIRAVPSTCITFCVYE 304

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 74/183 (40%), Gaps = 21/183 (11%)

Query: 115 PLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADG---- 170
           P+   ++SG+ AG   +    P++L K +LQ+   A   + +G  DV+K++         
Sbjct: 7   PVQKEMISGLTAGTITTVSTHPLDLVKVRLQLL--ATNKKPQGYYDVVKRIVKDSKQHSF 64

Query: 171 IRGMYKGLVSTLIFRT-----HFVYWWGSYELLTRWFKA---------NTNLSDTAINXX 216
            R  Y+GL   L+  +     +F  +  S + + +W            N +   T++   
Sbjct: 65  FRETYRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLMYL 124

Query: 217 XXXXXXXXXXXXXAYPSDVIKQVILCNDKYDG-SLRSWRNAASDIWRTRGIRGFFKGFVP 275
                          P  VIK  I+     D  S RS  +    ++R  G+ GF++G VP
Sbjct: 125 LAAAMSGVATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGIKKLYRIEGLAGFWRGLVP 184

Query: 276 SFL 278
           S  
Sbjct: 185 SLF 187

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 62.8 bits (151), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 65/309 (21%), Positives = 126/309 (40%), Gaps = 33/309 (10%)

Query: 13  NEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIR 72
           +E  S     V+G  SG+       P DT+K++LQ +          + +   ++++GIR
Sbjct: 10  DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKN----ANVLINILKREGIR 65

Query: 73  GFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSF 132
           GF+ G  P  + +I+      G        L+  +  +     L  C++ G LAG + S 
Sbjct: 66  GFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISP-QLYSCLV-GSLAGMTSSL 123

Query: 133 IAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLI-FRTHFVYW 191
            + P ++ + +       Q  + R   D I  +++ +G+ G + G  S++I    +    
Sbjct: 124 ASYPFDVLRTRFAANSQGQLIKLR---DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIM 180

Query: 192 WGSYELLTRWFKANTNLSD-----TAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKY 246
           +G YE +  + +  + LSD     T +N                +P D +++ I   +  
Sbjct: 181 FGVYESIKIFTEERSKLSDRRDPFTLLN-ELAGPISGFTSKLATFPLDTVRRRIQIRNSP 239

Query: 247 DGSLRSWRNAASDIWRTRGIRGF----------------FKGFVPSFLRSFPANAAALAS 290
           +   R  R    DI+++   R F                ++G   S ++S P+ A +L S
Sbjct: 240 NEE-RHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWS 298

Query: 291 FEFVLRVSG 299
           +E  +   G
Sbjct: 299 YELFMNKLG 307

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 76/171 (44%), Gaps = 10/171 (5%)

Query: 104 KKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIK 163
           KK   + +E++  +  +++G L+G       AP++  K KLQV      T +    +V+ 
Sbjct: 3   KKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQV------TPHNKNANVLI 56

Query: 164 KVYAADGIRGMYKGLV-STLIFRTHFVYWWGSYELLTRWFKANTNLS-DTAINXXXXXXX 221
            +   +GIRG +KG V  ++++  +    +GSY  +  + +   +L+    +        
Sbjct: 57  NILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSL 116

Query: 222 XXXXXXXXAYPSDVIKQVILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKG 272
                   +YP DV++     N +  G L   R+    IW   G+ GFF G
Sbjct: 117 AGMTSSLASYPFDVLRTRFAANSQ--GQLIKLRDEIMAIWSHEGLMGFFSG 165

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 63.5 bits (153), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 87/180 (48%), Gaps = 18/180 (10%)

Query: 17  SRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQ----GIR 72
           S++  F++G  +G+      +P DT+K R+Q +      KG    + QT ++     G++
Sbjct: 319 SKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGR-KLMIQTAKEMYTEGGLK 377

Query: 73  GFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVY-------QHEEKLPLSGCIL--SG 123
            FY G T  ++G     ++ LG    + ML K Y+        + EE + LS  ++   G
Sbjct: 378 LFYRGVTVGVLGIFPYAALDLGT---FSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMG 434

Query: 124 VLAGWSVSFIAAPVELAKAKLQVQYD-AQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTL 182
             +G   + +  P+ L + +LQ Q   A   RY G  DV+ K    +G  G++KGLV TL
Sbjct: 435 AFSGTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGYPGLFKGLVPTL 494

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 65/310 (20%), Positives = 120/310 (38%), Gaps = 43/310 (13%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKV-----------RLQTSQDT---------GRFKGPL-D 60
           F++G  SG+       PFD +KV            L +++D           + + PL  
Sbjct: 204 FIAGGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLVK 263

Query: 61  CVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEK-LPLSGC 119
            +    RQ GI+ FY+G     +      S+  G     + L+ K     + K L     
Sbjct: 264 AIISLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTKVENCKDTKDLSKLST 323

Query: 120 ILSGVLAGWSVSFIAAPVELAKAKLQVQ-YDAQTTRYRGPLDVIKKVYAADGIRGMYKGL 178
            ++G LAG    F   P++  K ++Q    +A+    +  +   K++Y   G++  Y+G+
Sbjct: 324 FIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAKEMYTEGGLKLFYRGV 383

Query: 179 -VSTLIFRTHFVYWWGSYELLTRWF------KANTNLSDTAINXXXXXXXXXXXXXXXA- 230
            V  L    +     G++ +L +W+      K N    D  ++               A 
Sbjct: 384 TVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAFSGTFGAT 443

Query: 231 --YPSDVIKQVILCND------KYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFP 282
             YP ++++  +          +YDG    +R+      +  G  G FKG VP+  +  P
Sbjct: 444 VVYPINLLRTRLQAQGTFAHPYRYDG----FRDVLLKTIQREGYPGLFKGLVPTLAKVCP 499

Query: 283 ANAAALASFE 292
           A + +   +E
Sbjct: 500 AVSISYLCYE 509

 Score = 31.6 bits (70), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 69/180 (38%), Gaps = 19/180 (10%)

Query: 132 FIAAPVELAKAKLQVQYD-------AQTTRYRGPL-DVIKKVYAADGIRGMY--KGLVST 181
           F+ A  +L+   L    D       A+  + R PL   I  +Y   GI+  Y   GL + 
Sbjct: 227 FLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLVKAIISLYRQGGIKSFYVGNGLNAL 286

Query: 182 LIFRTHFVYWWGSYELLTRWFKANTNLSDTA----INXXXXXXXXXXXXXXXAYPSDVIK 237
            +F    +  +GS+E+  +      N  DT     ++                YP D +K
Sbjct: 287 KVFPESSI-KFGSFEITKKLMTKVENCKDTKDLSKLSTFIAGGLAGVCAQFSVYPIDTLK 345

Query: 238 QVILCNDKYDGSLRSWR---NAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFV 294
             + C    +  L+  +     A +++   G++ F++G     L  FP  A  L +F  +
Sbjct: 346 FRMQCA-PLNAELKGRKLMIQTAKEMYTEGGLKLFYRGVTVGVLGIFPYAALDLGTFSML 404

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 63.2 bits (152), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 87/180 (48%), Gaps = 18/180 (10%)

Query: 17  SRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQT----MRQQGIR 72
           S+   +++G  +G+A     +P DT+K R+Q +    + KG  + ++QT     R+ G+R
Sbjct: 346 SKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGN-NLLFQTAKDMFREGGLR 404

Query: 73  GFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEE--KLPLSGCILS-------G 123
            FY G T  +VG     ++ LG    +  L K Y+ +  +   LP     LS       G
Sbjct: 405 LFYRGVTVGIVGIFPYAALDLGT---FSALKKWYIAKQAKTLNLPQDQVTLSNLVVLPMG 461

Query: 124 VLAGWSVSFIAAPVELAKAKLQVQYD-AQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTL 182
             +G   + +  P+ L + +LQ Q   A    Y G  DV+ K    +G +G++KGLV TL
Sbjct: 462 AFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVPTL 521

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 60/308 (19%), Positives = 113/308 (36%), Gaps = 39/308 (12%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRL--------------------QTSQDTGRFKGPLDC 61
           F++G  SG+       PFD +KV L                      + D  +   PL  
Sbjct: 231 FIAGGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSPLAK 290

Query: 62  VYQTM-RQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEK-LPLSGC 119
             +++ RQ GI+ FY+G    ++      S+  G     + ++ K     + K L     
Sbjct: 291 AVKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLSKFST 350

Query: 120 ILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGP---LDVIKKVYAADGIRGMYK 176
            ++G LAG +  F   P++    K +VQ     T+ +G        K ++   G+R  Y+
Sbjct: 351 YIAGGLAGMAAQFSVYPID--TLKFRVQCAPLDTKLKGNNLLFQTAKDMFREGGLRLFYR 408

Query: 177 GLVSTLI-FRTHFVYWWGSYELLTRWFKANT----NLSDTAINXXXXXXX-----XXXXX 226
           G+   ++    +     G++  L +W+ A      NL    +                  
Sbjct: 409 GVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLPMGAFSGTVG 468

Query: 227 XXXAYPSDVIKQVILCNDKYDGS--LRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPAN 284
               YP ++++  +     Y        +++         G +G FKG VP+  +  PA 
Sbjct: 469 ASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVPTLAKVCPAV 528

Query: 285 AAALASFE 292
           + +   +E
Sbjct: 529 SISYLCYE 536

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 62.8 bits (151), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 82/180 (45%), Gaps = 18/180 (10%)

Query: 17  SRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGP---LDCVYQTMRQQGIRG 73
           SR+  +++G   G+A     +P DT+K R+Q +      K     L    +  +Q GIR 
Sbjct: 318 SRLSTYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQGGIRL 377

Query: 74  FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEK---LPLSGCILS-------G 123
           FY G    ++G     ++ LG        LKK+  + E K   LP    I+S       G
Sbjct: 378 FYRGVHIGVMGIFPYAALDLGTFS----ALKKWYIKKEAKKTGLPEDEVIISNLIVLPMG 433

Query: 124 VLAGWSVSFIAAPVELAKAKLQVQYD-AQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTL 182
             +G   + +  P+ L + +LQ Q   A    Y G  DV+KK    +G +G++KGLV  L
Sbjct: 434 AFSGTVGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPNL 493

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 66/313 (21%), Positives = 120/313 (38%), Gaps = 39/313 (12%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKV----------RLQTSQDT----------GRFKGPLDC 61
           F++G  SG+       PFD IKV           L  S+DT           + K PL  
Sbjct: 203 FIAGGCSGVVSRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSPLIK 262

Query: 62  VYQTM-RQQGIRGFYLGFTPPLVGWILMDSVMLGCLH-NYRMLLKKYVYQHEEKLPLSGC 119
              T+ RQ G+R FY+G    +V      ++  G      R++ +    +   +L     
Sbjct: 263 AATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENVKDTSELSRLST 322

Query: 120 ILSGVLAGWSVSFIAAPVELAKAKLQVQ-YDAQTTRYRGPLDVIKKVYAADGIRGMYKGL 178
            ++G L G +  F   P++  K ++Q    +    +    L   K++Y   GIR  Y+G+
Sbjct: 323 YIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQGGIRLFYRGV 382

Query: 179 -VSTLIFRTHFVYWWGSYELLTRWF----KANTNLSDTAINXXXXXXX-----XXXXXXX 228
            +  +    +     G++  L +W+       T L +  +                    
Sbjct: 383 HIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGTVGAT 442

Query: 229 XAYPSDVIKQVILCNDKYDGSLRSWRNAASDIWRT----RGIRGFFKGFVPSFLRSFPAN 284
             YP ++++  +     Y  +     N  SD+ +      G +G FKG VP+  +  PA 
Sbjct: 443 LVYPINLLRTRLQAQGTY--AHPHTYNGFSDVLKKTIQREGYQGLFKGLVPNLAKVCPAV 500

Query: 285 AAALASFEFVLRV 297
           + +   +E + R+
Sbjct: 501 SISYLCYENLKRL 513

>Kwal_55.21338
          Length = 323

 Score = 62.0 bits (149), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 73/167 (43%), Gaps = 9/167 (5%)

Query: 37  HPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCL 96
           +P   +  +LQT    G      D +    R+ G  GF+ G    L G  L + V   C 
Sbjct: 41  YPLIVVTTKLQTQDAKGEKLSLADTIKDIYRKDGAMGFFAGLESALFGTTLSNFVYYYCY 100

Query: 97  H-NYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRY 155
             + R +L+    +H ++L  +  +L G +AG   +  A P+ +A  ++ VQ        
Sbjct: 101 EASSRCVLRA---RHTQRLTTAESMLVGSIAGSLNATAANPLWVANTRMTVQKSD----- 152

Query: 156 RGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYWWGSYELLTRWF 202
           RG L  I  +   +GI G++KGL   LI   + +  +  YE L  W 
Sbjct: 153 RGTLSTIFDIVKDEGISGLFKGLNPALILVINPIIQYTVYEQLKNWI 199

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 93/209 (44%), Gaps = 30/209 (14%)

Query: 15  AYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGF 74
           A S ++G ++G  +  A N    P      R+ T Q + R  G L  ++  ++ +GI G 
Sbjct: 119 AESMLVGSIAGSLNATAAN----PLWVANTRM-TVQKSDR--GTLSTIFDIVKDEGISGL 171

Query: 75  YLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSG--CILSGVLAGWSVSF 132
           + G  P L+  ++++ ++   ++     LK ++    +   LS     + G +   + + 
Sbjct: 172 FKGLNPALI--LVINPIIQYTVYEQ---LKNWILSSRQTRTLSPSWAFILGAVGKLAATG 226

Query: 133 IAAPVELAKAKLQVQYDAQTTRYRGP---LDVIKKVYAADGIRGMYKG----LVSTLI-- 183
              P    KA++ +  + +++    P   L ++ ++   DGI G+Y+G    LV +++  
Sbjct: 227 STYPYVTMKARMHLLGEHKSSTAAPPRSLLSLMAEIIKKDGILGLYRGIGIKLVQSILTA 286

Query: 184 -----FRTHFVYWWGSYELLTRWFKANTN 207
                F+   V W  S  +L  W + NT 
Sbjct: 287 AFLFFFKEGLVIW--SMRVLRAWSRFNTK 313

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 61.6 bits (148), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 71/301 (23%), Positives = 134/301 (44%), Gaps = 46/301 (15%)

Query: 5   SDSNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDT-------GRFKG 57
           S++     N A   +MG VS   + +AK A   P + +K+ +Q   +         R+KG
Sbjct: 2   SETKKPQSNFAIDFLMGGVS---AAVAKTAA-SPIERVKLLIQNQDEMIKQGSLDHRYKG 57

Query: 58  PLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLP-- 115
            +DC  +T RQ+GI  F+ G T  ++ +    ++        + +   + ++ EE     
Sbjct: 58  IVDCFQRTARQEGIISFWRGNTANVIRYFPTQALNFAFKDQIKAM---FGFKKEEGYAKW 114

Query: 116 LSGCILSGVLAG-WSVSFIAAPVELAKAKLQVQYDAQTTR------YRGPLDVIKKVYAA 168
            +G + SG +AG  S+ F+     L  A+ ++  DA++++      + G +DV KK  A+
Sbjct: 115 FAGNLASGGIAGGLSLMFV---YSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIAS 171

Query: 169 DGIRGMYKGLVSTLI-FRTHFVYWWGSYE-----LLTRWFKANTNLSDTAINXXXXXXXX 222
           DG+ G+Y+G + ++I    +   ++G Y+     LLT       +L  + I         
Sbjct: 172 DGVAGLYRGFLPSVIGIVVYRGLYFGLYDSCKPLLLT------GSLEGSFIASFLLGWVV 225

Query: 223 XXXXXXXAYPSDVIKQVILCND----KYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFL 278
                  +YP D +++ ++       KY G++    +    I    G+   FKG   + L
Sbjct: 226 TTGASTASYPLDTVRRRMMMTSGQAVKYKGAM----DCLQKIVAAEGVSSLFKGCGANIL 281

Query: 279 R 279
           R
Sbjct: 282 R 282

>Scas_578.3*
          Length = 524

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 82/180 (45%), Gaps = 16/180 (8%)

Query: 17  SRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGP---LDCVYQTMRQQGIRG 73
           S++  +V+G  +G+      +P DT+K R+Q +   G  KG    +    +  ++ GIR 
Sbjct: 325 SKLQTYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEGGIRV 384

Query: 74  FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKL--PLSGCILS-------GV 124
           FY G     +G     ++ LG    +  L K Y+ +  +KL  P    +LS       G 
Sbjct: 385 FYRGVLLGALGIFPYAALDLGT---FSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGA 441

Query: 125 LAGWSVSFIAAPVELAKAKLQVQYD-AQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183
            +G   +    P+ L + +LQ Q   A    Y G  DV  +    +G+ G YKGLV TL+
Sbjct: 442 FSGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPTLV 501

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 64/316 (20%), Positives = 115/316 (36%), Gaps = 57/316 (18%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDT------------------GRFKGPL-DCV 62
           F++G  SG+       P D IKV L    D                    + + P+   +
Sbjct: 212 FIAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSPIIKAI 271

Query: 63  YQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILS 122
               RQ G+R FY+G    +       S+  G     + L+            LSG  L 
Sbjct: 272 RSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMAN----------LSGDKLV 321

Query: 123 GVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYR---GPLD-----------VIKKVYAA 168
             L+    +++A  +    A++ + Y   T ++R    PL+             K++Y  
Sbjct: 322 NDLSKLQ-TYVAGGIAGVMAQISI-YPIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKE 379

Query: 169 DGIRGMYKG-LVSTLIFRTHFVYWWGSYELLTRWF------KANTNLSDTAINXXXXXXX 221
            GIR  Y+G L+  L    +     G++  L +W+      K N    D  ++       
Sbjct: 380 GGIRVFYRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPM 439

Query: 222 XXXXXXXXA---YPSDVIKQVILCNDKYDG--SLRSWRNAASDIWRTRGIRGFFKGFVPS 276
                   A   YP ++++  +     Y    +   +R+      +  G+ GF+KG VP+
Sbjct: 440 GAFSGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPT 499

Query: 277 FLRSFPANAAALASFE 292
            ++  PA +     +E
Sbjct: 500 LVKVCPAVSIGYLCYE 515

>Scas_718.24
          Length = 337

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 76/157 (48%), Gaps = 19/157 (12%)

Query: 37  HPFDTIKVRL----QTSQDTG--RFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDS 90
           +  D  + RL    ++S+  G  +F G +D   +T++  G+ G Y GF P +VG I+   
Sbjct: 165 YSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIIVYRG 224

Query: 91  VMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAA----PVELAKAKLQV 146
           +  G   + + +L            L G  L+  L GW V+  A+    P++  + K+ +
Sbjct: 225 LYFGLYDSIKPVLLTG--------SLEGSFLASFLLGWVVTTGASTCSYPLDTVRRKMMM 276

Query: 147 QYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183
               Q  +Y+G  D  KK+ AA+G+  ++KG  + ++
Sbjct: 277 T-SGQAVKYKGAFDCFKKIVAAEGVASLFKGCGANIL 312

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 61/290 (21%), Positives = 124/290 (42%), Gaps = 40/290 (13%)

Query: 13  NEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDT-------GRFKGPLDCVYQT 65
           N A   +MG VS   + +AK A   P + +K+ +Q   +         ++KG +DC  +T
Sbjct: 41  NFAIDFLMGGVS---AAVAKTAA-SPIERVKLLIQNQNEMLKQGTLDTKYKGIVDCFRRT 96

Query: 66  MRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLP--LSGCILSG 123
            +Q+GI  F+ G T  ++ +    ++        +++   + ++ E+      +G + SG
Sbjct: 97  AQQEGIISFWRGNTANVIRYFPTQALNFAFKDKIKLM---FGFKKEDGYGKWFAGNLASG 153

Query: 124 VLAGWSVSFIAAPVELAKAKLQVQYDAQ----TTRYRGPLDVIKKVYAADGIRGMYKG-- 177
             AG         ++ A+ +L     +     + ++ G +DV KK   +DG+ G+Y+G  
Sbjct: 154 GAAGGLSLLFVYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGFL 213

Query: 178 --LVSTLIFRTHFVYWWGSYE--LLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPS 233
             +V  +++R  +   + S +  LLT       +L  + +                +YP 
Sbjct: 214 PSVVGIIVYRGLYFGLYDSIKPVLLT------GSLEGSFLASFLLGWVVTTGASTCSYPL 267

Query: 234 DVIKQVILCND----KYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLR 279
           D +++ ++       KY G+   ++     I    G+   FKG   + LR
Sbjct: 268 DTVRRKMMMTSGQAVKYKGAFDCFKK----IVAAEGVASLFKGCGANILR 313

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 84/179 (46%), Gaps = 16/179 (8%)

Query: 17  SRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKG-PL--DCVYQTMRQQGIRG 73
           SR+  +V+G   GI      +P DT+K R+Q +    R +G PL         R+ G+R 
Sbjct: 294 SRLSTYVAGGLGGIMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGLRL 353

Query: 74  FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSG--CILS-------GV 124
           FY G    ++G     ++ LG    +  L + Y+ +    L +S    ++S       G 
Sbjct: 354 FYRGLGVGILGVFPYAALDLG---TFSALKRWYITRRANALGISENEVVMSNLVVLPMGA 410

Query: 125 LAGWSVSFIAAPVELAKAKLQVQYD-AQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTL 182
            +G   + +  P+ L + +LQ Q   A   RY G  DV +K    +G+ G+YKGLV TL
Sbjct: 411 FSGTVGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTL 469

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 69/299 (23%), Positives = 114/299 (38%), Gaps = 43/299 (14%)

Query: 38  PFDTIKV-----------RLQTSQ---------DTGRFKGPLDCVYQTM-RQQGIRGFYL 76
           PFD IKV            L T +         D  + + PL     ++ RQ G+R FYL
Sbjct: 195 PFDRIKVFLIARTDLSSPLLHTPEQLLHHNPRADPAKIRSPLVKAATSLYRQGGLRAFYL 254

Query: 77  GFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEE-KLPLSGCILSGVLAGWSVSFIAA 135
           G    ++      ++  G     + +L       E  +L      ++G L G    F   
Sbjct: 255 GNGLNVIKVFPESAMKFGSFELAKRVLAGLEGCGETGELSRLSTYVAGGLGGIMAQFSVY 314

Query: 136 PVELAKAKLQVQYDAQTTRYRG-PL--DVIKKVYAADGIRGMYKGL-VSTLIFRTHFVYW 191
           P++    K ++Q     TR RG PL     K +Y   G+R  Y+GL V  L    +    
Sbjct: 315 PID--TLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGLRLFYRGLGVGILGVFPYAALD 372

Query: 192 WGSYELLTRWF---KANT-NLSDTAINXXXXXXX-----XXXXXXXXAYPSDVIKQVILC 242
            G++  L RW+   +AN   +S+  +                      YP ++++  +  
Sbjct: 373 LGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTVGATVVYPINLLRTRLQA 432

Query: 243 NDKYDGSLRSWRNAASDIWRT----RGIRGFFKGFVPSFLRSFPANAAALASFEFVLRV 297
              Y    R   +   D++R      G+ G +KG VP+  +  PA A +   +E + R 
Sbjct: 433 QGTYAHPHRY--DGFQDVFRKTVQREGLPGLYKGLVPTLAKVCPAVAISYLCYENLKRA 489

>Kwal_14.2210
          Length = 315

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 65/294 (22%), Positives = 120/294 (40%), Gaps = 23/294 (7%)

Query: 20  MGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFK-GPLDCVYQTMRQQGIRGFYLGF 78
           + F +G  +G     V  PF+ +K+ LQ    T  +  G    V Q   ++G+ G   G 
Sbjct: 19  IAFCAGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNHGLFRAVKQVYLEEGVPGLLRGN 78

Query: 79  TPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLS-GCILSGVLAGWSVSFIAAPV 137
               +      +V       Y    K++  Q+ + + L+   ++SG L G        P+
Sbjct: 79  GLNCIRIFPYSAVQFLV---YEFCKKQWFQQNPDTVVLNWHRLVSGALCGGCSVLATYPL 135

Query: 138 ELAKAKLQVQYDAQTTRYR-----------GPLDVIKKVYAADG-IRGMYKGLVSTLIFR 185
           +L + +L +Q  A   R             G  ++++K Y  +G I G+Y+G+  T I  
Sbjct: 136 DLVRTRLSIQ-TANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIGV 194

Query: 186 THFVYW-WGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIK---QVIL 241
             +V   +  YE L  +  A+ + +  ++                 YP D+++   QV+ 
Sbjct: 195 VPYVALNFAVYEQLREYIPASFDPASASLYKLSIGAISGGVAQTITYPFDLLRRRFQVLA 254

Query: 242 CNDKYDG-SLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFV 294
                 G   +S  +A   I RT G +G++KG   +  +  P+ A +   +E V
Sbjct: 255 MGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKVVPSTAVSWVVYETV 308

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 69/292 (23%), Positives = 111/292 (38%), Gaps = 35/292 (11%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKG---PLDCVYQTMRQQGIRGFYLGF 78
             +G F+GI ++++  P D IK R+Q    TG       P + + Q  +     G     
Sbjct: 21  LAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEG----- 75

Query: 79  TPPLVGWILMDSVMLGC-------LHNYRMLLKKYVYQHEEKL--PLSGCILSGVLAGWS 129
              L  W  + SV+LG           Y M   + +   + +   PL    LSG LA  +
Sbjct: 76  --SLALWKGVQSVVLGAGPAHAVYFATYEMCKSRLIDPEDRQTHQPLKTA-LSGTLATVA 132

Query: 130 VSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFV 189
              +  P +  K +LQ+      T+         ++Y  +GI   +    +T+     F 
Sbjct: 133 ADALMNPFDTIKQRLQLHPSDSMTK------CAVRMYQREGIAAFFYSYPTTIAMNIPFA 186

Query: 190 YW-WGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCN--DKY 246
              +  YE  T+ F  + N +                      P D +K V+     D  
Sbjct: 187 ALNFVIYESSTKIFNPSNNYNPWI--HCLCGGISGATCAAITTPLDCVKTVLQIRGADSV 244

Query: 247 DGSL----RSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFV 294
              L     ++R AAS I +T G  GFF+G  P  + + PA A +  S+EF 
Sbjct: 245 QSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISNMPATAISWTSYEFA 296

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 78/202 (38%), Gaps = 37/202 (18%)

Query: 23  VSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPL 82
           +SG  + +A +A+ +PFDTIK RLQ        K    C  +  +++GI  F+  +   +
Sbjct: 124 LSGTLATVAADALMNPFDTIKQRLQLHPSDSMTK----CAVRMYQREGIAAFFYSYPTTI 179

Query: 83  VGWILMDSVMLGCLHNYRMLLKKYVYQHEEKL--------PLSGCILSGVLAGWSVSFIA 134
              I   +            L   +Y+   K+        P   C+  G+ +G + + I 
Sbjct: 180 AMNIPFAA------------LNFVIYESSTKIFNPSNNYNPWIHCLCGGI-SGATCAAIT 226

Query: 135 APVELAKAKLQV--------QYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFR- 185
            P++  K  LQ+        Q   +   +R     I K Y   G  G ++GL   +I   
Sbjct: 227 TPLDCVKTVLQIRGADSVQSQLFKEADTFRKAASAIHKTY---GWSGFFRGLKPRIISNM 283

Query: 186 THFVYWWGSYELLTRWFKANTN 207
                 W SYE        N+N
Sbjct: 284 PATAISWTSYEFAKHLLFTNSN 305

>Kwal_27.12481
          Length = 304

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 66/134 (49%), Gaps = 13/134 (9%)

Query: 54  RFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEK 113
           +F G +D   +T+   GI G Y GF P +VG ++   +  G   + + LL          
Sbjct: 156 QFNGLVDVYKKTLASDGIAGLYRGFLPSVVGIVVYRGLYFGGYDSLKPLLLTG------- 208

Query: 114 LPLSGCILSGVLAGWSVSFIAA----PVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAAD 169
             L G  L+  L GW+V+  A+    P++  + ++ +    Q  +Y G  D  +K+ AA+
Sbjct: 209 -SLEGSFLASFLLGWAVTTGASTASYPLDTVRRRMMMT-SGQAVKYNGAFDAFRKIVAAE 266

Query: 170 GIRGMYKGLVSTLI 183
           GI+ ++KG  + ++
Sbjct: 267 GIKSLFKGCGANIL 280

>Kwal_26.7653
          Length = 325

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 77/326 (23%), Positives = 124/326 (38%), Gaps = 41/326 (12%)

Query: 1   MSSRSDSNAVVPN------EAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQ----TSQ 50
           MS   D+ A+         +  S+   F++G  +      V +P + +K R+Q     S 
Sbjct: 1   MSKEIDTKALAAEADKPAAQKVSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSA 60

Query: 51  DTGR-FKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQ 109
           D  R +K P+  +    + +GIRG   G +   +  I ++   LG     R +L K  Y 
Sbjct: 61  DAQRIYKNPMQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYP 120

Query: 110 HEEKLPLSGC---ILSGVLAGWSVSFIAAPVELAKAKLQVQYDA----QTTRYRGPLDVI 162
             +   +      ++SG  +G   + + +P+ L K ++Q   +A    Q T Y    + +
Sbjct: 121 AMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGL 180

Query: 163 KKVYAADGIRGMYKGLVSTLIFRTHF-------VYWWGSYELLTR-WFKANTNLSDTAIN 214
             +Y A+G +G+Y+G V   I RT         +Y    + LL     K  T L   A  
Sbjct: 181 SSIYRAEGFKGLYRG-VDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVA-- 237

Query: 215 XXXXXXXXXXXXXXXAYPSDVIKQVILCNDK---YDGSLRSWRNAASDIWRTRGIRGFFK 271
                            P DVI   +  N K   Y G L  +        R  GI   +K
Sbjct: 238 ----STVSGFGVGVVMNPWDVILTRVY-NQKGNLYKGPLDCFVKTV----RIEGIGALYK 288

Query: 272 GFVPSFLRSFPANAAALASFEFVLRV 297
           GF     R  P     L   E  ++V
Sbjct: 289 GFEAQIFRIAPHTILCLTFMEQTMKV 314

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 65/301 (21%), Positives = 124/301 (41%), Gaps = 23/301 (7%)

Query: 1   MSSRSDSNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLD 60
           M    D  A+ P       +  ++G F+GI +++V  P D IK R+Q+S      +G + 
Sbjct: 1   MDEEIDYEALPPCAPLHHQL--LAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLIK 58

Query: 61  CVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGC--LHNYRMLLKKYVYQHEEKLPLSG 118
            + +    +G    + G    ++G     +V          +++  + ++ H+   P+  
Sbjct: 59  QISKITTAEGSLALWKGVQSVILGAGPAHAVYFATYEFSKSKLIDPQDMHTHQ---PIKT 115

Query: 119 CILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGL 178
            I SG+ A      +  P ++ K ++Q+      TR      V K +Y  +G    Y   
Sbjct: 116 AI-SGMAATTVADALMNPFDVIKQRMQLN-----TR-ESVWHVTKNIYHKEGFAAFYYSY 168

Query: 179 VSTLIFRTHFV-YWWGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIK 237
            +TL+    F  + +  YE  T+ F   +N  +  I+                 P D IK
Sbjct: 169 PTTLVMNIPFAAFNFAIYESATK-FMNPSNEYNPFIHCISGGLSGATCAAITT-PLDCIK 226

Query: 238 QVI------LCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASF 291
            V+        +++      +++ AAS I++  G +GF +G  P  + + PA A +  S+
Sbjct: 227 TVLQVRGSETVSNEIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSY 286

Query: 292 E 292
           E
Sbjct: 287 E 287

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 74/190 (38%), Gaps = 16/190 (8%)

Query: 115 PLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGM 174
           PL   +L+G  AG     +  PV+  K ++Q       T  +G +  I K+  A+G   +
Sbjct: 15  PLHHQLLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAAT--QGLIKQISKITTAEGSLAL 72

Query: 175 YKGLVSTLIFR--THFVYWWGSYEL-LTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAY 231
           +KG+ S ++     H VY + +YE   ++        +   I                  
Sbjct: 73  WKGVQSVILGAGPAHAVY-FATYEFSKSKLIDPQDMHTHQPIKTAISGMAATTVADALMN 131

Query: 232 PSDVIKQVILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASF 291
           P DVIKQ +  N +      S  +   +I+   G   F+  +  + + + P      A+F
Sbjct: 132 PFDVIKQRMQLNTR-----ESVWHVTKNIYHKEGFAAFYYSYPTTLVMNIP-----FAAF 181

Query: 292 EFVLRVSGAK 301
            F +  S  K
Sbjct: 182 NFAIYESATK 191

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 59.3 bits (142), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 66/318 (20%), Positives = 128/318 (40%), Gaps = 31/318 (9%)

Query: 5   SDSNAVVPNEAYSRMM-------GFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRF-K 56
           S+   V+P  +Y + +        F++G  +G     V  PF+ +K+ LQ    T  + +
Sbjct: 2   SELAQVLPQPSYVKSILKNDSNVAFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQ 61

Query: 57  GPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVY----QHEE 112
           G +  V Q  R++G  G + G     +      +V       Y    K + +    +  E
Sbjct: 62  GIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVV---YEACKKHFFHVDGSKGRE 118

Query: 113 KLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQT----------TRYRGPLDVI 162
           +L     + SG L G        P++L + +L +Q    T          ++  G  D++
Sbjct: 119 QLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLL 178

Query: 163 KKVYAADG-IRGMYKGLVSTLIFRTHFVYW-WGSYELLTRWFKANTNLSDTAINXXXXXX 220
            + Y  +G I+G+Y+G+  T +    +V   +  YE    +    T+ +           
Sbjct: 179 CRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGA 238

Query: 221 XXXXXXXXXAYPSDVIK---QVI-LCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPS 276
                     YP D+++   QV+ +  ++     +S  +A   I +T G RG++KG   +
Sbjct: 239 LSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTAN 298

Query: 277 FLRSFPANAAALASFEFV 294
             +  P+ A +   +E V
Sbjct: 299 LFKVIPSTAVSWLVYEVV 316

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 59.3 bits (142), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 82/185 (44%), Gaps = 13/185 (7%)

Query: 14  EAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQ-----TSQDTGRFKGPLDCVYQTMRQ 68
           +  S+   F +G  +      V +P + +K+R+Q      + +   +  P   +    R 
Sbjct: 14  QKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRN 73

Query: 69  QGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGC---ILSGVL 125
           +GIRG   G     +  I ++   LG     R ++ K  Y  +E   +      + +G  
Sbjct: 74  EGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAA 133

Query: 126 AGWSVSFIAAPVELAKAKLQVQYDA----QTTRYRGPLDVIKKVYAADGIRGMYKGLVST 181
           +G   + + +P+ L K +LQ   +A    + T Y G  + +K +Y  +G++G+++G +  
Sbjct: 134 SGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRG-IDA 192

Query: 182 LIFRT 186
            I RT
Sbjct: 193 AILRT 197

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 79/173 (45%), Gaps = 23/173 (13%)

Query: 24  SGMFSGIAKNAVGHPFDTIKVRLQTSQD----------TGRFKGPLDCVYQTMRQQGIRG 73
           +G  SGI    +G P   +K RLQ+  +          TG + G L  +Y T   +G++G
Sbjct: 130 AGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNG-LKTIYMT---EGVKG 185

Query: 74  FYLGFTPPLVGWILMDSVMLGCLHNYR-MLLKKYVYQHEEKLPLSGCILSGVLAGWSVSF 132
            + G    ++      SV L   +  +  LL+  + +    L L+   +SG+     V+ 
Sbjct: 186 LFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGL----GVAV 241

Query: 133 IAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFR 185
           +  P ++   ++   Y+ +   Y+GP+D + K    +GI  +YKG  +  +FR
Sbjct: 242 VMNPWDVILTRI---YNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQ-VFR 290

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 59.3 bits (142), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 82/164 (50%), Gaps = 21/164 (12%)

Query: 28  SGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVG--- 84
           SGIA   + +P   IK R+  +   G +K   D VY+  + +G+  F+ G  P L+G   
Sbjct: 123 SGIATAVLTNPIWVIKTRIMATSRAGPYKSTFDGVYKLYQTEGVLAFWRGVVPSLLGVSQ 182

Query: 85  ----WILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCI-LSGVLAGWSVSFIAAPVEL 139
               + L D++    LH+          + E +L +S  I ++ +    SV+ +  P +L
Sbjct: 183 GAIYFALYDTLKFHYLHS-------STDKAERRLSVSEIIGITCISKMISVTSV-YPFQL 234

Query: 140 AKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183
            K+KLQ  + A +    G   +++ VY+ +GIRG Y+GL + L+
Sbjct: 235 LKSKLQ-DFGAPS----GITQLVQTVYSREGIRGFYRGLSANLL 273

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 61/295 (20%), Positives = 122/295 (41%), Gaps = 25/295 (8%)

Query: 13  NEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTS---QDTGRFKGPLDCVYQTMRQQ 69
           +E  S     +SG+ +G       HP D +K+RLQ S   +    + G +  +++  RQQ
Sbjct: 3   HELTSLQREVISGLTAGTITTIASHPLDLLKLRLQLSAGNRANTTYTGLIRDIFE--RQQ 60

Query: 70  GIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQH------EEKLPLSGCILSG 123
             R  Y G    L+G  +  ++  GC    + +  +++         + +LP    +L+ 
Sbjct: 61  WGRELYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYMLAA 120

Query: 124 VLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183
             +G + + +  P+ + K ++     A    Y+   D + K+Y  +G+   ++G+V +L+
Sbjct: 121 GSSGIATAVLTNPIWVIKTRIMATSRAGP--YKSTFDGVYKLYQTEGVLAFWRGVVPSLL 178

Query: 184 FRTHFVYWWGSYELLTRWF------KANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIK 237
             +    ++  Y+ L   +      KA   LS + I                 YP  ++K
Sbjct: 179 GVSQGAIYFALYDTLKFHYLHSSTDKAERRLSVSEI--IGITCISKMISVTSVYPFQLLK 236

Query: 238 QVILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFE 292
             +    +  G+          ++   GIRGF++G   + LR+ PA       +E
Sbjct: 237 SKL----QDFGAPSGITQLVQTVYSREGIRGFYRGLSANLLRAVPATCITFFVYE 287

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 59.3 bits (142), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 65/299 (21%), Positives = 130/299 (43%), Gaps = 40/299 (13%)

Query: 5   SDSNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDT-------GRFKG 57
           SD+     N A + +MG VS   + IAK A   P + +K+ +Q   +         ++ G
Sbjct: 3   SDAKQQETNFAINFLMGGVS---AAIAKTAA-SPIERVKILIQNQDEMIKQGTLDKKYSG 58

Query: 58  PLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLP-- 115
            +DC  +T +Q+G+  F+ G T  ++ +    ++        +++   + ++ EE     
Sbjct: 59  IVDCFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLM---FGFKKEEGYGKW 115

Query: 116 LSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTR------YRGPLDVIKKVYAAD 169
            +G + SG  AG         ++ A+ +L    DA++++      + G  DV KK   +D
Sbjct: 116 FAGNLASGGAAGALSLLFVYSLDFARTRLAA--DAKSSKKGGARQFNGLTDVYKKTLKSD 173

Query: 170 GIRGMYKG----LVSTLIFRTHFVYWWGSYELLTRWFKANTNLSDTAINXXXXXXXXXXX 225
           GI G+Y+G    +V  +++R  +   + S + L        +L  + +            
Sbjct: 174 GIAGLYRGFMPSVVGIVVYRGLYFGMFDSLKPLV----LTGSLDGSFLASFLLGWVVTTG 229

Query: 226 XXXXAYPSDVIKQVILCND----KYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRS 280
               +YP D +++ ++       KY+G++   +     I  + G+   FKG   + LRS
Sbjct: 230 ASTCSYPLDTVRRRMMMTSGQAVKYNGAIDCLKK----IVASEGVGSLFKGCGANILRS 284

>Scas_691.4
          Length = 334

 Score = 58.9 bits (141), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 68/324 (20%), Positives = 116/324 (35%), Gaps = 55/324 (16%)

Query: 12  PNEAYSR-MMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTG--RFKGPLDCVYQTMRQ 68
           PN+  S  ++  V+G  +G+ +    HP DTIKVR+Q ++ T   R  G +         
Sbjct: 6   PNDKKSSPLINLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPHGFITTGRNIYSH 65

Query: 69  QGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGW 128
           +G    Y G    ++G I   ++       YR  L     +    +      L+GV AG 
Sbjct: 66  EGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRNALTD---KETRTITTGNTFLAGVGAGI 122

Query: 129 SVS-FIAAPVELAKAKLQVQY------------------DAQTTRYRGPLDVIKKVYAAD 169
           + +  +  P+E+ K +LQ Q+                       +Y   +     +   +
Sbjct: 123 TEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEE 182

Query: 170 GIRGMYKGLVSTLI--------------FRTHFVYWWGSYELLTRWFKANTNLSDTAINX 215
           G   +Y+G+  T                +   ++  + + E L  W  +   L   AI  
Sbjct: 183 GAGALYRGVSLTAARQATNQGANFTVYSYLKDYLQKYHNRESLPSWETSCIGLISGAIGP 242

Query: 216 XXXXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSLRSWRN---AASDIWRTRGIRGFFKG 272
                           P D IK   L  DK   S  +W+      + + +  G R  +KG
Sbjct: 243 FSNA------------PLDTIK-TRLQKDKSISSNSAWKKIYIIGTQLIKEEGFRALYKG 289

Query: 273 FVPSFLRSFPANAAALASFEFVLR 296
             P  +R  P  A     +EFV +
Sbjct: 290 ITPRVMRVAPGQAVTFTVYEFVRK 313

 Score = 35.4 bits (80), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 81/200 (40%), Gaps = 34/200 (17%)

Query: 8   NAVVPNEAYSRMMG--FVSGMFSGIAKNA-VGHPFDTIKVRLQTS-------QDTG---- 53
           NA+   E  +   G  F++G+ +GI +   V +P + +K+RLQ         Q  G    
Sbjct: 98  NALTDKETRTITTGNTFLAGVGAGITEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAA 157

Query: 54  ---------RFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLK 104
                    ++   +   Y  ++++G    Y G +          +   G        LK
Sbjct: 158 GTAATVTKPKYANAIHAAYTIVKEEGAGALYRGVSLTAA----RQATNQGANFTVYSYLK 213

Query: 105 KYV--YQHEEKLP--LSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLD 160
            Y+  Y + E LP   + CI  G+++G    F  AP++  K +LQ      +      + 
Sbjct: 214 DYLQKYHNRESLPSWETSCI--GLISGAIGPFSNAPLDTIKTRLQKDKSISSNSAWKKIY 271

Query: 161 VI-KKVYAADGIRGMYKGLV 179
           +I  ++   +G R +YKG+ 
Sbjct: 272 IIGTQLIKEEGFRALYKGIT 291

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 58.9 bits (141), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 87/185 (47%), Gaps = 25/185 (13%)

Query: 13  NEAYSRMMGFVSGMFSGIAKNAVG----HPFDTIKVRL----QTSQDTG--RFKGPLDCV 62
            E Y++   F   + SG A  A+     +  D  + RL    ++S+  G  +F G +D  
Sbjct: 120 EEGYAKW--FAGNLASGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVY 177

Query: 63  YQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILS 122
            +T++  G+ G Y GF P +VG ++   +  G   + + LL            L G  L+
Sbjct: 178 KKTLKSDGVAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTG--------SLEGSFLA 229

Query: 123 GVLAGWSVSFIAA----PVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGL 178
             L GW V+  A+    P++  + ++ +    Q  +Y G  D ++K+ AA+G+  ++KG 
Sbjct: 230 SFLLGWVVTTGASTCSYPLDTVRRRMMMT-SGQAVKYDGAFDCLRKIVAAEGVGSLFKGC 288

Query: 179 VSTLI 183
            + ++
Sbjct: 289 GANIL 293

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 56/278 (20%), Positives = 118/278 (42%), Gaps = 31/278 (11%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDT-------GRFKGPLDCVYQTMRQQGIRGF 74
            + G+ + +AK A   P + +K+ +Q   +         ++ G LDC  +T  Q+G+  F
Sbjct: 28  LMGGVSAAVAKTAA-SPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVISF 86

Query: 75  YLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLP--LSGCILSGVLAGWSVSF 132
           + G T  ++ +    ++        + +   + ++ EE      +G + SG  AG     
Sbjct: 87  WRGNTANVIRYFPTQALNFAFKDKIKAM---FGFKKEEGYAKWFAGNLASGGAAGALSLL 143

Query: 133 IAAPVELAKAKLQVQYDAQTTR------YRGPLDVIKKVYAADGIRGMYKGLVSTLI-FR 185
               ++ A+ +L    D+++++      + G +DV KK   +DG+ G+Y+G + +++   
Sbjct: 144 FVYSLDYARTRLAA--DSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIV 201

Query: 186 THFVYWWGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCND- 244
            +   ++G Y+ L       + L  + +                +YP D +++ ++    
Sbjct: 202 VYRGLYFGMYDSLKPLLLTGS-LEGSFLASFLLGWVVTTGASTCSYPLDTVRRRMMMTSG 260

Query: 245 ---KYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLR 279
              KYDG+    R     I    G+   FKG   + LR
Sbjct: 261 QAVKYDGAFDCLRK----IVAAEGVGSLFKGCGANILR 294

>Scas_582.7
          Length = 329

 Score = 58.9 bits (141), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 63/287 (21%), Positives = 112/287 (39%), Gaps = 30/287 (10%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPP 81
            ++G F+GI +++   P D +K R+Q++   G  +     + Q  +   + G        
Sbjct: 40  LLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEG-------S 92

Query: 82  LVGWILMDSVMLGCLHNYRMLLKKYVY---------QHEEKLPLSGCILSGVLAGWSVSF 132
           L  W  + SV+LG    + +    Y +         Q E   P+   + SG  A  +  F
Sbjct: 93  LALWKGVQSVILGAGPAHAVYFATYEFTKAHLIPDSQRETHQPIKVAV-SGATATVASDF 151

Query: 133 IAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFV-YW 191
              P +  K ++Q+    +   Y    +V KK+Y  +G+   Y    +T+     F  + 
Sbjct: 152 FMNPFDTIKQRMQISDLKKEKVY----NVAKKIYNLEGLSAFYYSYPTTIAMNIPFAAFN 207

Query: 192 WGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSLR 251
           +  YE  +++F  N       +                  P D IK VI        SL 
Sbjct: 208 FMIYESASKFF--NPLHHYNPLIHCLCGGISGAIAAAVTTPLDCIKTVIQIRGSSVVSLE 265

Query: 252 ------SWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFE 292
                 +++ A S I    G +GF++G  P  L + PA A +  ++E
Sbjct: 266 VMKKANTFKKATSAILMVYGWKGFWRGLQPRILANMPATAISWTAYE 312

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 75/193 (38%), Gaps = 17/193 (8%)

Query: 115 PLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGP-LDVIKKVYAADGIRG 173
           PLS  +L+G  AG        P++  K ++Q      T +     +  I K+   +G   
Sbjct: 35  PLSHQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLA 94

Query: 174 MYKGLVSTLIFR--THFVYWWGSYELLTRWFKANTN-LSDTAINXXXXXXXXXXXXXXXA 230
           ++KG+ S ++     H VY + +YE        ++   +   I                 
Sbjct: 95  LWKGVQSVILGAGPAHAVY-FATYEFTKAHLIPDSQRETHQPIKVAVSGATATVASDFFM 153

Query: 231 YPSDVIKQVILCNDKYDGSLRSWR--NAASDIWRTRGIRGFFKGFVPSFLRSFPANAAAL 288
            P D IKQ +  +D     L+  +  N A  I+   G+  F+  +  +   + P      
Sbjct: 154 NPFDTIKQRMQISD-----LKKEKVYNVAKKIYNLEGLSAFYYSYPTTIAMNIP-----F 203

Query: 289 ASFEFVLRVSGAK 301
           A+F F++  S +K
Sbjct: 204 AAFNFMIYESASK 216

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 58.9 bits (141), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 77/169 (45%), Gaps = 22/169 (13%)

Query: 25  GMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVG 84
           G  +G+  + V +P D ++ RL  ++ + R     +C  Q    +G+RGF+ G +  +  
Sbjct: 121 GALAGMTSSVVSYPLDLLRTRLIANRTSHRTSVAEEC-RQMWLNEGVRGFFTGISTAMTT 179

Query: 85  WILMDSVMLGCLHNYRMLLKKYVYQHEEKL---PLSGCILSGVLAGWSVSFIAAPVELAK 141
             L  ++M        ++ +     HE++    P+S    SG++AG+    +  P++  +
Sbjct: 180 VTLSTAIMFLTYETVNIVCE----NHEKEFWSRPVSAS--SGIIAGFVSKTMVFPIDTLR 233

Query: 142 AKLQVQYDAQTT------------RYRGPLDVIKKVYAADGIRGMYKGL 178
            ++QV    +T             RY+    +I K+   +G+  +Y+GL
Sbjct: 234 RRMQVMNSKRTVHFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALYRGL 282

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 84/169 (49%), Gaps = 15/169 (8%)

Query: 17  SRMMGFVSGMFSGIAKNAVGHPFDTIKVR--LQTSQDTGRFKGPLDCVYQTMRQQGIRGF 74
           S + G VSG+F+ +A      P DT+K+R  LQ  Q+  ++KG    V   M+++G+R  
Sbjct: 21  SVIAGSVSGVFARMATA----PMDTVKIRYQLQPVQE-DKYKGIASTVRTIMKEEGLRAL 75

Query: 75  YLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIA 134
           + G  P    +++  +V  G    +  +      +  ++      +  G LAG + S ++
Sbjct: 76  WKGNIPATAMYVVYGAVQFGSYSWFNNVWSAKFPRFSQQ---GQTLTVGALAGMTSSVVS 132

Query: 135 APVELAKAKLQVQYDAQTTRYRGPL-DVIKKVYAADGIRGMYKGLVSTL 182
            P++L + +L     A  T +R  + +  ++++  +G+RG + G+ + +
Sbjct: 133 YPLDLLRTRL----IANRTSHRTSVAEECRQMWLNEGVRGFFTGISTAM 177

 Score = 46.6 bits (109), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 35/184 (19%), Positives = 74/184 (40%), Gaps = 4/184 (2%)

Query: 112 EKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGI 171
           E +     +++G ++G       AP++  K + Q+Q   Q  +Y+G    ++ +   +G+
Sbjct: 14  ETVSWYNSVIAGSVSGVFARMATAPMDTVKIRYQLQ-PVQEDKYKGIASTVRTIMKEEGL 72

Query: 172 RGMYKGLV-STLIFRTHFVYWWGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXA 230
           R ++KG + +T ++  +    +GSY      + A                         +
Sbjct: 73  RALWKGNIPATAMYVVYGAVQFGSYSWFNNVWSAKFPRFSQQGQTLTVGALAGMTSSVVS 132

Query: 231 YPSDVIKQVILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALAS 290
           YP D+++  ++ N     +  S       +W   G+RGFF G   +      + A    +
Sbjct: 133 YPLDLLRTRLIANRTSHRT--SVAEECRQMWLNEGVRGFFTGISTAMTTVTLSTAIMFLT 190

Query: 291 FEFV 294
           +E V
Sbjct: 191 YETV 194

 Score = 36.2 bits (82), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 37/89 (41%), Gaps = 17/89 (19%)

Query: 8   NAVVPN---EAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTG----------- 53
           N V  N   E +SR +   SG+ +G     +  P DT++ R+Q                 
Sbjct: 195 NIVCENHEKEFWSRPVSASSGIIAGFVSKTMVFPIDTLRRRMQVMNSKRTVHFTKFPAVY 254

Query: 54  ---RFKGPLDCVYQTMRQQGIRGFYLGFT 79
              R+K     +Y+ +RQ+G+   Y G T
Sbjct: 255 HEYRYKSSTAIIYKILRQEGVSALYRGLT 283

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/298 (21%), Positives = 117/298 (39%), Gaps = 55/298 (18%)

Query: 23  VSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGI-------RGFY 75
           +SG+ +G     + HP D  KVRLQ    +   KG     Y+ +  + +       R  Y
Sbjct: 13  ISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKG-----YRNLWSEIVGSDLSLTRELY 67

Query: 76  LGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLP----------LSGCILSGVL 125
            G T  LVG    +++  G       + K Y+  +  ++           LS    SG+L
Sbjct: 68  RGLTVNLVG----NTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASSGML 123

Query: 126 AGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFR 185
                + +  P+ + K ++  + ++  T  +   D+IK     DG++G++KGLV  L+  
Sbjct: 124 T----TVLTNPLWVIKTRMMSKANSDLTSMKVLRDLIKN----DGVQGLWKGLVPALVGV 175

Query: 186 THFVYWWGSYELLTRWFKANTNLSD--TAINXXXXXXXXXXXXXXXAYPSDVIKQVILCN 243
           +     +  Y+ L          SD  T +                 YP  ++K      
Sbjct: 176 SQGALHFTCYDTLKHKLVLKNRDSDEITNLETIAVTSVSKMLSTSAVYPFQLLK------ 229

Query: 244 DKYDGSLRSWRNAASD---------IWRTRGIRGFFKGFVPSFLRSFPANAAALASFE 292
                +L+S++ + +D         I+   G+ GF+KG   + LRS P+       +E
Sbjct: 230 ----SNLQSFQASENDFKLLPLSKMIYSRSGLLGFYKGLSANLLRSVPSTCITFCIYE 283

 Score = 34.7 bits (78), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 75/172 (43%), Gaps = 13/172 (7%)

Query: 115 PLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAAD--GIR 172
           PL   ++SG+ AG   + I  P++L K +LQ+   + T   +G  ++  ++  +D    R
Sbjct: 7   PLQKEVISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTK--KGYRNLWSEIVGSDLSLTR 64

Query: 173 GMYKGLVSTLIFRT-----HFVYWWGSYELLTRWFKANTNLSD-TAINXXXXXXXXXXXX 226
            +Y+GL   L+  T     +F  +  + + L  +     N  D ++              
Sbjct: 65  ELYRGLTVNLVGNTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASSGMLT 124

Query: 227 XXXAYPSDVIKQVILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFL 278
                P  VIK  ++   K +  L S +    D+ +  G++G +KG VP+ +
Sbjct: 125 TVLTNPLWVIKTRMM--SKANSDLTSMK-VLRDLIKNDGVQGLWKGLVPALV 173

>Scas_667.4
          Length = 308

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/302 (21%), Positives = 131/302 (43%), Gaps = 41/302 (13%)

Query: 1   MSSRSDSNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDT-------G 53
           MSS+ +      N A   +MG VS   + +AK A   P + +K+ +Q   +         
Sbjct: 1   MSSKEEVKKE-SNFAIDFLMGGVS---AAVAKTAA-SPIERVKLLIQNQDEMIKQGSLDS 55

Query: 54  RFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEK 113
           ++KG ++C  +T + +GI  F+ G T  ++ +    ++        + +   + ++ EE 
Sbjct: 56  KYKGIIECFQRTAKTEGIIAFWRGNTANVIRYFPTQALNFAFKDKIKAM---FGFKKEEG 112

Query: 114 LP--LSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTR------YRGPLDVIKKV 165
                +G + SG  AG         ++ A+ +L    DA++++      Y+G +DV K+ 
Sbjct: 113 YGKWFAGNLASGGAAGGLSLLFVYSLDYARTRLAA--DAKSSKKGGSRQYKGLIDVYKQT 170

Query: 166 YAADGIRGMYKG----LVSTLIFRTHFVYWWGSYELLTRWFKANTNLSDTAINXXXXXXX 221
            A DG+ G+Y+G    +V  +++R     ++G Y+ L       + L  + +        
Sbjct: 171 LATDGMAGLYRGFLPSVVGIIVYRG---LYFGLYDSLKPAVLTGS-LEGSFLASFLLGWI 226

Query: 222 XXXXXXXXAYPSDVIKQVILCND----KYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSF 277
                   +YP D +++ ++       KYDG+   +R   +      G+   FKG   + 
Sbjct: 227 VTTGASTASYPLDTVRRRMMMTSGQAVKYDGAFDCFRKVVA----AEGVSSLFKGCGANI 282

Query: 278 LR 279
           LR
Sbjct: 283 LR 284

>Scas_379.2
          Length = 301

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 67/287 (23%), Positives = 119/287 (41%), Gaps = 36/287 (12%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPP 81
            ++G F+GI +++V  P D +K R+Q++      K   + + Q  +     G        
Sbjct: 27  LLAGAFAGIMEHSVMFPIDALKTRIQSTSA----KSTSNMLSQMAKISTAEG-------S 75

Query: 82  LVGWILMDSVMLGCLHNYRMLLKKYVYQH----EEK-----LPLSGCILSGVLAGWSVSF 132
           L  W  + SV+LG    + +    Y Y      +EK      PL    LSG +A  +   
Sbjct: 76  LALWKGVQSVILGAGPAHAVYFATYEYTKKYLIDEKDMQTHQPLKTA-LSGTVATIAADA 134

Query: 133 IAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFV-YW 191
           +  P +  K ++Q+  +  TT +    +V K++Y  +G    Y    +TL     F  + 
Sbjct: 135 LMNPFDTLKQRMQL--NTNTTVW----NVTKQIYKNEGFSAFYYSYPTTLAMNIPFAAFN 188

Query: 192 WGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSLR 251
           +  YE  T++F   TN  +  ++                 P D IK V+        SL+
Sbjct: 189 FMIYESATKFFNP-TNDYNPLVHCLSGGLSGATCAAITT-PLDCIKTVLQVRGSESVSLQ 246

Query: 252 ------SWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFE 292
                 +++ A   I++  G +GF++G  P    + PA A A  ++E
Sbjct: 247 VMKEANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAIAWTAYE 293

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/193 (20%), Positives = 76/193 (39%), Gaps = 17/193 (8%)

Query: 112 EKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGI 171
           +  PLS  +L+G  AG     +  P++  K ++Q      T+     L  + K+  A+G 
Sbjct: 19  DSAPLSHQLLAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTSNM---LSQMAKISTAEGS 75

Query: 172 RGMYKGLVSTLIFR--THFVYWWGSYELLTRWFKANTNL-SDTAINXXXXXXXXXXXXXX 228
             ++KG+ S ++     H VY + +YE   ++     ++ +   +               
Sbjct: 76  LALWKGVQSVILGAGPAHAVY-FATYEYTKKYLIDEKDMQTHQPLKTALSGTVATIAADA 134

Query: 229 XAYPSDVIKQVILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAAL 288
              P D +KQ +  N     +   W N    I++  G   F+  +  +   + P      
Sbjct: 135 LMNPFDTLKQRMQLNT----NTTVW-NVTKQIYKNEGFSAFYYSYPTTLAMNIP-----F 184

Query: 289 ASFEFVLRVSGAK 301
           A+F F++  S  K
Sbjct: 185 AAFNFMIYESATK 197

 Score = 35.0 bits (79), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 33/79 (41%), Gaps = 13/79 (16%)

Query: 12  PNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIK----------VRLQTSQDTGRFKGPLDC 61
           P   Y+ ++  +SG  SG    A+  P D IK          V LQ  ++   F+     
Sbjct: 201 PTNDYNPLVHCLSGGLSGATCAAITTPLDCIKTVLQVRGSESVSLQVMKEANTFQKATKA 260

Query: 62  VYQTMRQQGIRGFYLGFTP 80
           +YQ     G +GF+ G  P
Sbjct: 261 IYQV---HGAKGFWRGLQP 276

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 73/310 (23%), Positives = 127/310 (40%), Gaps = 30/310 (9%)

Query: 5   SDSNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRF-KGPLDCVY 63
           S S  V P+++      F++G  +G  + +V +PF+  K RLQ      +  + PL  +Y
Sbjct: 2   SQSKQVDPSKS------FIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKASRNPLVLIY 55

Query: 64  QTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSG--CIL 121
            T + QGI   Y+G    +VG      V        + LL+       +   LSG   ++
Sbjct: 56  NTAKTQGIGSVYVGCPAFIVGNTAKAGVRFLGFDTIKNLLR-----DPKTGELSGPRGVI 110

Query: 122 SGVLAGWSVSFIA-APVELAKAKLQVQYDAQTTRY----RGPLDVIKKVYAADGIRGMYK 176
           +G+ AG   S +A  P E  K  L     + T +Y    +G L     +    G+ G+Y+
Sbjct: 111 AGLGAGLLESVVAVTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYR 170

Query: 177 GLVSTLIFR-THFVYWWGSYELLTRWFKANTNL-SDTAINXXXXXXXXXXXXXXXAY--- 231
           G++   + +  +     G Y  +    +  TN   D  ++                Y   
Sbjct: 171 GVLPVSMRQAANQAVRLGCYNKIKVMVQDYTNAPKDKPLSSGLTFVVGAFSGIVTVYTTM 230

Query: 232 PSDVIKQVI--LCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALA 289
           P D +K  +  L + +Y  ++    N  + I++  G++ F+KG  P   R F +      
Sbjct: 231 PIDTVKTRMQSLDSKRYSSTI----NCFTTIFKEEGLKAFWKGATPRLGRLFLSGGIVFT 286

Query: 290 SFEFVLRVSG 299
            +E VL V G
Sbjct: 287 VYEKVLTVLG 296

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/287 (20%), Positives = 122/287 (42%), Gaps = 29/287 (10%)

Query: 13  NEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDT-------GRFKGPLDCVYQT 65
           N+  + ++ F+ G  S         P + +K+ +Q   +         R+ G +DC  +T
Sbjct: 4   NKQSNFLINFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDRRYNGIVDCFKRT 63

Query: 66  MRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRML--LKKYVYQHEEKLPLSGCILSG 123
              +G+  F+ G T  ++ +    ++        + +   +K V  + +    +G + SG
Sbjct: 64  AASEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFRKEVDGYAK--WFAGNLASG 121

Query: 124 VLAGWSVSFIAAPVELAKAKLQVQYDAQTTR------YRGPLDVIKKVYAADGIRGMYKG 177
             AG         ++ A+ +L    D+++ +      + G +DV KK  A+DGI G+Y+G
Sbjct: 122 GAAGGLSLLFVYSLDYARTRLAA--DSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRG 179

Query: 178 LVSTLI-FRTHFVYWWGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVI 236
            + +++    +   ++G Y+ L +      NL  + I                +YP D +
Sbjct: 180 FLPSVVGIVVYRGLYFGMYDSL-KPLLLTGNLESSFIASFLLGWAVTTGASTASYPLDTV 238

Query: 237 KQVILCND----KYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLR 279
           ++ ++       KYDG+  ++R     I    G++  FKG   + LR
Sbjct: 239 RRRMMMTSGQAVKYDGAFDAFRK----IVAAEGVKSLFKGCGANILR 281

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/270 (23%), Positives = 109/270 (40%), Gaps = 27/270 (10%)

Query: 25  GMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVG 84
           G F GI      HP D  KVRLQT+         +    Q +R +G+ G Y G T  ++ 
Sbjct: 15  GGFGGIVACVATHPLDLAKVRLQTAPAPKPTL--VRMASQILRNEGVPGLYSGLTAAILR 72

Query: 85  WILMDSVMLGCLH--NYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKA 142
                +   G       R + K+Y+      LP S  + SG + G     I  P ++   
Sbjct: 73  QCTYTTARFGVYDFVKERYIPKEYLNSMLYLLPCS--MFSGAVGG----LIGNPADVVNI 126

Query: 143 KLQ--VQYDAQTTR-YRGPLDVIKKVYAADGIRGMYKG----LVSTLIFRTHFVYWWGSY 195
           ++Q      A+  R Y+   D + K+ + +G+  ++ G    LV  ++  +  V    +Y
Sbjct: 127 RMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTSSQVV---TY 183

Query: 196 ELLTRWFKANTNLS-DTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDK--YDGSLRS 252
           ++   +   N  L  D                     P+DVIK  ++   K  +D ++R 
Sbjct: 184 DIAKNYLVQNVGLDKDNKSTHFASSLLAGLVATTVCSPADVIKTRVMNAHKHSHDSAVRI 243

Query: 253 WRNAASDIWRTRGIRGFFKGFVPSFLRSFP 282
             +A     +  G    F+G++PSF+R  P
Sbjct: 244 LLDAV----KQEGPSFMFRGWLPSFVRLGP 269

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 71/157 (45%), Gaps = 19/157 (12%)

Query: 37  HPFDTIKVRLQTSQDTGR------FKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDS 90
           +  D  + RL     + +      F G +D   +T+   G+ G Y GF P +VG ++   
Sbjct: 133 YSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFLPSVVGIVVYRG 192

Query: 91  VMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAA----PVELAKAKLQV 146
           +  G   + + LL            L    L+  L GW+V+  A+    P++  + ++ +
Sbjct: 193 LYFGLYDSLKPLLLTG--------SLENSFLASFLLGWAVTTGASTASYPLDTVRRRMMM 244

Query: 147 QYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183
               Q  +Y G  D  +K+ AA+GI+ ++KG  + ++
Sbjct: 245 T-SGQAVKYDGAFDAFRKIVAAEGIKSLFKGCGANIL 280

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/287 (21%), Positives = 126/287 (43%), Gaps = 34/287 (11%)

Query: 13  NEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQD-------TGRFKGPLDCVYQT 65
           N A   +MG VS   + ++K A   P + +K+ +Q   +         R+ G ++C  +T
Sbjct: 9   NFAIDFLMGGVS---AAVSKTAAA-PIERVKLLIQNQDEMIKQGSLDRRYTGIVECFKRT 64

Query: 66  MRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLP--LSGCILSG 123
              +G+  F+ G T  ++ +    ++        + +   + ++ EE      +G + SG
Sbjct: 65  AADEGVASFWRGNTANVIRYFPTQALNFAFKDKIKAM---FGFKKEEGYAKWFAGNLASG 121

Query: 124 VLAGWSVSFIAAPVELAKAKLQVQYDAQTTR------YRGPLDVIKKVYAADGIRGMYKG 177
            LAG         ++ A+ +L    D+++ +      + G +DV KK  A+DG+ G+Y+G
Sbjct: 122 GLAGGLSLLFVYSLDYARTRLAA--DSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRG 179

Query: 178 LVSTLI-FRTHFVYWWGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVI 236
            + +++    +   ++G Y+ L       + L ++ +                +YP D +
Sbjct: 180 FLPSVVGIVVYRGLYFGLYDSLKPLLLTGS-LENSFLASFLLGWAVTTGASTASYPLDTV 238

Query: 237 KQVILCND----KYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLR 279
           ++ ++       KYDG+  ++R     I    GI+  FKG   + LR
Sbjct: 239 RRRMMMTSGQAVKYDGAFDAFRK----IVAAEGIKSLFKGCGANILR 281

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/308 (21%), Positives = 119/308 (38%), Gaps = 54/308 (17%)

Query: 38  PFDTIKVRLQ---------------------------TSQDTGRFKGPLDCVYQTMRQQG 70
           PFD +K RLQ                           T Q    FK  +  +    RQ+G
Sbjct: 76  PFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTLQAATHFKETVSIIGNVYRQEG 135

Query: 71  IRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSV 130
            R  + G  P LVG I   S+        + +  K  + + ++ P    +++   AGW+ 
Sbjct: 136 FRSLFKGLGPNLVGVIPARSINFFTYGTTKDIYSK-AFNNGQEAPWIH-LMAAATAGWAT 193

Query: 131 SFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVY 190
           +    P+ + K ++Q+    +T  Y+   D +K +   +GI G+Y+GL ++ +     + 
Sbjct: 194 ATATNPIWMVKTRVQLDKAGKTRTYKNSYDCLKSILRNEGIYGLYRGLSASYLGSVEGIL 253

Query: 191 WWGSYELLTRWFK--------ANTNLSDTAINXXXX-------XXXXXXXXXXXAYPSDV 235
            W  YE L    K        A+   + T  +                       YP +V
Sbjct: 254 QWLLYEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWCQRSGGAGLAKFMASIVTYPHEV 313

Query: 236 I----KQVILCND--KYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALA 289
           +    +Q  L N   KY G ++S+R     I +  G+   + G  P  +R+ P +     
Sbjct: 314 VRTRLRQSPLENGKVKYTGLVQSFR----VIIKEEGLASMYSGLTPHLMRTVPNSIIMFG 369

Query: 290 SFEFVLRV 297
           ++E V+++
Sbjct: 370 TWEVVIKL 377

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 83/188 (44%), Gaps = 33/188 (17%)

Query: 37  HPFDTIKVRLQTSQ--DTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVG-------WIL 87
           +P   +K R+Q  +   T  +K   DC+   +R +GI G Y G +   +G       W+L
Sbjct: 198 NPIWMVKTRVQLDKAGKTRTYKNSYDCLKSILRNEGIYGLYRGLSASYLGSVEGILQWLL 257

Query: 88  MDSVMLGCLHNYRMLLKKYVYQ----HEEKLPLSG------CILSGV--LAGWSVSFIAA 135
            + +        + L+KK   +    H+E    +       C  SG   LA +  S +  
Sbjct: 258 YEQL--------KHLIKKRSIEKFGAHDESTMTTTDKIKQWCQRSGGAGLAKFMASIVTY 309

Query: 136 PVELAKAKL-QVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRT--HFVYWW 192
           P E+ + +L Q   +    +Y G +   + +   +G+  MY GL   L+ RT  + +  +
Sbjct: 310 PHEVVRTRLRQSPLENGKVKYTGLVQSFRVIIKEEGLASMYSGLTPHLM-RTVPNSIIMF 368

Query: 193 GSYELLTR 200
           G++E++ +
Sbjct: 369 GTWEVVIK 376

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 38/74 (51%), Gaps = 6/74 (8%)

Query: 28  SGIAK---NAVGHPFDTIKVRL-QTSQDTGRFK--GPLDCVYQTMRQQGIRGFYLGFTPP 81
           +G+AK   + V +P + ++ RL Q+  + G+ K  G +      ++++G+   Y G TP 
Sbjct: 297 AGLAKFMASIVTYPHEVVRTRLRQSPLENGKVKYTGLVQSFRVIIKEEGLASMYSGLTPH 356

Query: 82  LVGWILMDSVMLGC 95
           L+  +    +M G 
Sbjct: 357 LMRTVPNSIIMFGT 370

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/307 (21%), Positives = 131/307 (42%), Gaps = 45/307 (14%)

Query: 20  MGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRF-KGPLDCVYQTMRQQGIRGFYLG- 77
           + F++G  +G     V  PF+ +K+ LQ    T  + KG  D + Q  +++ I+G + G 
Sbjct: 25  VAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGN 84

Query: 78  -------FTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHE-----EKLPLSGCILSGVL 125
                  F    V +++ +    GC        KK+++  +     E+L     + SG L
Sbjct: 85  GLNCIRVFPYSAVQFVVFE----GC--------KKHIFHVDTKGKGEQLNNWQRLFSGAL 132

Query: 126 AGWSVSFIAAPVELAKAKLQVQYD--AQTTRYR--------GPLDVIKKVYAADG-IRGM 174
            G        P++L + +L VQ    ++ ++ R        G   ++ K YA +G I G+
Sbjct: 133 CGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGL 192

Query: 175 YKGLVSTLIFRTHFVYW-WGSYELLTRWFKANTNLSDT---AINXXXXXXXXXXXXXXXA 230
           Y+G+  T +    +V   +  YE L  +  ++ N + +   ++                 
Sbjct: 193 YRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTIT 252

Query: 231 YPSDVIK---QVI-LCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAA 286
           YP D+++   QV+ +  ++      S  +A   I +T G +G++KG   +  +  P+ A 
Sbjct: 253 YPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAV 312

Query: 287 ALASFEF 293
           +   +E 
Sbjct: 313 SWLVYEL 319

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 80/178 (44%), Gaps = 24/178 (13%)

Query: 22  FVSGMFSGIAKNAVG----HPFDTIKVRL------QTSQDTGRFKGPLDCVYQTMRQQGI 71
           F   +FSG A   +     +  D  + RL        S    +F G LD   +T++  G+
Sbjct: 118 FAGNLFSGGAAGGLSLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGL 177

Query: 72  RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVS 131
            G Y GF P ++G I+   +  G   +++ +L            L G  ++  L GW ++
Sbjct: 178 LGLYRGFVPSVLGIIVYRGLYFGLYDSFKPVLLTG--------ALEGSFVASFLLGWVIT 229

Query: 132 FIAA----PVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFR 185
             A+    P++  + ++ +    QT +Y G LD ++K+   +G   ++KG  +  IFR
Sbjct: 230 MGASTASYPLDTVRRRMMMT-SGQTIKYDGALDCLRKIVQKEGAYSLFKGCGAN-IFR 285

 Score = 56.2 bits (134), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 64/282 (22%), Positives = 113/282 (40%), Gaps = 30/282 (10%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDT-------GRFKGPLDCVYQTMRQQGIRGF 74
            + G+ + IAK     P + +K+ +Q  ++         R+KG LDC  +T   +GI  F
Sbjct: 18  LMGGVSAAIAKTGAA-PIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTATHEGIVSF 76

Query: 75  YLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIA 134
           + G T  ++ +    ++        + LL     +       +G + SG  AG       
Sbjct: 77  WRGNTANVLRYFPTQALNFAFKDKIKSLLSYDRERDGYAKWFAGNLFSGGAAGGLSLLFV 136

Query: 135 APVELAKAKLQVQYDAQTTR------YRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHF 188
             ++ A+ +L    DA+ ++      + G LDV KK    DG+ G+Y+G V +++     
Sbjct: 137 YSLDYARTRLAA--DARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFVPSVL---GI 191

Query: 189 VYWWGSYELLTRWFKA---NTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCND- 244
           + + G Y  L   FK       L  + +                +YP D +++ ++    
Sbjct: 192 IVYRGLYFGLYDSFKPVLLTGALEGSFVASFLLGWVITMGASTASYPLDTVRRRMMMTSG 251

Query: 245 ---KYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPA 283
              KYDG+L   R     I +  G    FKG   +  R   A
Sbjct: 252 QTIKYDGALDCLRK----IVQKEGAYSLFKGCGANIFRGVAA 289

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 65/312 (20%), Positives = 117/312 (37%), Gaps = 50/312 (16%)

Query: 13  NEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFK-----GPLDCVYQTMR 67
           + A + M G  +G+F  +      HP DTIKVR+Q  +     +     G +       +
Sbjct: 9   HPAINLMAGGTAGLFEALC----CHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQ 64

Query: 68  QQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAG 127
           ++G    Y G    ++G I   ++       YR LL   V +    +      ++GV AG
Sbjct: 65  KEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLL---VNKESGIVSTGNTFVAGVGAG 121

Query: 128 WSVS-FIAAPVELAKAKLQVQYDAQTTRYRGPL--DVIKKVYA---ADGIRGMYKGLVST 181
            + +  +  P+E+ K +LQ Q+   +    GP   + I   Y     +G+  +Y+G+  T
Sbjct: 122 ITEAVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLT 181

Query: 182 LIFRT--------------HFVYWWGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXX 227
              +                F+  +   ++L  W  +   L   AI              
Sbjct: 182 AARQATNQGANFTVYSKLKEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNA-------- 233

Query: 228 XXAYPSDVIKQVI-----LCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFP 282
               P D IK  +     +  +K  G ++      + + +  G R  +KG  P  +R  P
Sbjct: 234 ----PLDTIKTRLQKDKSISLEKQSG-MKKIITIGAQLLKEEGFRALYKGITPRVMRVAP 288

Query: 283 ANAAALASFEFV 294
             A     +E+V
Sbjct: 289 GQAVTFTVYEYV 300

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 66/292 (22%), Positives = 114/292 (39%), Gaps = 36/292 (12%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQ---DTGRFKGPLDCVYQTMRQQGIRGFYLGF 78
            ++G F+GIA+++V  P D +K RLQ       TG    P   + Q        G     
Sbjct: 22  LMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISAQEG----- 76

Query: 79  TPPLVGWILMDSVMLGC-------LHNYRMLLKKYVYQH---EEKLPLSGCILSGVLAGW 128
              +V W  + SV+LG           Y M+ K ++        K        SG  A  
Sbjct: 77  --SMVLWKGVQSVLLGAGPAHAVYFATYEMV-KSFLIDEATSTSKYHFFKTAFSGATATI 133

Query: 129 SVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHF 188
           +   +  P ++ K ++Q+  +          D  K++Y+ +G +  Y    +TL     F
Sbjct: 134 AADALMNPFDVIKQRIQLNTNISV------WDTAKRIYSKEGFQAFYSSYPTTLAINIPF 187

Query: 189 V-YWWGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYD 247
             + +G Y+  TR+F   + + +  I+                 P D IK  +       
Sbjct: 188 AAFNFGIYDTATRYFNP-SGVYNPFIHCLCGGISGAACAGLTT-PLDCIKTALQVRGSEK 245

Query: 248 GSLR------SWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEF 293
            S+       +++ A   I++  G RGF+ G  P  L + PA A +  ++EF
Sbjct: 246 VSMEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPATAISWTAYEF 297

 Score = 34.7 bits (78), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 80/190 (42%), Gaps = 19/190 (10%)

Query: 112 EKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRG-PLDVIKK---VYA 167
           +  PL+  +++G  AG +   +  P++  K +LQ  +   TT  +  P  ++++   + A
Sbjct: 14  DHAPLAHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISA 73

Query: 168 ADGIRGMYKGLVSTLIFR--THFVYWWGSYELLTRWF--KANTNLSDTAINXXXXXXXXX 223
            +G   ++KG+ S L+     H VY + +YE++  +   +A +                 
Sbjct: 74  QEGSMVLWKGVQSVLLGAGPAHAVY-FATYEMVKSFLIDEATSTSKYHFFKTAFSGATAT 132

Query: 224 XXXXXXAYPSDVIKQVILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPA 283
                   P DVIKQ I  N     ++  W + A  I+   G + F+  +  +   + P 
Sbjct: 133 IAADALMNPFDVIKQRIQLNT----NISVW-DTAKRIYSKEGFQAFYSSYPTTLAINIP- 186

Query: 284 NAAALASFEF 293
                A+F F
Sbjct: 187 ----FAAFNF 192

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 56.2 bits (134), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 62/298 (20%), Positives = 112/298 (37%), Gaps = 23/298 (7%)

Query: 17  SRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQD-----TGRFKGPLDCVYQTMRQQGI 71
           S+   FV+G  +      V +PFD +K R+Q   +        +  P+       + +GI
Sbjct: 19  SKFGSFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKNEGI 78

Query: 72  RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGC---ILSGVLAGW 128
            G   G     +  I ++   LG     R +L    Y + E   +      + +G  +G 
Sbjct: 79  AGLQKGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHIGINVAAGATSGV 138

Query: 129 SVSFIAAPVELAKAKLQVQYDA----QTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIF 184
             +FI +P+ L K ++Q   +A    Q T Y    + +  ++ ++GI+G+++G V   + 
Sbjct: 139 VGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGIKGLFRG-VDAAML 197

Query: 185 RTHF--VYWWGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILC 242
           RT          Y +   +   +  ++D                     P DV+   +  
Sbjct: 198 RTGIGSAVQLPIYNICKNFLLKHDLMNDGTGLHLLSSTIAGFGVGVAMNPWDVVLTRVY- 256

Query: 243 NDK---YDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRV 297
           N K   Y G +  +        R  G+   +KGF    LR  P     L   E  L++
Sbjct: 257 NQKGNLYSGPIDCFIKTV----RNEGLSALYKGFGAQILRIGPHTVLCLTFMEQTLKL 310

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 75/193 (38%), Gaps = 17/193 (8%)

Query: 112 EKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTR---YRGPLDVIKKVYAA 168
            K+   G  ++G LA      +  P +  K ++Q+Q +        Y  P+     ++  
Sbjct: 16  HKVSKFGSFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKN 75

Query: 169 DGIRGMYKGLVSTLIFRTHFV-YWWGSYE----LLTRWFKANTN---LSDTAINXXXXXX 220
           +GI G+ KGL S  +++        G YE    +L   F  N     +    IN      
Sbjct: 76  EGIAGLQKGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHIGINVAAGAT 135

Query: 221 XXXXXXXXXAYPSDVIKQVI--LCNDKYDGSLRSWR---NAASDIWRTRGIRGFFKGFVP 275
                    + P  ++K  +    N  + G    +    N  + I+R+ GI+G F+G   
Sbjct: 136 SGVVGAFIGS-PLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGIKGLFRGVDA 194

Query: 276 SFLRSFPANAAAL 288
           + LR+   +A  L
Sbjct: 195 AMLRTGIGSAVQL 207

>Kwal_23.3042
          Length = 542

 Score = 57.0 bits (136), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 82/179 (45%), Gaps = 16/179 (8%)

Query: 17  SRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGP---LDCVYQTMRQQGIRG 73
           SR   +++G   G+      +P DT+K R+Q +      KG    +       ++ G+R 
Sbjct: 343 SRFSTYLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKEGGLRI 402

Query: 74  FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQH-------EEKLPLSG--CILSGV 124
           FY G T  ++G     ++ LG    +  L K Y+ +        E+++ +S    +L G 
Sbjct: 403 FYRGITVGIMGIFPYAAMDLG---TFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGA 459

Query: 125 LAGWSVSFIAAPVELAKAKLQVQYD-AQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTL 182
            +G   +    PV L + +LQ Q   A   RY G  DV+ K    +G +G++KGLV  L
Sbjct: 460 FSGTVGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGLVPNL 518

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 65/310 (20%), Positives = 113/310 (36%), Gaps = 35/310 (11%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRL--------------------QTSQDTGRFKGPLDC 61
           F++G  SG+       PFD IKV L                      + D  + K PL  
Sbjct: 228 FIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSPLVK 287

Query: 62  VYQTM-RQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYV-YQHEEKLPLSGC 119
              T+ RQ GIR FY+G     +      ++  G     + L+ +    Q    L     
Sbjct: 288 AATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQLEGVQDTAGLSRFST 347

Query: 120 ILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPL-DVIKKVYAADGIRGMYKGL 178
            L+G L G        P++  K ++Q       ++ R  L    K +Y   G+R  Y+G+
Sbjct: 348 YLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKEGGLRIFYRGI 407

Query: 179 -VSTLIFRTHFVYWWGSYELLTRWFKAN----TNLSDTAINXXXXXXXXX-----XXXXX 228
            V  +    +     G++  L +W+ A     T L +  +                    
Sbjct: 408 TVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAFSGTVGAT 467

Query: 229 XAYPSDVIKQVILCNDKYDGSLR--SWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAA 286
             YP ++++  +     +    R   +R+      +  G +G FKG VP+  +  PA + 
Sbjct: 468 AVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGLVPNLAKVCPAVSI 527

Query: 287 ALASFEFVLR 296
           +   +E + R
Sbjct: 528 SYLCYENLKR 537

 Score = 32.0 bits (71), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 24/43 (55%)

Query: 255 NAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRV 297
            AA+ ++R  GIR F+ G   + ++ FP +A    SFE   R+
Sbjct: 287 KAATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRL 329

>Scas_716.29
          Length = 316

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 67/301 (22%), Positives = 125/301 (41%), Gaps = 36/301 (11%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQD-TGRFKGPLDCVYQTM--RQQGIRGFYLGF 78
            V+G  SG+    V  P DT+K+RLQ     TG+    L  + + M   + G+R F+ G 
Sbjct: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGN 85

Query: 79  TPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILS---GVLAGWSVSFIAA 135
            P  + ++L           Y  L         E   ++G + S   G LAG + SF++ 
Sbjct: 86  VPGTMMYVLYGGAQFSSYSFYNNLFG-------ETSDMNGQLQSLVVGALAGMTSSFVSY 138

Query: 136 PVELAKAKLQVQYD-AQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRT-HFVYWWG 193
           P ++ + +     D A ++   G     K+++  +GI G ++G  +++   T      +G
Sbjct: 139 PTDVLRTRFIANQDVALSSLSHG----CKEIWNMEGIPGFFRGCTASMFTITLSASILFG 194

Query: 194 SYELLTRWFKANTNLSD-TAINXXXXXXXXXXXXXXXAYPSDVIKQVI-----------L 241
           +YE +  +    +  SD T                   YP D I++ I           +
Sbjct: 195 TYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNV 254

Query: 242 CNDKYDGSLRSWRNAA-----SDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLR 296
            N       +S++ A+      +I R  G+   ++G   S  ++ P+   +L ++E V+R
Sbjct: 255 ENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMR 314

Query: 297 V 297
           +
Sbjct: 315 L 315

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 39/185 (21%), Positives = 81/185 (43%), Gaps = 5/185 (2%)

Query: 112 EKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIK-KVYAADG 170
           E + +S  +++G ++G     + AP++  K +LQ++         G L ++K  +    G
Sbjct: 18  EDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGG 77

Query: 171 IRGMYKGLV-STLIFRTHFVYWWGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXX 229
           +R  +KG V  T+++  +    + SY      F   +++ +  +                
Sbjct: 78  LRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDM-NGQLQSLVVGALAGMTSSFV 136

Query: 230 AYPSDVIKQVILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALA 289
           +YP+DV++   + N   D +L S  +   +IW   GI GFF+G   S      + +    
Sbjct: 137 SYPTDVLRTRFIANQ--DVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFG 194

Query: 290 SFEFV 294
           ++E +
Sbjct: 195 TYESI 199

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/132 (21%), Positives = 58/132 (43%), Gaps = 7/132 (5%)

Query: 18  RMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLG 77
           ++   V G  +G+  + V +P D ++ R   +QD         C  +    +GI GF+ G
Sbjct: 119 QLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGC-KEIWNMEGIPGFFRG 177

Query: 78  FTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHE--EKLPLSGCILSGVLAGWSVSFIAA 135
            T  +    L  S++ G   + ++   +Y  + +    L  S   +SGV +      +  
Sbjct: 178 CTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTS----KMVTY 233

Query: 136 PVELAKAKLQVQ 147
           P++  + ++QV+
Sbjct: 234 PLDTIRRRIQVR 245

>Scas_662.12
          Length = 308

 Score = 55.8 bits (133), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 59/309 (19%), Positives = 119/309 (38%), Gaps = 55/309 (17%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQ-----TSQ--------------DTGRFKGPLDCV 62
            +SG+ +G     + HP D IKVRLQ     T+Q              +  +  G    +
Sbjct: 11  IISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKMGSQGPI 70

Query: 63  YQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILS 122
           Y  +++   RG  +      V W L  ++      +Y M    Y++ +   + L+    S
Sbjct: 71  YNLIKE-SYRGLPINLLGNAVAWSLYFTIY-NSTKDY-MFQNNYLHNNNTTIFLT----S 123

Query: 123 GVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTL 182
           G+++G S + +  P+ + K ++          Y+      K +   +G + ++ GL+ +L
Sbjct: 124 GLISGISTTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKSLLTKEGPKAIWMGLLPSL 183

Query: 183 IFRTHFVYWWGSYELLTRWFKANTNLS-----DTAINXXXXXXXXXXXXXXXAYPSDVIK 237
           +  +    ++  Y+ L   F  N N S     +  +                 YP  ++K
Sbjct: 184 LGVSQGAIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLSVMSVYPFQLLK 243

Query: 238 QVILCNDKYDGSLRSWRNAASD--------------IWRTRGIRGFFKGFVPSFLRSFPA 283
                      +L+++R+  ++              I+R  GI+G +KG   + LR+ P+
Sbjct: 244 ----------SNLQTFRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAIPS 293

Query: 284 NAAALASFE 292
                  +E
Sbjct: 294 TCITFCIYE 302

>Scas_489.4
          Length = 297

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 80/168 (47%), Gaps = 17/168 (10%)

Query: 21  GFVSGMFSGIAKNAVG-HPFDTIKVRLQTS--------QDTGRFKGPLDCVYQTMRQQGI 71
           G V+G+ +G+ ++ V   PF+ IK  L           Q+ GR  G L      +R QGI
Sbjct: 109 GVVAGLGAGLLESVVAVTPFEAIKTALIDDKQALKPKYQNNGR--GMLRNYGSLVRDQGI 166

Query: 72  RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCI--LSGVLAGWS 129
            G Y G  P  +      +V LGC +  + +++ Y    +++ PLS  +  + G  +G  
Sbjct: 167 MGLYRGVLPVSMRQAANQAVRLGCYNKIKTMVQDYTNAPKDR-PLSSGLTFIVGAFSGVV 225

Query: 130 VSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKG 177
             +   P++  K ++Q   DA  T+Y   ++   K++  +G++  +KG
Sbjct: 226 TVYTTMPIDTVKTRMQ-SLDA--TKYTSTVNCFAKIFKEEGLKTFWKG 270

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 67/289 (23%), Positives = 114/289 (39%), Gaps = 24/289 (8%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRF-KGPLDCVYQTMRQQGIRGFYLGFTP 80
           F++G  +G  + ++ +PF+  K RLQ    T    + PL  +Y T + QG    Y+G   
Sbjct: 14  FIAGALAGAIEASITYPFEFAKTRLQLIDKTSTASRNPLVLIYNTAKTQGTGAIYVGCPA 73

Query: 81  PLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSG--CILSGVLAGWSVSFIA-APV 137
            +VG      +        + +L+  V        LSG   +++G+ AG   S +A  P 
Sbjct: 74  FIVGNTAKAGIRFLGFDTIKNMLRDPVTGE-----LSGPRGVVAGLGAGLLESVVAVTPF 128

Query: 138 ELAKAKLQVQYDAQTTRY----RGPLDVIKKVYAADGIRGMYKGLVSTLIFR-THFVYWW 192
           E  K  L     A   +Y    RG L     +    GI G+Y+G++   + +  +     
Sbjct: 129 EAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVLPVSMRQAANQAVRL 188

Query: 193 GSYELLTRWFKANTNL-SDTAINXXXXXXXXXXXXXXXAY---PSDVIKQVILCND--KY 246
           G Y  +    +  TN   D  ++                Y   P D +K  +   D  KY
Sbjct: 189 GCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTTMPIDTVKTRMQSLDATKY 248

Query: 247 DGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVL 295
             ++    N  + I++  G++ F+KG  P   R   +       +E VL
Sbjct: 249 TSTV----NCFAKIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYENVL 293

>Scas_721.129
          Length = 323

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 66/305 (21%), Positives = 113/305 (37%), Gaps = 31/305 (10%)

Query: 14  EAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGR-----FKGPLDCVYQTMRQ 68
           +  S+   F++G  +        +P + +K+R+Q   +        ++ P+  +    R 
Sbjct: 17  QKVSKFGSFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRN 76

Query: 69  QGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGC---ILSGVL 125
           +GIRG   G     +  I ++   LG     R  L    Y +EE   +      + +G  
Sbjct: 77  EGIRGLQKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSINVAAGAS 136

Query: 126 AGWSVSFIAAPVELAKAKLQVQYDA----QTTRYRGPLDVIKKVYAADGIRGMYKGLVST 181
           +G   + I +P+ L K ++Q   DA    + T YR   + +  +   +G +G+++G +  
Sbjct: 137 SGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRG-IDA 195

Query: 182 LIFRTHFVYWWGS------YELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDV 235
            I RT      GS      Y     +   N  + D                     P DV
Sbjct: 196 AILRT----GAGSSVQLPIYNTAKNFLLKNDLMKDGPGLHLTASTISGLGVAVVMNPWDV 251

Query: 236 IKQVILCNDK---YDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFE 292
           I   I  N K   Y G +  +        RT GI   +KGF    LR  P     L   E
Sbjct: 252 ILTRIY-NQKGNLYKGPVDCFVKTV----RTEGISALYKGFQAQILRIAPHTIICLTFME 306

Query: 293 FVLRV 297
             +++
Sbjct: 307 QTMKL 311

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 80/183 (43%), Gaps = 18/183 (9%)

Query: 12  PNEAYSRM----MGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGR------FKGPLDC 61
           PNE   ++    +   +G  SGI    +G P   +K R+Q+  D  +      ++   + 
Sbjct: 117 PNEESHKIQKVSINVAAGASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNG 176

Query: 62  VYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYR-MLLKKYVYQHEEKLPLSGCI 120
           +    R +G +G + G    ++      SV L   +  +  LLK  + +    L L+   
Sbjct: 177 LSTIARTEGFKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLKNDLMKDGPGLHLTAST 236

Query: 121 LSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVS 180
           +SG+     V+ +  P ++   ++   Y+ +   Y+GP+D   K    +GI  +YKG  +
Sbjct: 237 ISGL----GVAVVMNPWDVILTRI---YNQKGNLYKGPVDCFVKTVRTEGISALYKGFQA 289

Query: 181 TLI 183
            ++
Sbjct: 290 QIL 292

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 50/105 (47%), Gaps = 2/105 (1%)

Query: 10  VVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQ 69
           + PN+  +    FV G  S  A  AV  P D IK R+Q+      +K  L+C Y+   ++
Sbjct: 315 ISPNKPLNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQSKYAWANYKNSLNCAYRIFVEE 374

Query: 70  GIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKL 114
           GI  F+ G+ P L+   L   V  G       L+K  +  HE++L
Sbjct: 375 GIPKFWKGWAPRLMKVGLSGGVSFGVYQYVENLIK--LMAHEKQL 417

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 26/129 (20%), Positives = 55/129 (42%), Gaps = 10/129 (7%)

Query: 49  SQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVY 108
              T RF   +  +Y T   +G+RGF  G  P +   +   +V      + + L+     
Sbjct: 264 EHPTSRFFSTVKEIYLT---RGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLKQLISP--- 317

Query: 109 QHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAA 168
              + L      + G ++  +V  +  P+++ K ++Q +Y      Y+  L+   +++  
Sbjct: 318 --NKPLNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQSKYAW--ANYKNSLNCAYRIFVE 373

Query: 169 DGIRGMYKG 177
           +GI   +KG
Sbjct: 374 EGIPKFWKG 382

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 35/158 (22%), Positives = 66/158 (41%), Gaps = 12/158 (7%)

Query: 141 KAKLQVQYDAQ-TTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRT--HFVYWWGSYEL 197
           + +L + Y+   T+R+      +K++Y   G+RG  +G   T IFR   +    + +Y  
Sbjct: 255 RERLFLHYEEHPTSRF---FSTVKEIYLTRGLRGFVQGTAPT-IFRQMGNSAVRFTTYTS 310

Query: 198 LTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYD-GSLRSWRNA 256
           L +    N  L++                     P DVIK  +    KY   + ++  N 
Sbjct: 311 LKQLISPNKPLNE--YYAFVLGFISSCAVVAVTQPIDVIKTRM--QSKYAWANYKNSLNC 366

Query: 257 ASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFV 294
           A  I+   GI  F+KG+ P  ++   +   +   +++V
Sbjct: 367 AYRIFVEEGIPKFWKGWAPRLMKVGLSGGVSFGVYQYV 404

>Scas_328.1
          Length = 227

 Score = 54.3 bits (129), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 78/164 (47%), Gaps = 19/164 (11%)

Query: 26  MFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGW 85
           +F  + KN +G    +IK     S    +F G LD   +T+   G+ G Y GF P +VG 
Sbjct: 55  LFLRLCKNEIGSDAKSIK-----SGAPRKFNGILDVYKKTLFTDGVLGLYRGFLPSVVGI 109

Query: 86  ILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAA----PVELAK 141
           ++   +  G   + + +L    +++          L   L GW+V+  A+    P++  +
Sbjct: 110 MVYRGLYFGLYDSLKPVLLTGSFENA--------FLPSFLLGWAVTISASTTSYPLDTVR 161

Query: 142 AKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFR 185
            ++ +    Q  +Y+G +D  +++ + +G+  ++KG  +  IFR
Sbjct: 162 RRMMMT-SGQAVKYKGAIDCFQQIVSQEGVYSLFKGCGAN-IFR 203

 Score = 33.1 bits (74), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 70/169 (41%), Gaps = 26/169 (15%)

Query: 131 SFIAAPVELAKAKLQVQYDAQTTR------YRGPLDVIKKVYAADGIRGMYKG----LVS 180
           SF    + L   K ++  DA++ +      + G LDV KK    DG+ G+Y+G    +V 
Sbjct: 49  SFPIVCLFLRLCKNEIGSDAKSIKSGAPRKFNGILDVYKKTLFTDGVLGLYRGFLPSVVG 108

Query: 181 TLIFRTHFVYWWGSYE--LLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQ 238
            +++R  +   + S +  LLT  F+ N  L    +                +YP D +++
Sbjct: 109 IMVYRGLYFGLYDSLKPVLLTGSFE-NAFLPSFLLG-----WAVTISASTTSYPLDTVRR 162

Query: 239 VILCND----KYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPA 283
            ++       KY G++  ++   S      G+   FKG   +  R   A
Sbjct: 163 RMMMTSGQAVKYKGAIDCFQQIVSQ----EGVYSLFKGCGANIFRGVAA 207

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 69/323 (21%), Positives = 124/323 (38%), Gaps = 50/323 (15%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTS---------------------------QDTGR 54
           FV+G   G+A   V  PFD +K RLQ+                            Q    
Sbjct: 56  FVAGGIGGMAGAVVTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTH 115

Query: 55  FKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKL 114
           FK  L  +    +Q+G R  + G  P LVG I   S+        + +  K  + + ++ 
Sbjct: 116 FKETLGIIGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAK-AFNNGQET 174

Query: 115 PLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTT--RYRGPLDVIKKVYAADGIR 172
           P+   +++   AGW+ +    P+ L K ++Q+    +T+  +Y+   D +K V   +G  
Sbjct: 175 PMIH-LMAAATAGWATATATNPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFT 233

Query: 173 GMYKGLVSTLIFRTHFVYWWGSYELLTRWFKAN-----------TNLSDTAINXXXXXXX 221
           G+YKGL ++ +     +  W  YE + R  K             T  +   +        
Sbjct: 234 GLYKGLSASYLGSVEGILQWLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEWCQRSG 293

Query: 222 XXXXXXXXA----YPSDVIKQVILCNDKYDGSLRSWRNAASD---IWRTRGIRGFFKGFV 274
                   A    YP +V++  +    K +G  R +         I +  G+   + G  
Sbjct: 294 SAGLAKFVASIATYPHEVVRTRLRQTPKENGK-RKYTGLVQSFKVIIKEEGLFSMYSGLT 352

Query: 275 PSFLRSFPANAAALASFEFVLRV 297
           P  +R+ P +     ++E V+R+
Sbjct: 353 PHLMRTVPNSIIMFGTWEIVIRL 375

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/284 (22%), Positives = 115/284 (40%), Gaps = 28/284 (9%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTG-RFKGPLDCVYQTMRQQGIRGFYLGFTP 80
            ++G F+GI +++V  P D +K R+Q++       K  L  +      +G    + G   
Sbjct: 37  LIAGAFAGIMEHSVMFPIDALKTRIQSANAKSLSAKNMLSQISHISTSEGTLALWKGVQS 96

Query: 81  PLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKL--PLSGCILSGVLAGWSVSFIAAPVE 138
            ++G     +V  G    Y    K  +   + +   P    I SG  A  +   +  P +
Sbjct: 97  VILGAGPAHAVYFG---TYEFCKKNLIDSSDTQTHHPFKTAI-SGACATTASDALMNPFD 152

Query: 139 LAKAKLQVQYDA---QTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFV-YWWGS 194
             K ++Q+   A   QTT         K++Y ++G+   Y    +TL+    F  + +  
Sbjct: 153 TIKQRIQLNTSASVWQTT---------KQIYQSEGLAAFYYSYPTTLVMNIPFAAFNFVI 203

Query: 195 YELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSLRSWR 254
           YE  T++    +N  +  I+                 P D IK V+        SL   R
Sbjct: 204 YESSTKFLNP-SNEYNPLIHCLCGSISGSTCAAITT-PLDCIKTVLQIRGSQTVSLEIMR 261

Query: 255 NA------ASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFE 292
            A      AS I++  G +GF++G+ P  + + PA A +  ++E
Sbjct: 262 KADTFSKAASAIYQVYGWKGFWRGWKPRIVANMPATAISWTAYE 305

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 69/321 (21%), Positives = 122/321 (38%), Gaps = 49/321 (15%)

Query: 1   MSSRSDSNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDT--GRFKGP 58
           M+S+  S+    N A + + G  +G+  G+      HP DTIKVR+Q  ++      K P
Sbjct: 1   MASKQKSS----NPAVNLIAGGGAGLMEGLC----CHPLDTIKVRMQIYKNAVGSGVKAP 52

Query: 59  --LDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPL 116
             +    +  R +G   FY G    ++G     ++       YR LL     +   K+  
Sbjct: 53  GFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLAD---KETGKVST 109

Query: 117 SGCILSGVLAGWS-VSFIAAPVELAKAKLQVQY---DAQTTRYRGPLDVIKKVYAADGIR 172
               ++GV AG +    +  P+E+ K +LQ Q+        +Y+  +     +   +G  
Sbjct: 110 GNTFIAGVGAGITEAVVVVNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFS 169

Query: 173 GMYKGLVSTLIFRT--------------HFVYWWGSYELLTRWFKANTNLSDTAINXXXX 218
            +Y+G+  T   +                F+  + + E+L  W  +   L   AI     
Sbjct: 170 ALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSN 229

Query: 219 XXXXXXXXXXXAYPSDVIKQVILCNDKYDGSLRSWRNA---ASDIWRTRGIRGFFKGFVP 275
                        P D IK   L  DK   ++   +        + +  G R  +KG  P
Sbjct: 230 A------------PLDTIK-TRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITP 276

Query: 276 SFLRSFPANAAALASFEFVLR 296
             +R  P  A    ++EF+ +
Sbjct: 277 RVMRVAPGQAVTFTAYEFIRK 297

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/222 (23%), Positives = 96/222 (43%), Gaps = 41/222 (18%)

Query: 8   NAVVP---NEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQ--TSQDTGRFKGPLDCV 62
           + V+P   +E++ R +  +SG  +G+    V +P D ++VRL   T +   + +  + C+
Sbjct: 107 SVVIPTWRHESHWRRL--LSGSLAGLCSVFVTYPLDLVRVRLAYVTERHDAKVRKIMACI 164

Query: 63  YQTMRQQGIR------------GFYLGFTPPLVGWI------------LMDSVMLGCLHN 98
           Y     + +R             FY G+TP ++G I              D      L  
Sbjct: 165 YNERPSEALRKWYIPQWFAHWSNFYRGYTPTVIGMIPYAGVSFFAHDLCQDIFRHPMLEP 224

Query: 99  YRMLLKKYVYQHEEKLPLS--GCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTR-- 154
           Y +L       ++  +PL     +++G LAG +    A P E+ + +LQV      TR  
Sbjct: 225 YSVLSPGGSSAYDRTVPLKTWAQLVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRH 284

Query: 155 YRGPLDVIKKVYAADGIRGMYKGL------VSTLIFRTHFVY 190
           + G  ++ K +Y   G RG + GL      V+ ++  + F+Y
Sbjct: 285 FVGINEIAKIIYTEGGWRGFFVGLSIGYIKVTPMVACSFFIY 326

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 71/182 (39%), Gaps = 12/182 (6%)

Query: 1   MSSRSDSNAVVPNEAYSRMM--GFVSGMFSGIAKNAVGHPFDTIKVRLQTS-----QDTG 53
           MS R   +  V   +   ++  G   G+    AK  V  P D IK+  QTS     Q  G
Sbjct: 1   MSGRQRGSGPVDKSSVDYIVKSGLAGGIAGSCAKTLVA-PLDRIKILFQTSNPQFAQFAG 59

Query: 54  RFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEK 113
              G +      M   G RGF+ G +  L+      ++        R ++    ++HE  
Sbjct: 60  SMGGLVRASKYIMAHDGPRGFFQGHSATLLRIFPYAAIKFIAYEQIRSVVIP-TWRHESH 118

Query: 114 LPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRG 173
                 +LSG LAG    F+  P++L + +L    +    + R  +  I     ++ +R 
Sbjct: 119 WRR---LLSGSLAGLCSVFVTYPLDLVRVRLAYVTERHDAKVRKIMACIYNERPSEALRK 175

Query: 174 MY 175
            Y
Sbjct: 176 WY 177

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 4/70 (5%)

Query: 232 PSDVIKQVILCND----KYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAA 287
           P D IK +   ++    ++ GS+     A+  I    G RGFF+G   + LR FP  A  
Sbjct: 39  PLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPRGFFQGHSATLLRIFPYAAIK 98

Query: 288 LASFEFVLRV 297
             ++E +  V
Sbjct: 99  FIAYEQIRSV 108

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 72/335 (21%), Positives = 115/335 (34%), Gaps = 74/335 (22%)

Query: 19  MMGFVSGMFSGIAKNAVGHPFDTIKVRLQ-----------------------------TS 49
           ++  V+G  +G+ +    HP DTIKVR+Q                               
Sbjct: 12  VVNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGG 71

Query: 50  QDTGRFKGP--LDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYV 107
             T   K P  +        Q+G    Y G    ++G I   ++       YR LL    
Sbjct: 72  DATAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLAD-- 129

Query: 108 YQHEEKLPLSGCILSGVLAGWSVS-FIAAPVELAKAKLQVQY-----DAQTTRYRGPLDV 161
            +    +  S   ++GV AG + +  +  P+E+ K +LQ Q+     D    +Y   +  
Sbjct: 130 -KQTGVVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQA 188

Query: 162 IKKVYAADGIRGMYKGLVSTLIFRT--------------HFVYWWGSYELLTRWFKANTN 207
              +   +GI  +Y+G+  T   +                F+  +   E L  W  +   
Sbjct: 189 GYTIIKEEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPSWETSCIG 248

Query: 208 LSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDK---YDGSLRSWRNAA---SDIW 261
           L   AI                  P D IK   L  DK   + G    W+  A   + + 
Sbjct: 249 LISGAIGPFSNA------------PLDTIK-TRLQKDKSTSFKGE-SGWKRIAHIGTQLL 294

Query: 262 RTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLR 296
           +  G R  +KG  P  +R  P  A     +EFV R
Sbjct: 295 KEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRR 329

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/304 (20%), Positives = 111/304 (36%), Gaps = 29/304 (9%)

Query: 14  EAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGR-----FKGPLDCVYQTMRQ 68
           +  S+   FV+G  +      V +P + IK+R+Q   +        +K P+  +    + 
Sbjct: 18  QKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKN 77

Query: 69  QGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGC---ILSGVL 125
           +GI+G   G     +  I ++   LG     R  L +  +  +E   +      + SG  
Sbjct: 78  EGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAA 137

Query: 126 AGWSVSFIAAPVELAKAKLQVQYD----AQTTRYRGPLDVIKKVYAADGIRGMYKGLVST 181
           +G   + I +P+ L K +LQ   +     + T Y G  + +  ++  +G++G+++G +  
Sbjct: 138 SGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRG-IDA 196

Query: 182 LIFRTHFVYWWGS------YELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDV 235
            I RT      GS      Y         N  + D                     P DV
Sbjct: 197 AILRT----GAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDV 252

Query: 236 IKQVILCN--DKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEF 293
           I   I     D Y G +    +      R  G+   +KGF     R  P     L   E 
Sbjct: 253 ILTRIYNQKGDLYKGPI----DCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQ 308

Query: 294 VLRV 297
            +++
Sbjct: 309 TMKL 312

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 82/181 (45%), Gaps = 15/181 (8%)

Query: 12  PNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQD------TGRFKGPLDCVYQT 65
           P++  S  +   SG  SGI    +G P   +K RLQ+  +         + G  + +   
Sbjct: 122 PHKVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTI 181

Query: 66  MRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYR-MLLKKYVYQHEEKLPLSGCILSGV 124
            + +G++G + G    ++      SV L   +  + +L+K  + +    L L+   +SG+
Sbjct: 182 FKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGL 241

Query: 125 LAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIF 184
                V+ +  P ++   ++   Y+ +   Y+GP+D + K    +G+  +YKG  +  +F
Sbjct: 242 ----GVAVVMNPWDVILTRI---YNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQ-VF 293

Query: 185 R 185
           R
Sbjct: 294 R 294

>Kwal_26.7967
          Length = 297

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 68/294 (23%), Positives = 121/294 (41%), Gaps = 24/294 (8%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQ-TSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTP 80
           F++G  +G  + ++ +PF+  K RLQ   + +   + PL  +Y+T + QG+   Y+G   
Sbjct: 13  FLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTASRNPLTLIYRTAKVQGLGAVYVGCPA 72

Query: 81  PLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSG--CILSGVLAGWSVSFIA-APV 137
            +VG      V        + +L+           LSG   I++G+ AG   S +A  P 
Sbjct: 73  FIVGNTAKAGVRFLGFDAIKNILRDPTTGE-----LSGPRGIVAGLGAGLLESVVAVTPF 127

Query: 138 ELAKAKLQVQYDAQTTRY----RGPLDVIKKVYAADGIRGMYKGLVSTLIFR-THFVYWW 192
           E  K  L     + + +Y    RG L     +    G  G+Y+G++   + +  +     
Sbjct: 128 EAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSMRQAANQAVRL 187

Query: 193 GSYELLTRWFKANTNLS-DTAINXXXXXXXXXXXXXXXAY---PSDVIKQVI--LCNDKY 246
           G Y  +    +  TN + D  ++                Y   P D +K  +  L + KY
Sbjct: 188 GCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKTRMQSLDSSKY 247

Query: 247 DGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRVSGA 300
             ++    N  + ++R  G++ F+KG  P   R   +       +E VL V GA
Sbjct: 248 SSTI----NCFATVFREEGLKTFWKGATPRLGRLILSGGIVFTIYEKVLVVLGA 297

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 13  NEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIR 72
           ++  S  M FV G FSGI       P DT+K R+Q S D+ ++   ++C     R++G++
Sbjct: 206 DKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKTRMQ-SLDSSKYSSTINCFATVFREEGLK 264

Query: 73  GFYLGFTPPLVGWILMDSVM 92
            F+ G TP L   IL   ++
Sbjct: 265 TFWKGATPRLGRLILSGGIV 284

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 74/166 (44%), Gaps = 13/166 (7%)

Query: 21  GFVSGMFSGIAKNAVG-HPFDTIKVRLQTSQDTGRFK------GPLDCVYQTMRQQGIRG 73
           G V+G+ +G+ ++ V   PF+ IK  L   + +   K      G L      +  +G  G
Sbjct: 108 GIVAGLGAGLLESVVAVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSG 167

Query: 74  FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSG--CILSGVLAGWSVS 131
            Y G  P  +      +V LGC +  + +++ Y    ++K PLS     + G  +G    
Sbjct: 168 LYRGVLPVSMRQAANQAVRLGCYNKIKTMIQDYTNSAKDK-PLSSGMTFVVGAFSGIVTV 226

Query: 132 FIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKG 177
           +   P++  K ++Q      +++Y   ++    V+  +G++  +KG
Sbjct: 227 YTTMPIDTVKTRMQ---SLDSSKYSSTINCFATVFREEGLKTFWKG 269

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 53.5 bits (127), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 71/305 (23%), Positives = 122/305 (40%), Gaps = 30/305 (9%)

Query: 6   DSNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRF-KGPLDCVYQ 64
           DS  V P ++      FV+G  +G  + ++ +PF+  K RLQ    + +  + PL  +Y 
Sbjct: 4   DSKKVDPTKS------FVAGALAGAVEASITYPFEFAKTRLQLIDKSSKASRNPLVLIYN 57

Query: 65  TMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSG--CILS 122
           T + QG+   Y+G    +VG     +         R LLK      ++   LSG   +L+
Sbjct: 58  TAKTQGVGAIYVGCPAFIVGNTAKAATRFLGYDTIRNLLK-----DKKTGELSGPRGVLA 112

Query: 123 GVLAGWSVSFIA-APVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAA----DGIRGMYKG 177
           G+ AG   S +A  P E  K  L     +   +Y+     + + Y +    +G RG+Y G
Sbjct: 113 GLGAGLLESVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGG 172

Query: 178 LVSTLIFR-THFVYWWGSYELLTRWFKANTNL-SDTAINXXXXXXXXXXXXXXXAY---P 232
           ++   + +  +     G Y  +    +  T    D  +                 Y   P
Sbjct: 173 VLPVSMRQAANQAVRLGCYNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMP 232

Query: 233 SDVIKQVI--LCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALAS 290
            D +K  +  L   KY  +L    N  + I++  G++ F+KG  P   R   +       
Sbjct: 233 IDTVKTRMQSLTASKYSSTL----NCFTTIYKEEGLKTFWKGATPRLGRLILSGGIVFTI 288

Query: 291 FEFVL 295
           +E VL
Sbjct: 289 YENVL 293

>Kwal_23.3529
          Length = 395

 Score = 53.9 bits (128), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 65/287 (22%), Positives = 116/287 (40%), Gaps = 29/287 (10%)

Query: 33  NAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGI-RGFYLGFTPPLVGWILMDSV 91
           ++V H  DT+K R Q + +  +++  +    +   ++GI RG Y G+T  ++G     ++
Sbjct: 100 DSVMHSLDTVKTRQQGAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAI 159

Query: 92  MLGCLHNYRMLLKKYV--YQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQ-- 147
             G    Y +  +K +  +   E L      LSG L     S +  P E+ K +LQ+Q  
Sbjct: 160 FFGT---YELTKRKLIDDWGVNETLSHLTAGLSGDLVS---SVVYVPSEVLKTRLQLQGC 213

Query: 148 ----YDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHF-VYWWGSYELLTRW- 201
               +      YR   D I  +   +G + ++ G  +TL     F  + +  YE   +W 
Sbjct: 214 YNNPHFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFRQWA 273

Query: 202 --FKANTNLSD-TAINXXXXXXXXXXXXXXXAYPSDVIK---QVILCNDKYDGSLRSWR- 254
              +  T   D + +N                 P DVIK   Q  + +     S R  R 
Sbjct: 274 FTLEGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQMPSTVASDSTRLVRI 333

Query: 255 -----NAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLR 296
                   + ++R+ G  GFF G  P F+ +   ++  L  ++  L+
Sbjct: 334 ENSLIKGLTAVYRSEGTLGFFSGVGPRFIWTSIQSSIMLLLYQVTLK 380

>Scas_717.20
          Length = 356

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 98/231 (42%), Gaps = 51/231 (22%)

Query: 8   NAVVPNEAY-SRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFK--GPLDCVYQ 64
           N ++P++ Y S     +SG  +G+      +P D I+VRL    +  R    G +  +Y+
Sbjct: 120 NTLIPSKEYESHWRRLMSGSLAGLCSVFTTYPLDLIRVRLAYVTEHKRISLLGLVKTIYK 179

Query: 65  -----TMRQQGIR--------GFYLGFTPPLVGWI------------LMDSVMLGCLHNY 99
                T+  +G           FY G+TP ++G I            L D +    L  Y
Sbjct: 180 EPASTTLEAKGYIPNWFAHWCNFYRGYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPY 239

Query: 100 RMLLKKYVYQHE-----EKLPLS--GCILSGVLAGWSVSFIAAPVELAKAKLQVQ----- 147
            +L      Q E     ++LPL     +LSG LAG +    A P E+ + +LQV      
Sbjct: 240 SVLALSESEQEERHFKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVS 299

Query: 148 --YDAQTTRYRGPLDVIKKVYAADGIRGMYKGL------VSTLIFRTHFVY 190
             YD    R++   ++ K +Y   G RG + GL      V+ ++  + FVY
Sbjct: 300 QMYDH---RFQSISEIAKIIYKERGWRGFFVGLSIGYIKVTPMVACSFFVY 347

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 34/65 (52%), Gaps = 4/65 (6%)

Query: 232 PSDVIKQVILCND----KYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAA 287
           P D IK +   ++    KY GSL   + AA  IW   GIRGFF+G   + +R FP  A  
Sbjct: 52  PLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFFQGHSVTLMRIFPYAAVK 111

Query: 288 LASFE 292
             ++E
Sbjct: 112 FVAYE 116

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 67/321 (20%), Positives = 106/321 (33%), Gaps = 57/321 (17%)

Query: 21  GFVSGMFSGIAKNAVGHPFDTIKVRLQTSQD-----TGRFKGPLDCVYQTMRQQGIRGFY 75
           G   G+    AK  +  P D IK+  QTS        G   G  +         GIRGF+
Sbjct: 36  GLAGGISGSCAKTLIA-PLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFF 94

Query: 76  LGFTPPLVGWILMDSVMLGCLHNYR--MLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFI 133
            G +  L+      +V        R  ++  K    H  +L      +SG LAG    F 
Sbjct: 95  QGHSVTLMRIFPYAAVKFVAYEQIRNTLIPSKEYESHWRRL------MSGSLAGLCSVFT 148

Query: 134 AAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRG-------------MYKGLVS 180
             P++L + +L    + +     G +  I K  A+  +                Y+G   
Sbjct: 149 TYPLDLIRVRLAYVTEHKRISLLGLVKTIYKEPASTTLEAKGYIPNWFAHWCNFYRGYTP 208

Query: 181 TL------------------------IFRTHFVYWWGSYELLTRWFKANTNLSDTAINXX 216
           T+                        I   + V      E   R FK +  L        
Sbjct: 209 TVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQEERHFK-HQRLPLRTWAEL 267

Query: 217 XXXXXXXXXXXXXAYPSDVIKQ-----VILCNDKYDGSLRSWRNAASDIWRTRGIRGFFK 271
                        AYP ++I++      +  +  YD   +S    A  I++ RG RGFF 
Sbjct: 268 LSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKERGWRGFFV 327

Query: 272 GFVPSFLRSFPANAAALASFE 292
           G    +++  P  A +   +E
Sbjct: 328 GLSIGYIKVTPMVACSFFVYE 348

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/251 (22%), Positives = 106/251 (42%), Gaps = 22/251 (8%)

Query: 34  AVGHPFDTIKVRLQTSQDT----GRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMD 89
           A+  P  T+  R+Q S+       R K  L+ V +  R++G+ GFY G    + G   M 
Sbjct: 32  ALTMPLVTLATRMQVSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYG---MA 88

Query: 90  SVMLGCLHNYRMLLKKYV-YQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQY 148
           +  L   + Y +  +  +  +   +L  S  ILS  +AG   +  + P+ +   ++ V  
Sbjct: 89  ANSLNYYYFYELAARATMRVRGSRRLNTSEAILSSAVAGSMTAIASNPIWVVNTRMTVAK 148

Query: 149 DAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYWWGSYELLT----RWFKA 204
             Q+T     LD+++K    DG+  ++ GL   L+  ++ +  +  +E L     +W  +
Sbjct: 149 SEQST-LAVLLDIVRK----DGVTALFNGLRPALMLVSNPIIQYTVFEQLKNVVLKWSGS 203

Query: 205 NTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIK-QVILCNDKYDG-SLRSWRNAASDIWR 262
           +  L   A                  YP   +K ++ L   K D  + +S  +   DI +
Sbjct: 204 DVLLPSWAF---LLGAVGKLAATGSTYPYITLKTRMHLAKGKEDADTQQSMWSLMVDIVK 260

Query: 263 TRGIRGFFKGF 273
             GI+G + G 
Sbjct: 261 KEGIQGLYHGI 271

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 69/310 (22%), Positives = 125/310 (40%), Gaps = 30/310 (9%)

Query: 1   MSSRSDSNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRF-KGPL 59
           MSS++  + V P      +  F++G  +G A+  + +PF+  K RLQ      +  + PL
Sbjct: 1   MSSKATKSDVDP------LHSFLAGSLAGAAEACITYPFEFAKTRLQLIDKASKASRNPL 54

Query: 60  DCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGC 119
             +Y+T + QGI   Y+G    ++G      +        + +L+       E   LSG 
Sbjct: 55  VLIYKTAKTQGIGSIYVGCPAFIIGNTAKAGIRFLGFDTIKDMLR-----DSETGELSGT 109

Query: 120 --ILSGVLAGWSVSFIA-APVELAKAKLQVQYDAQTTRY----RGPLDVIKKVYAADGIR 172
             +++G+ AG   S  A  P E  K  L     + T +Y    RG +     +    G  
Sbjct: 110 RGVIAGLGAGLLESVAAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFS 169

Query: 173 GMYKGLVSTLIFR-THFVYWWGSYELLTRWFKANTNL-SDTAINXXXXXXXXXXXXXXXA 230
           G+Y+G++   + +  +     G Y  +    +  T+   D  ++                
Sbjct: 170 GLYRGVLPVSMRQAANQAVRLGCYNKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSGIVTV 229

Query: 231 Y---PSDVIKQVI--LCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANA 285
           Y   P D +K  +  L + KY  ++    N  + I++  G++ F+KG  P   R   +  
Sbjct: 230 YSTMPLDTVKTRMQSLDSTKYSSTM----NCFATIFKEEGLKTFWKGATPRLGRLVLSGG 285

Query: 286 AALASFEFVL 295
                +E VL
Sbjct: 286 IVFTIYEKVL 295

>Kwal_47.18216
          Length = 333

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 71/346 (20%), Positives = 124/346 (35%), Gaps = 76/346 (21%)

Query: 1   MSSRSDSNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQT---SQDTG-RFK 56
           MS+R +S+    + A + + G  +G+F  +      HP DTIKVR+Q    +++ G R +
Sbjct: 1   MSNRKNSS----HPAINLVAGGTAGLFEALC----CHPLDTIKVRMQIYSRAREQGQRAR 52

Query: 57  GPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPL 116
           G +        Q+G    Y G    ++G I   ++       +R LL     +    +  
Sbjct: 53  GFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLAD---RQTGVVST 109

Query: 117 SGCILSGVLAGWSVS-FIAAPVELAKAKLQVQY--------------------------- 148
               ++GV AG + +  +  P+E+ K +LQ Q+                           
Sbjct: 110 GNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTA 169

Query: 149 ---DAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFR-----THFVYW--------- 191
               A T +YR  +     +   +G R +Y+G+  T   +      +F  +         
Sbjct: 170 TENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQE 229

Query: 192 WGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSLR 251
           +   ++L  W  +   L   A+                  P D IK   L  DK      
Sbjct: 230 YHQTDMLPSWETSLIGLISGALGPFSNA------------PLDTIK-TRLQKDKSTSKDS 276

Query: 252 SWRNAAS---DIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFV 294
            W    +    + R  G R  +KG  P  +R  P  A     +E +
Sbjct: 277 GWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELI 322

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 63/300 (21%), Positives = 123/300 (41%), Gaps = 29/300 (9%)

Query: 20  MGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRF-KGPLDCVYQTMRQQGIRGFYLGF 78
           + F++G  +G     V  PF+ +K+ LQ    T  + +G    + Q   ++G +G + G 
Sbjct: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGN 83

Query: 79  TPPLVGWILMDSVMLGCLHNYRMLLKKYVYQH----EEKLPLSGCILSGVLAGWSVSFIA 134
               +      +V       Y    KK  + +    +E+L  +  + SG L G       
Sbjct: 84  GLNCIRIFPYSAVQFVV---YEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVAT 140

Query: 135 APVELAKAKLQVQYDAQTTRYR----------GPLDVIKKVYAADG-IRGMYKGLVSTLI 183
            P++L K +L +Q    ++  R          G   ++ + Y  +G +RG+Y+G+  T +
Sbjct: 141 YPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPTSL 200

Query: 184 FRTHFVYW-WGSYELLTRWFKANTNLSD----TAINXXXXXXXXXXXXXXXAYPSDVIK- 237
               +V   +  YE L R F  N++ +     + +                 YP D+++ 
Sbjct: 201 GVVPYVALNFAVYEQL-REFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRR 259

Query: 238 --QVI-LCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFV 294
             QV+ +  ++      S  +A   I R  G+ G++KG   +  +  P+ A +   +E V
Sbjct: 260 RFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVV 319

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/310 (21%), Positives = 113/310 (36%), Gaps = 47/310 (15%)

Query: 13  NEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTS-QDTGRFKGPLDCVYQTMRQQGI 71
            EA S +   V+G  SG+   +V  P DT+K+R Q       ++ G L       R++G+
Sbjct: 19  GEAVSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGV 78

Query: 72  RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVS 131
           R  + G  P    ++L  S+  G    Y  L            P +  +  G LAG   S
Sbjct: 79  RALWKGNVPASAMYVLYGSLQFG---TYAWL--NTAAASAGLPPQAHSLAVGALAGLVSS 133

Query: 132 FIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKG---LVSTLIFRTHF 188
            +  P++L + +L     A     R    VI   +  +G  G ++G    ++     T  
Sbjct: 134 LLTYPLDLLRTRLVANRSAHFFSLRRQARVI---WDTEGPAGFFRGGAWAIAATTLTTGL 190

Query: 189 VYWWGSYELLT--------RWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVI 240
           ++  G YE  T         W  A  + +   ++                +P D +++ +
Sbjct: 191 IF--GIYETCTIAADTYGLPWLAAAASPTAGLVS------------KAAVFPLDTVRRRL 236

Query: 241 LCNDKYD-----------GSLRSWR--NAASDIWRTRGIRGFFKGFVPSFLRSFPANAAA 287
              D               +LR  R    A  + R  GI   +KG   +  +S P     
Sbjct: 237 QIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVIT 296

Query: 288 LASFEFVLRV 297
           L  ++  LR+
Sbjct: 297 LWVYQRCLRL 306

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 79/180 (43%), Gaps = 18/180 (10%)

Query: 17  SRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGP---LDCVYQTMRQQGIRG 73
           S+   +++G   G+      +P DT+K R+Q +      KG    +    Q  R  G++ 
Sbjct: 314 SKFSTYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTARQMYRDGGLKL 373

Query: 74  FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKL---PLSGCILS-------G 123
           FY G T  ++G     ++ LG        LKK+    + K+   P+    +S       G
Sbjct: 374 FYRGVTVGVMGIFPYAALDLGTFS----ALKKWYIARQAKMTGVPVDQVTISNFIVLPMG 429

Query: 124 VLAGWSVSFIAAPVELAKAKLQVQYD-AQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTL 182
             +G   + +  P+ L + +LQ Q   A    Y G  DV+ K    +G +G++KGLV  L
Sbjct: 430 AFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLVPNL 489

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 60/312 (19%), Positives = 115/312 (36%), Gaps = 37/312 (11%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRL--------------------QTSQDTGRFKGPLDC 61
           F++G  SG+       PFD IKV L                      + D  + K PL  
Sbjct: 199 FIAGGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSPLIK 258

Query: 62  VYQTM-RQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYV-YQHEEKLPLSGC 119
              T+ RQ GIR FY+G    ++      ++  G     + L+       H  +L     
Sbjct: 259 AATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSKFST 318

Query: 120 ILSGVLAGWSVSFIAAPVELAKAKLQVQ-YDAQTTRYRGPLDVIKKVYAADGIRGMYKGL 178
            ++G + G    F   P++  K ++Q    D         +   +++Y   G++  Y+G+
Sbjct: 319 YIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTARQMYRDGGLKLFYRGV 378

Query: 179 -VSTLIFRTHFVYWWGSYELLTRWFKA-NTNLSDTAINXXXXX--------XXXXXXXXX 228
            V  +    +     G++  L +W+ A    ++   ++                      
Sbjct: 379 TVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPMGAFSGTVGAT 438

Query: 229 XAYPSDVIKQVILCNDKYDGSLRSWRNAASDIWRT---RGIRGFFKGFVPSFLRSFPANA 285
             YP ++++  +     Y     ++      +W+T    G +G FKG VP+  +  PA +
Sbjct: 439 VVYPINLLRTRLQAQGTY-AHPHTYTGFRDVLWKTVQREGYQGLFKGLVPNLAKVCPAVS 497

Query: 286 AALASFEFVLRV 297
            +   +E   R+
Sbjct: 498 ISYLCYENFKRL 509

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 3/83 (3%)

Query: 25  GMFSGIAKNAVGHPFDTIKVRLQ---TSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPP 81
           G FSG     V +P + ++ RLQ   T      + G  D +++T++++G +G + G  P 
Sbjct: 429 GAFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLVPN 488

Query: 82  LVGWILMDSVMLGCLHNYRMLLK 104
           L       S+   C  N++ L+K
Sbjct: 489 LAKVCPAVSISYLCYENFKRLMK 511

>Scas_715.45
          Length = 305

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 75/190 (39%), Gaps = 19/190 (10%)

Query: 117 SGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYK 176
           + C L G++A         P++L K +LQV      T YR     I ++   +G+  ++ 
Sbjct: 17  AACTLGGIVACGPTHSSVTPLDLIKCRLQVD----PTLYRSNTSGIIQILKKEGLGKLFT 72

Query: 177 GLVSTLI-FRTHFVYWWGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDV 235
           G+ +T I +       +G YEL  R +  +  + D A                  + +D+
Sbjct: 73  GVGATCIGYSLQGAGKYGGYELFKRLYSTHL-VKDEATAYKYRTSIYLLSSATAEFFADI 131

Query: 236 IKQVILC-----NDKYDGSLRSWRNAASDIWRT----RGIRGFFKGFVPSFLRSFPANAA 286
           +    LC       K   ++  W N   + W+      G+ GF+KG  P + R  P    
Sbjct: 132 M----LCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMC 187

Query: 287 ALASFEFVLR 296
              SFE ++ 
Sbjct: 188 KFTSFERIVE 197

 Score = 30.0 bits (66), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 36/167 (21%), Positives = 72/167 (43%), Gaps = 16/167 (9%)

Query: 38  PFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLH 97
           PF+ IKV+ QT+         ++   +   ++G+ GFY G TP     I           
Sbjct: 135 PFEAIKVKQQTTMPP-WCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFE 193

Query: 98  NY------RMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQ 151
                   R+  KK      +++ +S   + G +AG   + ++ P ++  +K+  +    
Sbjct: 194 RIVEAIYARLPTKKSEMSALQQISVS--FVGGYMAGILCAIVSHPADVMVSKINNERKVN 251

Query: 152 TTRYRGPLDV-IKKVYAADGIRGMYKGL-VSTLIFRTHFVYWWGSYE 196
            +     ++V +K++Y+  G  G++ GL V  L+  T   + W  Y+
Sbjct: 252 ES-----MNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYD 293

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/185 (20%), Positives = 82/185 (44%), Gaps = 13/185 (7%)

Query: 14  EAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQ-----TSQDTGRFKGPLDCVYQTMRQ 68
           +  S++  F++G  +      V +PF+ +K R+Q     ++ +   ++ P   +    + 
Sbjct: 19  QKVSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGVIFKN 78

Query: 69  QGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGC---ILSGVL 125
           +G++G   G     V  I ++   LG     R +L K  +   +   L      + +G  
Sbjct: 79  EGVKGLQRGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQNVAVNVTAGAT 138

Query: 126 AGWSVSFIAAPVELAKAKLQVQYDA----QTTRYRGPLDVIKKVYAADGIRGMYKGLVST 181
           +G   + + +P+ L K ++Q   +A    + T Y    + +  ++  +G+ G+++G V  
Sbjct: 139 SGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRG-VDA 197

Query: 182 LIFRT 186
            I RT
Sbjct: 198 AILRT 202

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/211 (20%), Positives = 89/211 (42%), Gaps = 23/211 (10%)

Query: 97  HNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTR-- 154
            N  +  K++     +K+   G  ++G LA      +  P EL K ++Q+Q +   T   
Sbjct: 4   ENKPVATKEHEKSAAQKVSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQR 63

Query: 155 -YRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFV-YWWGSYE----LLTRWFKANTN- 207
            YR P   +  ++  +G++G+ +GLVS  +++        G YE    +L + F   ++ 
Sbjct: 64  IYRNPFQALGVIFKNEGVKGLQRGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDP 123

Query: 208 --LSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSLR--------SWRNAA 257
             L + A+N               + P  ++K  +     Y  +++        S  N  
Sbjct: 124 HKLQNVAVNVTAGATSGIIGAIVGS-PLFLVKTRM---QSYSNAIKIGEQTHYTSMSNGL 179

Query: 258 SDIWRTRGIRGFFKGFVPSFLRSFPANAAAL 288
           + I++  G+ G F+G   + LR+   ++  L
Sbjct: 180 ATIFKKEGVLGLFRGVDAAILRTGAGSSVQL 210

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 79/181 (43%), Gaps = 15/181 (8%)

Query: 12  PNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGR------FKGPLDCVYQT 65
           P++  +  +   +G  SGI    VG P   +K R+Q+  +  +      +    + +   
Sbjct: 123 PHKLQNVAVNVTAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATI 182

Query: 66  MRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYR-MLLKKYVYQHEEKLPLSGCILSGV 124
            +++G+ G + G    ++      SV L   +  +  LL+  + +    L L    LS  
Sbjct: 183 FKKEGVLGLFRGVDAAILRTGAGSSVQLPIYNTTKNFLLQNDIMKEGTALHL----LSST 238

Query: 125 LAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIF 184
           + G  V  +  P ++   ++   Y+ +   Y+GP+D + K    +GI  +YKG  + L F
Sbjct: 239 VTGLGVGIVMNPWDVVLTRV---YNQKGNTYKGPIDCMFKTIKIEGIGALYKGFGAQL-F 294

Query: 185 R 185
           R
Sbjct: 295 R 295

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 58/293 (19%), Positives = 119/293 (40%), Gaps = 19/293 (6%)

Query: 20  MGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPL-DCVYQTMRQQGIRGFYLGF 78
           + FV+G   G     V  P + +K+ LQ    T  + G L   V Q  +++G++G + G 
Sbjct: 18  IAFVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGN 77

Query: 79  TPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVE 138
               +      +V        +  +        E+L     ++ G L G +   +  P++
Sbjct: 78  GINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERLVGGALGGGASVLVTYPLD 137

Query: 139 LAKAKLQVQYDAQTTRYR----------GPLDVIKKVYAADG-IRGMYKGLVSTLIFRTH 187
           L + +L +Q       +R          G ++++++++  +G +RG Y+G+  T +    
Sbjct: 138 LVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVP 197

Query: 188 FVYW-WGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQ--VILCND 244
           FV   +  YE L      + +    A                  YP D++++   +L   
Sbjct: 198 FVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMG 257

Query: 245 KYDGSLRSWRNAASDIW---RTRGIRGFFKGFVPSFLRSFPANAAALASFEFV 294
           + +   R + + A  +W   R  G+RG++KG   + ++  PA A     +E +
Sbjct: 258 QSELGFR-YASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 79/183 (43%), Gaps = 20/183 (10%)

Query: 35  VGHPFDTIKVRL--QTS----------QDTGRFKGPLDCVYQTMRQQG-IRGFYLGFTPP 81
           V +P D ++ RL  QT+           D  R  G ++ + +  R++G +RG+Y G  P 
Sbjct: 132 VTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPT 191

Query: 82  LVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAK 141
            +G +   ++        + L+    + ++     +  +  G ++G     +  P +L +
Sbjct: 192 SLGVVPFVALNFALYERLKALIP---HDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLR 248

Query: 142 AKLQVQYDAQTT---RYRGPLDVIKKVYAADGIRGMYKGLVSTLI-FRTHFVYWWGSYEL 197
            + QV    Q+    RY    D +  +   +G+RG YKGL + L+         W  YEL
Sbjct: 249 RRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308

Query: 198 LTR 200
           ++ 
Sbjct: 309 ISE 311

>Kwal_47.19228
          Length = 281

 Score = 50.4 bits (119), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 44/102 (43%)

Query: 10  VVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQ 69
           + PN+  +    F  G  S  A  AV  P D IK R+Q+      +K  L+C Y+   ++
Sbjct: 176 ISPNKPLNEYYAFALGFISSCAVVAVTQPIDVIKTRMQSKYTWSNYKNSLNCAYRIFVEE 235

Query: 70  GIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHE 111
           G   F+ G+ P L+   L   V  G       L+K    Q E
Sbjct: 236 GFTKFWKGWAPRLMKVGLSGGVSFGVYQYVDNLMKAVNGQQE 277

 Score = 35.4 bits (80), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 24/41 (58%)

Query: 251 RSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASF 291
           R +     +I+R+RGIRGF +G +P+ +R    +A    ++
Sbjct: 129 RQFLTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTY 169

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/127 (19%), Positives = 54/127 (42%), Gaps = 11/127 (8%)

Query: 59  LDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSG 118
           L  V +  R +GIRGF  G  P ++      +V      + + ++           PL+ 
Sbjct: 132 LTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMI-------SPNKPLNE 184

Query: 119 --CILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYK 176
                 G ++  +V  +  P+++ K ++Q +Y    + Y+  L+   +++  +G    +K
Sbjct: 185 YYAFALGFISSCAVVAVTQPIDVIKTRMQSKYTW--SNYKNSLNCAYRIFVEEGFTKFWK 242

Query: 177 GLVSTLI 183
           G    L+
Sbjct: 243 GWAPRLM 249

 Score = 32.7 bits (73), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 34/156 (21%), Positives = 66/156 (42%), Gaps = 8/156 (5%)

Query: 141 KAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRT-HFVYWWGSYELLT 199
           + K  + YD   +R    L  ++++Y + GIRG  +G + T+I +T +    + +Y  L 
Sbjct: 116 RQKWALYYDEHPSRQF--LTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLK 173

Query: 200 RWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYD-GSLRSWRNAAS 258
           +    N  L++                     P DVIK  +    KY   + ++  N A 
Sbjct: 174 QMISPNKPLNE--YYAFALGFISSCAVVAVTQPIDVIKTRM--QSKYTWSNYKNSLNCAY 229

Query: 259 DIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFV 294
            I+   G   F+KG+ P  ++   +   +   +++V
Sbjct: 230 RIFVEEGFTKFWKGWAPRLMKVGLSGGVSFGVYQYV 265

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 64/289 (22%), Positives = 116/289 (40%), Gaps = 20/289 (6%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRF-KGPLDCVYQTMRQQGIRGFYLGFTP 80
           F++G  +G  + ++ +PF+  K RLQ      +  + PL  +Y T +  GI   Y+G   
Sbjct: 94  FLAGSIAGAIEASITYPFEFAKTRLQLVDKASKASRNPLVLIYNTGKNYGISSIYVGCPA 153

Query: 81  PLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSG--CILSGVLAGWSVSFIA-APV 137
            +VG      +        + LL+      ++   LSG   +++G+ AG   S +A  P 
Sbjct: 154 FIVGNTAKAGIRFLGFDTIKNLLR-----DKKTGELSGFRGVVAGLGAGLLESVVAVTPF 208

Query: 138 ELAKAKLQVQYDAQTTRY----RGPLDVIKKVYAADGIRGMYKGLVSTLIFR-THFVYWW 192
           E  K  L     A   +Y    +G +    K+ +  G  G+Y+G++   + +  +     
Sbjct: 209 EAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQAANQAVRL 268

Query: 193 GSYELLTRWFKANTNL-SDTAINXXXXXXXXXXXXXXXAY---PSDVIKQVILCNDKYDG 248
           G Y  +    +  TN+  D  ++                Y   P D +K  +   +   G
Sbjct: 269 GCYNKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTTMPIDTVKTRMQSLNA--G 326

Query: 249 SLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRV 297
              S  N  + I++  G++ F+KG  P   R   +       +E VL V
Sbjct: 327 QYSSTINCFATIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYEKVLTV 375

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 75/168 (44%), Gaps = 17/168 (10%)

Query: 21  GFVSGMFSGIAKNAVG-HPFDTIKVRLQTS--------QDTGRFKGPLDCVYQTMRQQGI 71
           G V+G+ +G+ ++ V   PF+ IK  L           Q+ G  KG +    + +  QG 
Sbjct: 189 GVVAGLGAGLLESVVAVTPFEAIKTALIDDKQAAVPKYQNNG--KGMVSNYAKLLSDQGF 246

Query: 72  RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCI--LSGVLAGWS 129
            G Y G  P  +      +V LGC +  + L++ Y    ++K PLS  +  + G  +G  
Sbjct: 247 SGLYRGVLPVSMRQAANQAVRLGCYNKIKTLVQDYTNVPKDK-PLSSGLTFIVGAFSGIV 305

Query: 130 VSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKG 177
             +   P++  K ++Q     Q   Y   ++    ++  +G++  +KG
Sbjct: 306 TVYTTMPIDTVKTRMQSLNAGQ---YSSTINCFATIFKEEGLKTFWKG 350

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 45/88 (51%), Gaps = 1/88 (1%)

Query: 6   DSNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQT 65
           D   V  ++  S  + F+ G FSGI       P DT+K R+Q S + G++   ++C    
Sbjct: 280 DYTNVPKDKPLSSGLTFIVGAFSGIVTVYTTMPIDTVKTRMQ-SLNAGQYSSTINCFATI 338

Query: 66  MRQQGIRGFYLGFTPPLVGWILMDSVML 93
            +++G++ F+ G TP L   IL   ++ 
Sbjct: 339 FKEEGLKTFWKGATPRLGRLILSGGIVF 366

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 50/108 (46%), Gaps = 12/108 (11%)

Query: 10  VVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQ 69
           + PN+  S    F  G+FS  A  A+  P D +K R+Q+      ++  L+CVY+T  ++
Sbjct: 238 ISPNKPLSEYYAFGIGVFSSCAVVALTQPIDVVKTRMQSKYTWSLYRNSLNCVYRTFIEE 297

Query: 70  GIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLS 117
           G+   + G+ P L    L   V  G            VYQ+ + L LS
Sbjct: 298 GLTSLWKGWVPRLFKVGLSGGVSFG------------VYQYVDNLMLS 333

 Score = 32.7 bits (73), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 123 GVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTL 182
           GV +  +V  +  P+++ K ++Q +Y    + YR  L+ + + +  +G+  ++KG V  L
Sbjct: 253 GVFSSCAVVALTQPIDVVKTRMQSKYTW--SLYRNSLNCVYRTFIEEGLTSLWKGWVPRL 310

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 82/180 (45%), Gaps = 24/180 (13%)

Query: 12  PNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQ-QG 70
           P  +   + GFV G+ S I    V  PFD +K RLQ ++DT         ++ T+++ + 
Sbjct: 5   PKTSSHLIGGFVGGLTSAI----VLQPFDLLKTRLQQNKDT--------TLWGTLKEIRS 52

Query: 71  IRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEE-------KLPLSGCILSG 123
            +  + G  P  +   +  ++ L  L+ +R  + K   Q          +L +   + SG
Sbjct: 53  PKQLWRGALPSSLRTSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLASG 112

Query: 124 VLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183
                 V FI  P+ + K    V+Y++    Y+   +  + +Y+ +GIRG + G  +T++
Sbjct: 113 AFTRGVVGFITMPITIIK----VRYESTMYSYKSLGEATRHIYSTEGIRGFFNGCGATVM 168

 Score = 31.2 bits (69), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 3/47 (6%)

Query: 239 VILCNDKYDGSLRSWRN---AASDIWRTRGIRGFFKGFVPSFLRSFP 282
           + +   +Y+ ++ S+++   A   I+ T GIRGFF G   + +R  P
Sbjct: 126 ITIIKVRYESTMYSYKSLGEATRHIYSTEGIRGFFNGCGATVMRDAP 172

 Score = 28.9 bits (63), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 28/63 (44%), Gaps = 2/63 (3%)

Query: 17  SRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYL 76
           S ++  +S   S      +  PFDTIK R+Q   D  +F G    +   + ++  +  + 
Sbjct: 210 STVVNSISAFMSASLATTITSPFDTIKTRMQL--DPTKFSGFYKTLVLIVSKEKFKNLFD 267

Query: 77  GFT 79
           G T
Sbjct: 268 GLT 270

>Kwal_33.14050
          Length = 314

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 63/294 (21%), Positives = 113/294 (38%), Gaps = 39/294 (13%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDT-----GRFKGPLDCVYQTMRQQGIRGFYL 76
             +G F+GI ++++  P D IK R+Q    T        K P + V Q  R     G   
Sbjct: 20  LAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEG--- 76

Query: 77  GFTPPLVGWILMDSVMLGC-------LHNYRM----LLKKYVYQHEEKLPLSGCILSGVL 125
                +  W  + SV+LG           Y M    L+    +Q  + L  +    SG+ 
Sbjct: 77  ----SMALWKGVQSVILGAGPAHAVYFATYEMCKSYLIDPQDFQTHQPLKTAA---SGIA 129

Query: 126 AGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFR 185
           A  +   +  P +  K ++Q++  ++   +     V  ++Y  +G+   +    +T+   
Sbjct: 130 ATVAADLLMNPFDTIKQRMQLRTFSKDRMW----SVASRIYRNEGLAAFFYSYPTTIAMN 185

Query: 186 THFV-YWWGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCN- 243
             F  + +  YE  T++F    N  +  I+                 P D IK V+    
Sbjct: 186 IPFAAFNFAIYESATKFFNPE-NTYNPLIHCLCGGISGATCAAITT-PLDCIKTVLQVRG 243

Query: 244 -----DKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFE 292
                D       ++  AAS I +  G  GF++G  P  + + PA A +  ++E
Sbjct: 244 SESVVDPLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNMPATAISWTAYE 297

 Score = 32.0 bits (71), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 40/196 (20%), Positives = 74/196 (37%), Gaps = 18/196 (9%)

Query: 115 PLSGCILSGVLAGWSVSFIAAPVELAKAKLQV------QYDAQTTRYRGPLDVIKKVYAA 168
           PL+  + +G  AG     I  P++  K ++Q         +A        +  I ++   
Sbjct: 15  PLTHQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTT 74

Query: 169 DGIRGMYKGLVSTLIFR--THFVYWWGSYELLTRWFKANTNL-SDTAINXXXXXXXXXXX 225
           +G   ++KG+ S ++     H VY + +YE+   +     +  +   +            
Sbjct: 75  EGSMALWKGVQSVILGAGPAHAVY-FATYEMCKSYLIDPQDFQTHQPLKTAASGIAATVA 133

Query: 226 XXXXAYPSDVIKQVILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANA 285
                 P D IKQ +    +     R W + AS I+R  G+  FF  +  +   + P   
Sbjct: 134 ADLLMNPFDTIKQRM--QLRTFSKDRMW-SVASRIYRNEGLAAFFYSYPTTIAMNIP--- 187

Query: 286 AALASFEFVLRVSGAK 301
              A+F F +  S  K
Sbjct: 188 --FAAFNFAIYESATK 201

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 78/346 (22%), Positives = 127/346 (36%), Gaps = 66/346 (19%)

Query: 1   MSSRSDSNAVVPNEA-YSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQ-DTGRFKGP 58
           M+  ++  AV  N   Y    G   G+    AK  +  P D IK+  QTS     ++ G 
Sbjct: 1   MTKTNNRQAVDKNSLDYVVRSGLAGGVSGSCAKTLIA-PLDRIKILFQTSNPHYSKYAGS 59

Query: 59  LDCVYQTMRQ----QGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLL--KKYVYQHEE 112
           L  +Y+  +      GIRGF+ G +  L+      +V        R +L   +    H  
Sbjct: 60  LVGLYEAAKHIWINDGIRGFFQGHSVTLLRIFPYAAVKFVAYEQIRSILIPSREYESHWR 119

Query: 113 KLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIR 172
           +L       SG LAG    FI  P++L + +L    + +  + R   D++K +Y      
Sbjct: 120 RLA------SGSLAGLCSVFITYPLDLTRVRLAYVTEHKRVKLR---DIVKTIYHEPASE 170

Query: 173 GM----------------YKGLVSTLI---------FRTH---------------FVYWW 192
           G+                Y+G V T++         F  H                V   
Sbjct: 171 GLTSHLLVPKWFAHWCNFYRGYVPTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQL 230

Query: 193 GSYELLTRW-FKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCN-----DKY 246
            S E L R   +  T L   A                 AYP ++I++ +  +       Y
Sbjct: 231 SSQEELERKKLRQKTPLRTWA--ELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMY 288

Query: 247 DGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFE 292
           D   +S  + A  I++ +G RGFF G    +++  P  A +   +E
Sbjct: 289 DHKFQSISSIARIIYQEKGWRGFFVGLSIGYIKVTPMVACSFFVYE 334

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/281 (19%), Positives = 113/281 (40%), Gaps = 22/281 (7%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQ-DTGRFKGPLDCVYQTMRQQGIRGFYLGFTP 80
            ++G F+GI ++++  P D +K R+Q +  +     G +  + +    +G    + G   
Sbjct: 27  LLAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAASTGMISQISKISTMEGSMALWKGVQS 86

Query: 81  PLVGWILMDSVMLGCLH--NYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVE 138
            ++G     +V  G       R++  + +  H+   P+    LSG +A  +   +  P +
Sbjct: 87  VILGAGPAHAVYFGTYEFCKARLISPEDMQTHQ---PMKTA-LSGTIATIAADALMNPFD 142

Query: 139 LAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFV-YWWGSYEL 197
             K +LQ+  + +        +V K++Y  +G    Y    +TL     F  + +  YE 
Sbjct: 143 TVKQRLQLDTNLRV------WNVTKQIYQNEGFAAFYYSYPTTLAMNIPFAAFNFMIYES 196

Query: 198 LTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSLRSWRNAA 257
            +++F  N   S   +                  P D IK V+        S+   ++A 
Sbjct: 197 ASKFF--NPQNSYNPLIHCLCGGISGATCAALTTPLDCIKTVLQVRGSETVSIEIMKDAN 254

Query: 258 S------DIWRTRGIRGFFKGFVPSFLRSFPANAAALASFE 292
           +       I    G +GF++G  P  + + PA A +  ++E
Sbjct: 255 TFGRASRAILEVHGWKGFWRGLKPRIVANIPATAISWTAYE 295

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 74/190 (38%), Gaps = 15/190 (7%)

Query: 115 PLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGM 174
           PL   +L+G  AG     +  P++  K ++Q           G +  I K+   +G   +
Sbjct: 22  PLHSQLLAGAFAGIMEHSLMFPIDALKTRVQAA-GLNKAASTGMISQISKISTMEGSMAL 80

Query: 175 YKGLVSTLIFR--THFVYWWGSYELL-TRWFKANTNLSDTAINXXXXXXXXXXXXXXXAY 231
           +KG+ S ++     H VY +G+YE    R        +   +                  
Sbjct: 81  WKGVQSVILGAGPAHAVY-FGTYEFCKARLISPEDMQTHQPMKTALSGTIATIAADALMN 139

Query: 232 PSDVIKQVILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASF 291
           P D +KQ +    + D +LR W N    I++  G   F+  +  +   + P      A+F
Sbjct: 140 PFDTVKQRL----QLDTNLRVW-NVTKQIYQNEGFAAFYYSYPTTLAMNIP-----FAAF 189

Query: 292 EFVLRVSGAK 301
            F++  S +K
Sbjct: 190 NFMIYESASK 199

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 57/134 (42%), Gaps = 9/134 (6%)

Query: 14  EAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRG 73
           + +  M   +SG  + IA +A+ +PFDT+K RLQ   +   +    +   Q  + +G   
Sbjct: 116 QTHQPMKTALSGTIATIAADALMNPFDTVKQRLQLDTNLRVW----NVTKQIYQNEGFAA 171

Query: 74  FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFI 133
           FY  +   L   I   +       +      K+        PL  C+  G+ +G + + +
Sbjct: 172 FYYSYPTTLAMNIPFAAFNFMIYES----ASKFFNPQNSYNPLIHCLCGGI-SGATCAAL 226

Query: 134 AAPVELAKAKLQVQ 147
             P++  K  LQV+
Sbjct: 227 TTPLDCIKTVLQVR 240

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 74/183 (40%), Gaps = 16/183 (8%)

Query: 119 CILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGL 178
           C L G++A         P++L K +LQV     T+  +G     +K+ A +G + +Y G 
Sbjct: 21  CTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQG----FRKIIANEGWKKVYTGF 76

Query: 179 VSTLI-FRTHFVYWWGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIK 237
            +T + +       +G YE     + +  +   T                   + +  +K
Sbjct: 77  GATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVK 136

Query: 238 QVI----LCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEF 293
           Q       CN+  DG    W+   ++   + G++ F+KG VP + R  P       SFE 
Sbjct: 137 QQTTMPPFCNNVVDG----WKKMYAE---SGGMKAFYKGIVPLWCRQIPYTMCKFTSFEK 189

Query: 294 VLR 296
           +++
Sbjct: 190 IVQ 192

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 48/107 (44%), Gaps = 2/107 (1%)

Query: 8   NAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMR 67
            ++ P++A      F +G  S  A  A+  P D IK R+Q+      +K  L+C Y+   
Sbjct: 238 QSLSPHKALDEYQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWFTYKSSLNCAYRIFV 297

Query: 68  QQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKL 114
           ++G R  + G+ P L    L   +  G       L+   +++HE  L
Sbjct: 298 EEGFRYMWKGWVPRLFKVSLSGGISFGVYQYVENLV--LLWEHERSL 342

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 62/136 (45%), Gaps = 16/136 (11%)

Query: 50  QDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQ 109
           Q +  F G +  +Y+T   +G+RGF  G  P +    L +SV+       R     ++ Q
Sbjct: 190 QPSSHFAGTVLEIYRT---RGVRGFLQGAMPTIFRQ-LGNSVV-------RFTTYAWIVQ 238

Query: 110 H---EEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVY 166
                + L       +G L+  +V  +  P+++ K ++Q +    T  Y+  L+   +++
Sbjct: 239 SLSPHKALDEYQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWFT--YKSSLNCAYRIF 296

Query: 167 AADGIRGMYKGLVSTL 182
             +G R M+KG V  L
Sbjct: 297 VEEGFRYMWKGWVPRL 312

 Score = 32.7 bits (73), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 11/38 (28%), Positives = 24/38 (63%)

Query: 259 DIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLR 296
           +I+RTRG+RGF +G +P+  R    +     ++ ++++
Sbjct: 201 EIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTTYAWIVQ 238

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 60/148 (40%), Gaps = 8/148 (5%)

Query: 134 AAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRT--HFVYW 191
           A PV+ A  +  + Y+ Q + +      + ++Y   G+RG  +G + T IFR   + V  
Sbjct: 173 ARPVQTAHERWLLHYERQPSSHFA--GTVLEIYRTRGVRGFLQGAMPT-IFRQLGNSVVR 229

Query: 192 WGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSLR 251
           + +Y  + +    +  L +                     P DVIK  +     +  + +
Sbjct: 230 FTTYAWIVQSLSPHKALDE--YQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWF-TYK 286

Query: 252 SWRNAASDIWRTRGIRGFFKGFVPSFLR 279
           S  N A  I+   G R  +KG+VP   +
Sbjct: 287 SSLNCAYRIFVEEGFRYMWKGWVPRLFK 314

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/293 (19%), Positives = 109/293 (37%), Gaps = 24/293 (8%)

Query: 23  VSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGR--FKGPLDCVYQTMRQQGIRG------F 74
           +SG+ +G     V HP D +KVRLQ S  + +    GP   + + +R     G       
Sbjct: 14  ISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSANSGRSVTNEL 73

Query: 75  YLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQ----------HEEKLPLSGCILSGV 124
           Y G +  L G  +   V  G     + L+ K V +          ++ K+     + +G 
Sbjct: 74  YRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSLIYLSAGA 133

Query: 125 LAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIF 184
            +G   + +  P+ + K ++          Y    + ++++   DG +G++KGLV  L  
Sbjct: 134 SSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLRTDGFQGLWKGLVPALFG 193

Query: 185 RTHFVYWWGSYELLT-----RWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQV 239
            +    ++  Y+ L      R  +   ++  T +                 YP  ++K  
Sbjct: 194 VSQGALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVSVTLVYPFQLLKSN 253

Query: 240 ILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFE 292
           +      +   R +      I    G  G +KG   + +R+ P+       +E
Sbjct: 254 LQSFRANEQKFRLFP-LIKLIIANDGFVGLYKGLSANLVRAIPSTCITFCVYE 305

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 77/187 (41%), Gaps = 27/187 (14%)

Query: 115 PLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRG- 173
           PL   ++SG+ AG   + +  P++L K +LQ+   +    + GP  VIK++  +    G 
Sbjct: 8   PLQKEVISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSANSGR 67

Query: 174 -----MYKGLVSTLIFRTHFVYWWGSY--------ELLTRWFK--ANTNL----SDTAIN 214
                +Y+GL S  +F       WG Y        EL+ +       T L    +D  +N
Sbjct: 68  SVTNELYRGL-SINLFGNAIA--WGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMN 124

Query: 215 XXXXXXXXXXXXXXXAYPSD---VIKQVILCNDK-YDGSLRSWRNAASDIWRTRGIRGFF 270
                          A  ++   VIK  I+   K   G+  S  N    + RT G +G +
Sbjct: 125 SLIYLSAGASSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLRTDGFQGLW 184

Query: 271 KGFVPSF 277
           KG VP+ 
Sbjct: 185 KGLVPAL 191

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 74/164 (45%), Gaps = 14/164 (8%)

Query: 119 CILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGP--LDVIKKVYAADGIRGMYK 176
            +L+G ++G     I AP++  K +LQ+   A   +  G   ++V + +   +GIR  +K
Sbjct: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLT-PANGLKPFGSQVMEVARSMIKNEGIRSFWK 77

Query: 177 GLV-STLIFRTHFVYWWGSYELLTRW---FKANTNLSDTAINXXXXXXXXXXXXXXXAYP 232
           G +  +L++ T+    + SY L  R+   F     L    +                +YP
Sbjct: 78  GNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSIV-----SYP 132

Query: 233 SDVIKQVILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPS 276
            DV++  ++ N++      S      DIW+  G+ GFFKG + S
Sbjct: 133 FDVLRTRLVANNQMHS--MSITREVRDIWKLEGLPGFFKGSIAS 174

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/219 (21%), Positives = 88/219 (40%), Gaps = 35/219 (15%)

Query: 10  VVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQ 69
           + P    +R+   V G F+GI  + V +PFD ++ RL  +          + V    + +
Sbjct: 104 LTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITRE-VRDIWKLE 162

Query: 70  GIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLL---KKYVYQHEE----KLPLSGCILS 122
           G+ GF+ G    +    L  S+M G     R+     +K    H++     L  S   + 
Sbjct: 163 GLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIG 222

Query: 123 GVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRY----------------RGPLDVIKKVY 166
           GV+A      I  P+E  + ++Q        ++                R  L ++K+  
Sbjct: 223 GVIA----KIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQ-- 276

Query: 167 AADGIRGMYKGLVSTL--IFRTHFVYWWGSYELLTRWFK 203
             +G+  +Y+G++  L     T FV +WG YE    + +
Sbjct: 277 --EGVSSLYRGILVALSKTIPTTFVSFWG-YETAIHYLR 312

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 77/167 (46%), Gaps = 17/167 (10%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGR--FKGPLDCVYQTM-RQQGIRGFYLGF 78
            ++G  SG+   ++  P DTIK+RLQ +   G   F   +  V ++M + +GIR F+ G 
Sbjct: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79

Query: 79  TPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVE 138
            P  + ++   S           L  +Y+     +  L   ++ G  AG + S ++ P +
Sbjct: 80  IPGSLLYVTYGSAQFSSYS----LFNRYLTPFGLEARLHSLVV-GAFAGITSSIVSYPFD 134

Query: 139 LAKAKLQVQ---YDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTL 182
           + + +L      +    TR       ++ ++  +G+ G +KG ++++
Sbjct: 135 VLRTRLVANNQMHSMSITRE------VRDIWKLEGLPGFFKGSIASM 175

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 72/168 (42%), Gaps = 11/168 (6%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGI-RGFYLGFTP 80
           F++G   GI  ++  H  DT+K R Q + +  ++K  L        ++G  RG Y G+  
Sbjct: 57  FLAGGVGGIIGDSAMHSLDTVKTRQQGAPNVHKYKHMLQAYRTMFIEEGFRRGLYGGYCA 116

Query: 81  PLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELA 140
            ++G     ++       Y    +  +  +      S  + +G L  +  SF+  P E+ 
Sbjct: 117 AMLGSFPSAAIFFS---TYEFTKRTMINDYHLNDTFSH-LTAGFLGDFFSSFVYVPSEVL 172

Query: 141 KAKLQVQ------YDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTL 182
           K +LQ+Q      +      Y+   + I  +Y  +G+  ++ G  +TL
Sbjct: 173 KTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKATL 220

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 84/196 (42%), Gaps = 14/196 (7%)

Query: 107 VYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVY 166
           ++   E  P+  C L+G + G  +   +A   L   K + Q      +Y+  L   + ++
Sbjct: 44  LFDDYEHSPIWHCFLAGGVGG--IIGDSAMHSLDTVKTRQQGAPNVHKYKHMLQAYRTMF 101

Query: 167 AADGIR-GMYKGLVSTLI--FRTHFVYWWGSYELLTRWFKANTNLSDTAINXXXXXXXXX 223
             +G R G+Y G  + ++  F +  +++  +YE   R    + +L+DT  +         
Sbjct: 102 IEEGFRRGLYGGYCAAMLGSFPSAAIFF-STYEFTKRTMINDYHLNDT-FSHLTAGFLGD 159

Query: 224 XXXXXXAYPSDVIKQVILCNDKYDG-------SLRSWRNAASDIWRTRGIRGFFKGFVPS 276
                   PS+V+K  +     Y+        + +S RNA + I+RT G+   F G+  +
Sbjct: 160 FFSSFVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKAT 219

Query: 277 FLRSFPANAAALASFE 292
             R  P +A   A +E
Sbjct: 220 LARDLPFSALQFAFYE 235

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 73/167 (43%), Gaps = 16/167 (9%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPP 81
            VSG F G+A      P D +K RLQ +Q +      L  V + +R    R  + G  P 
Sbjct: 12  LVSGFFGGLASVCALQPLDLLKTRLQQAQASS-----LRSVLREVRT--TRELWRGTLPS 64

Query: 82  LVGWILMDSVMLGCLHNYRMLLKK--YVYQHEEKLPLSGC---ILSGVLAGWSVSFIAAP 136
            +   +  ++ L  L+  R  L +          LP       +L+G L+  +V  +  P
Sbjct: 65  ALRTSIGSALYLSLLNYSRSALARGSEARTRSSLLPRLQSYQNLLTGALSRAAVGLVTMP 124

Query: 137 VELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183
           + + K    V+Y++    Y G  +  + ++ ++G RG +KG  +T +
Sbjct: 125 ITVIK----VRYESTLYAYNGLAEATRHIWRSEGARGFFKGAAATTL 167

 Score = 35.4 bits (80), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 235 VIKQVILCNDKYDGSLRSWR---NAASDIWRTRGIRGFFKGFVPSFLRSFP 282
           V   + +   +Y+ +L ++     A   IWR+ G RGFFKG   + LR  P
Sbjct: 121 VTMPITVIKVRYESTLYAYNGLAEATRHIWRSEGARGFFKGAAATTLRDAP 171

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 62/311 (19%), Positives = 119/311 (38%), Gaps = 46/311 (14%)

Query: 23  VSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGI-RGFYLGFTPP 81
           VSG   G   ++  H  DT+K R Q + +  +++  +        ++G+ RG Y G+   
Sbjct: 58  VSGGIGGKIGDSAMHSLDTVKTRQQGAPNVKKYRNMISAYRTIWLEEGVRRGLYGGYMAA 117

Query: 82  LVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAK 141
           ++G     ++  G     +  + +    ++    LS    +G L  +  SF+  P E+ K
Sbjct: 118 MLGSFPSAAIFFGTYEYTKRTMIEDWQINDTITHLS----AGFLGDFISSFVYVPSEVLK 173

Query: 142 AKLQVQYDAQTTRYRGPL-----------DVIKKVYAADGIRGMYKGLVSTL-----IFR 185
            +LQ+Q      R+  P            + IK V   +G R ++ G  +TL        
Sbjct: 174 TRLQLQ-----GRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKATLARDLPFSA 228

Query: 186 THFVYWWGSYELLTRWFKANTNLSDTAI-NXXXXXXXXXXXXXXXAYPSDVIKQVILCND 244
             F ++    +L  +  + +    + +I N                 P DV+K  +    
Sbjct: 229 LQFAFYEKFRQLAFKIEQKDGRDGELSIPNEILTGACAGGLAGIITTPMDVVKTRVQTQQ 288

Query: 245 KYDGSLRSW----------RNAA---------SDIWRTRGIRGFFKGFVPSFLRSFPANA 285
               S +S+          R AA           ++++ G+ GFF G  P F+ +   ++
Sbjct: 289 PPSQSNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVLGFFSGVGPRFVWTSVQSS 348

Query: 286 AALASFEFVLR 296
             L  ++  LR
Sbjct: 349 IMLLLYQMTLR 359

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/201 (21%), Positives = 84/201 (41%), Gaps = 14/201 (6%)

Query: 102 LLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDV 161
           L KK     E+  P+  C++SG + G      +A   L   K + Q      +YR  +  
Sbjct: 39  LHKKRGDSDEDLSPIWHCVVSGGIGGKIGD--SAMHSLDTVKTRQQGAPNVKKYRNMISA 96

Query: 162 IKKVYAADGIR-GMYKGLVSTLI--FRTHFVYWWGSYELLTRWFKANTNLSDTAINXXXX 218
            + ++  +G+R G+Y G ++ ++  F +  +++ G+YE   R    +  ++DT I     
Sbjct: 97  YRTIWLEEGVRRGLYGGYMAAMLGSFPSAAIFF-GTYEYTKRTMIEDWQINDT-ITHLSA 154

Query: 219 XXXXXXXXXXXAYPSDVIKQVILCNDKYDGSL-------RSWRNAASDIWRTRGIRGFFK 271
                        PS+V+K  +    +++           + RNA   + +  G R  F 
Sbjct: 155 GFLGDFISSFVYVPSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFF 214

Query: 272 GFVPSFLRSFPANAAALASFE 292
           G+  +  R  P +A   A +E
Sbjct: 215 GYKATLARDLPFSALQFAFYE 235

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 48/119 (40%), Gaps = 30/119 (25%)

Query: 6   DSNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQ--------------- 50
           D    +PNE    + G  +G  +GI    +  P D +K R+QT Q               
Sbjct: 251 DGELSIPNEI---LTGACAGGLAGI----ITTPMDVVKTRVQTQQPPSQSNKSYSVTHPH 303

Query: 51  -DTGRFKGPLDCVYQTMR----QQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLK 104
              GR     + +  ++R     +G+ GF+ G  P  V   +  S+ML     Y+M L+
Sbjct: 304 VTNGRPAALSNSISLSLRTVYQSEGVLGFFSGVGPRFVWTSVQSSIMLLL---YQMTLR 359

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 76/326 (23%), Positives = 122/326 (37%), Gaps = 44/326 (13%)

Query: 6   DSNAVVPN--EAYSRMMGFVSGMFSGIAKNAVGHPFDTIKV--------RLQTSQDTGRF 55
           D  A VPN   + S+M  F          N  G   +  K+         L     + +F
Sbjct: 52  DGAAEVPNAVSSGSKMKTFT---------NVGGQNLNNAKIFWESACFQELHCKNSSLKF 102

Query: 56  KGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLP 115
            G L+   +    +GI   + G +  L+  I  + V     + Y   +      +    P
Sbjct: 103 NGTLEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSG-YEYIRDVSPIASTYPTLNP 161

Query: 116 LSGCILSGVLAGWSVSFIAAPVELAKAKLQ-VQYDAQTTR----YRGPLDVIKKVYAADG 170
           L    ++ V A  S+    AP+EL K KLQ +   +++T+     +  L+  ++     G
Sbjct: 162 LFCGAIARVFAATSI----APLELVKTKLQSIPRSSKSTKTWMMVKDLLNETRQEMKMVG 217

Query: 171 -IRGMYKGLVSTLIFRTHF-VYWWGSYELLTR--WFKANTNLSDTA-----INXXXXXXX 221
             R ++KGL  TL     F   +W SYEL     W  +    S  A     IN       
Sbjct: 218 PSRALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTRFASKDANWVHFINSFASGCI 277

Query: 222 XXXXXXXXAYPSDVIK---QVILCNDKYDGSLRSWRNA---ASDIWRTRGIRGFFKGFVP 275
                    +P DV K   Q+ + N+         RN       IWRT G+   + G   
Sbjct: 278 SGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTEGLAALYTGLAA 337

Query: 276 SFLRSFPANAAALASFEFVLRVSGAK 301
             ++  P+ A  ++S+E   +V G K
Sbjct: 338 RVIKIRPSCAIMISSYEISKKVFGNK 363

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 65/299 (21%), Positives = 118/299 (39%), Gaps = 36/299 (12%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQD----------TGRFKGPLDCVYQTMRQQGI 71
            ++G F+GI ++++  P D +K R+Q   +           G           T+ QQ  
Sbjct: 24  LIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLLQQIS 83

Query: 72  RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKL---------PLSGCILS 122
           R         L  W  + S+++G    + +    Y +  E+ +         PL   + S
Sbjct: 84  R--ISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDFNTHQPLKTAV-S 140

Query: 123 GVLAGWSVSFIAAPVELAKAKLQVQY-DAQTTRYRGPLDVIKKVYAADGIRGMYKGLVST 181
           GV A  +   +  P +  K +LQ+Q   + ++ +R   ++    Y  +G    +    +T
Sbjct: 141 GVAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAFNI----YKNEGPMAFFYSYPTT 196

Query: 182 LIFRTHFVYW-WGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVI 240
           L     F    +  YE  T++F   TN  +  I+                 P D IK V+
Sbjct: 197 LAMNIPFAALNFVIYESSTKFFNP-TNAYNPWIHCLCGGIAGATCAAVTT-PLDCIKTVL 254

Query: 241 LCNDKYDGSLRSWRNA------ASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEF 293
                    + S++ A      A  IW++ G +GF++G  P  + + PA A +  S+EF
Sbjct: 255 QIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPRVISNIPATAISWTSYEF 313

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 72/195 (36%), Gaps = 21/195 (10%)

Query: 117 SGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYK 176
           + C L GV+A         P++L K +LQV        YR  LD  K +  ++G+  ++ 
Sbjct: 16  AACTLGGVVACGPTHSSVTPLDLVKCRLQV----NPQLYRSNLDGWKTIVRSEGLSKVFT 71

Query: 177 GLVSTLI-FRTHFVYWWGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDV 235
           G+ +T I +       +G YE   + +   +NL                      + +D+
Sbjct: 72  GVGATFIGYSLQGACKYGGYEYFKQTY---SNLLSPETAHRHRTAVYLCASASAEFLADI 128

Query: 236 ---------IKQVILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAA 286
                    +KQ           L  W    S I    G+ G +KG  P + R  P    
Sbjct: 129 LLCPWEAIKVKQQTTIPPFCKNFLEGW----SKITAAEGLSGLYKGITPLWCRQIPYTMC 184

Query: 287 ALASFEFVLRVSGAK 301
              SFE ++ +  AK
Sbjct: 185 KFTSFERIVEMIYAK 199

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 60/147 (40%), Gaps = 14/147 (9%)

Query: 38  PFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLH 97
           P D +K RLQ +     ++  LD     +R +G+   + G     +G+ L  +   G   
Sbjct: 35  PLDLVKCRLQVNPQL--YRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYE 92

Query: 98  NYR-----MLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQT 152
            ++     +L  +  ++H   + L     +  LA      +  P E  K K Q       
Sbjct: 93  YFKQTYSNLLSPETAHRHRTAVYLCASASAEFLA----DILLCPWEAIKVKQQTTIPPFC 148

Query: 153 TRYRGPLDVIKKVYAADGIRGMYKGLV 179
             +   L+   K+ AA+G+ G+YKG+ 
Sbjct: 149 KNF---LEGWSKITAAEGLSGLYKGIT 172

>Scas_687.15*
          Length = 328

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 46/102 (45%), Gaps = 3/102 (2%)

Query: 10  VVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQ 69
           + P +  + +  F  G+FS  A  A+  P D +K R+Q+      +K  L+C Y+   ++
Sbjct: 225 ISPTQPLNEVYAFGIGLFSSCAVVALTQPIDVVKTRMQSKTAHYFYKNSLNCAYRVFVEE 284

Query: 70  GIRGFYLGFTPPLVGWILMDSVMLGC---LHNYRMLLKKYVY 108
           G+   + G+ P L    L   +  G    + N    LKK  Y
Sbjct: 285 GMVSLWKGWLPRLFKVGLSGGISFGVYQYVENLSHTLKKEKY 326

>Kwal_26.7972
          Length = 358

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 76/179 (42%), Gaps = 24/179 (13%)

Query: 3   SRSDSNAVVPNEAYS---RMMGFV--SGMFSGIAKNAVGH---PFDTIKVRLQTSQD--- 51
           +++D +++VP++  S   R   ++  SG+  GIA +       P D IK+  QTS     
Sbjct: 4   AKTDDDSMVPSKNQSVDKRSAHYILRSGLAGGIAGSCAKTLIAPLDRIKILFQTSNPHYL 63

Query: 52  --TGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYR--MLLKKYV 107
             +G   G +          GIRGFY G +  L+      ++        R  M+  K  
Sbjct: 64  KYSGSTMGLIRAGAHINAHDGIRGFYQGHSATLIRIFPYAAIKFIAYEQIRHFMIPSKEY 123

Query: 108 YQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVY 166
             H  +L       SG +AG    F+  P++L + +L    D    +    L VIK++Y
Sbjct: 124 ETHARRLA------SGSMAGLCSVFMTYPLDLIRVRLAYVTDRSRIKM---LPVIKQIY 173

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 83/207 (40%), Gaps = 39/207 (18%)

Query: 10  VVPNEAY-SRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQ 68
           ++P++ Y +      SG  +G+    + +P D I+VRL    D  R K  L  + Q   +
Sbjct: 117 MIPSKEYETHARRLASGSMAGLCSVFMTYPLDLIRVRLAYVTDRSRIKM-LPVIKQIYTE 175

Query: 69  QGIR----------------GFYLGFTPPLVGWI------------LMDSVMLGCLHNYR 100
           +                    FY GFTP ++G I              D +  G L  Y 
Sbjct: 176 RASESLTSKSYVPRWFAHWCNFYRGFTPTVLGMIPYAGVSFFAHDLCGDILRSGALSPYS 235

Query: 101 M-------LLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTT 153
           +       L  +   Q    L     +++G LAG +    + P E+ + +LQV   + T+
Sbjct: 236 VLPISDEELTIRSKKQSSRPLKTWAELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTS 295

Query: 154 --RYRGPLDVIKKVYAADGIRGMYKGL 178
              ++   D+I+ +Y   G RG + GL
Sbjct: 296 IHNFQTIPDMIRIIYKERGWRGFFVGL 322

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 51/99 (51%), Gaps = 11/99 (11%)

Query: 1   MSSRSDSNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTS----QDTGRFK 56
           ++ RS   +  P + ++ +   V+G  +G+A     +PF+ I+ RLQ S         F+
Sbjct: 244 LTIRSKKQSSRPLKTWAEL---VAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQ 300

Query: 57  GPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGC 95
              D +    +++G RGF++G +   +G+I + + M+ C
Sbjct: 301 TIPDMIRIIYKERGWRGFFVGLS---IGYIKV-TPMVAC 335

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 4/65 (6%)

Query: 232 PSDVIKQVILCND----KYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAA 287
           P D IK +   ++    KY GS      A + I    GIRGF++G   + +R FP  A  
Sbjct: 47  PLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFYQGHSATLIRIFPYAAIK 106

Query: 288 LASFE 292
             ++E
Sbjct: 107 FIAYE 111

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 5/67 (7%)

Query: 121 LSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGP-LDVIK---KVYAADGIRGMYK 176
           L+G +AG     + AP++  K   Q   +    +Y G  + +I+    + A DGIRG Y+
Sbjct: 32  LAGGIAGSCAKTLIAPLDRIKILFQTS-NPHYLKYSGSTMGLIRAGAHINAHDGIRGFYQ 90

Query: 177 GLVSTLI 183
           G  +TLI
Sbjct: 91  GHSATLI 97

>Scas_613.24
          Length = 177

 Score = 43.1 bits (100), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 71/168 (42%), Gaps = 18/168 (10%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPP 81
            VSG   G++      P D +K R+Q  +    +    D       +  I+ F+ G  P 
Sbjct: 12  LVSGFIGGLSSAVTLQPLDLLKTRIQQHKGATLWSAIKDI------KDPIQ-FWRGTLPS 64

Query: 82  LVGWILMDSVMLGCLHNYRMLLKKYVYQHE-------EKLPLSGCILSGVLAGWSVSFIA 134
            +   +  ++ L CL+  R  L                +L +   +L+G +A   V +I 
Sbjct: 65  ALRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTGAMARGLVGYIT 124

Query: 135 APVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTL 182
            P+ +    L+V+Y++    Y+   + IK +Y  +GI G +KG   T+
Sbjct: 125 MPITI----LKVRYESTYYSYKSMNEAIKDIYKMEGISGFFKGFGPTV 168

 Score = 33.5 bits (75), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 19/36 (52%)

Query: 249 SLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPAN 284
           S +S   A  DI++  GI GFFKGF P+     P  
Sbjct: 140 SYKSMNEAIKDIYKMEGISGFFKGFGPTVGIGIPPQ 175

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 62/282 (21%), Positives = 109/282 (38%), Gaps = 26/282 (9%)

Query: 19  MMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGF 78
           +   VSG  +G + + V  P DT+K RLQ     G F              G RG Y G 
Sbjct: 6   LASLVSGAAAGTSTDVVFFPIDTLKTRLQAK---GGF----------FHNGGYRGIYRGL 52

Query: 79  TPPLVGWILMDSVMLGCLHNYRMLLKKYVYQ---HEEKLPLSGCILSGVLAGWSVSFIAA 135
              +V      S+      + +  L+  + +    E+   +   +LS  L   S   +  
Sbjct: 53  GSAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMSACLVRV 112

Query: 136 PVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADG-IRGMYKGLVSTLIFRTHFV-YWWG 193
           P E+ K + Q  +   + +    L +I +    +G +RG+Y+G  +T++    F    + 
Sbjct: 113 PAEVIKQRTQTHHTNSSLQ---TLRLILRDPTGEGVVRGLYRGWWTTIMREIPFTCIQFP 169

Query: 194 SYELLTRWFKANTNLSD-TAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSLRS 252
            YE L + + A   +   +A                   P DV+K  ++ +++    L  
Sbjct: 170 LYEYLKKKWAAYAEIERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMMLHERRVPML-- 227

Query: 253 WRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFV 294
             + A  ++R  G R FF+G  P  +      A  L  +E V
Sbjct: 228 --HLARTLFREEGARVFFRGIGPRTMWISAGGAIFLGVYEAV 267

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 33/65 (50%), Gaps = 4/65 (6%)

Query: 232 PSDVIKQVILCND----KYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAA 287
           P D IK +   ++    KY GSL     AA  IW   G+RGFF+G   + LR FP  A  
Sbjct: 53  PLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQGHSATLLRIFPYAAVK 112

Query: 288 LASFE 292
             ++E
Sbjct: 113 FVAYE 117

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 63/153 (41%), Gaps = 17/153 (11%)

Query: 21  GFVSGMFSGIAKNAVGHPFDTIKVRLQTSQD-----TGRFKGPLDCVYQTMRQQGIRGFY 75
           G   G+    AK  +  P D IK+  QTS       TG   G ++         G+RGF+
Sbjct: 37  GLAGGISGSCAKTLIA-PLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFF 95

Query: 76  LGFTPPLVGWILMDSVMLGCLHNYR--MLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFI 133
            G +  L+      +V        R  ++  K    H  +L      +SG LAG    FI
Sbjct: 96  QGHSATLLRIFPYAAVKFVAYEQIRNTLIPSKEFESHWRRL------VSGSLAGLCSVFI 149

Query: 134 AAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVY 166
             P++L + +L  + + +  +      +IKK+Y
Sbjct: 150 TYPLDLVRVRLAYETEHKRVKLG---RIIKKIY 179

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/230 (21%), Positives = 91/230 (39%), Gaps = 49/230 (21%)

Query: 8   NAVVPNEAY-SRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTM 66
           N ++P++ + S     VSG  +G+    + +P D ++VRL    +  R K  L  + + +
Sbjct: 121 NTLIPSKEFESHWRRLVSGSLAGLCSVFITYPLDLVRVRLAYETEHKRVK--LGRIIKKI 178

Query: 67  RQQGIRG-----------------FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVY- 108
            ++                     FY G+ P ++G I    V          +LK   + 
Sbjct: 179 YKEPASATLIKNDYIPNWFCHWCNFYRGYVPTVLGMIPYAGVSFFAHDLLHDVLKSPFFA 238

Query: 109 ----------------QHEEKLPLS--GCILSGVLAGWSVSFIAAPVELAKAKLQVQYDA 150
                           Q +++ PL     ++SG LAG +    A P E+ + +LQV   +
Sbjct: 239 PYSVLELSEDDELERVQKKQRRPLRTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALS 298

Query: 151 QTTRYRGPLDVIKK----VYAADGIRGMYKGL------VSTLIFRTHFVY 190
             T Y      I +    ++   G+RG + GL      V+ ++  + FVY
Sbjct: 299 PKTMYDHKFQSISEIAHIIFKERGVRGFFVGLSIGYIKVTPMVACSFFVY 348

 Score = 35.8 bits (81), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 5/68 (7%)

Query: 230 AYPSDVIK---QVILCNDK--YDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPAN 284
           AYP ++I+   QV   + K  YD   +S    A  I++ RG+RGFF G    +++  P  
Sbjct: 282 AYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAHIIFKERGVRGFFVGLSIGYIKVTPMV 341

Query: 285 AAALASFE 292
           A +   +E
Sbjct: 342 ACSFFVYE 349

 Score = 32.7 bits (73), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 5/67 (7%)

Query: 121 LSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPL----DVIKKVYAADGIRGMYK 176
           L+G ++G     + AP++  K   Q   +   T+Y G L    +  K ++  DG+RG ++
Sbjct: 38  LAGGISGSCAKTLIAPLDRIKILFQTS-NPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQ 96

Query: 177 GLVSTLI 183
           G  +TL+
Sbjct: 97  GHSATLL 103

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 39/67 (58%), Gaps = 3/67 (4%)

Query: 136 PVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTL--IFRTHFVYWWG 193
           P+     KLQ Q + +  + +  L+ IK++Y  DG+ G Y GL S +  +  T+FVY++ 
Sbjct: 33  PLVTITTKLQTQGNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALTNFVYYY- 91

Query: 194 SYELLTR 200
            YEL +R
Sbjct: 92  FYELTSR 98

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 60/298 (20%), Positives = 112/298 (37%), Gaps = 47/298 (15%)

Query: 37  HPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIR-GFYLGFTPPLVGWILMDSVMLGC 95
           H  DT+K R Q +  T ++K  +      + ++G+R G Y G++            MLG 
Sbjct: 74  HSLDTVKTRQQGAPSTVKYKNMIGAYRTIILEEGLRKGLYGGYS----------GAMLGS 123

Query: 96  LHNYRMLLKKYVYQHEEKLPLSGC------ILSGVLAGWSVSFIAAPVELAKAKLQVQ-- 147
             +  +    Y Y   + +   G       + +G L  +  SF+  P E+ K +LQ+Q  
Sbjct: 124 FPSAAIFFATYEYTKRKMIGEWGINETFSHLTAGFLGDFISSFVYVPSEVLKTRLQLQGR 183

Query: 148 YDAQTTR----YRGPLDVIKKVYAADGIRGMYKGLVSTLI---------FRTHFVYWWGS 194
           Y+    R    Y+   D +  +   +G   ++ G  +TL          F  +  +   +
Sbjct: 184 YNNPFFRSGYNYKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPFSGLQFAFYEKFRQLA 243

Query: 195 YELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILC-----------N 243
           + +  + F  + +LS+  I                  P DV+K  I             N
Sbjct: 244 FAVENKTFDEDLSLSNEIITGAAAGGLAGIITT----PLDVVKTRIQTQLPDIPENSSQN 299

Query: 244 DKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRVSGAK 301
            K      S       +++T G+ G F G  P F+ +   ++  L  ++  L+   +K
Sbjct: 300 LKQQTLTNSITKGMMTVYKTEGLAGLFSGVGPRFIWTSIQSSIMLLLYQVALKTLDSK 357

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 61/274 (22%), Positives = 112/274 (40%), Gaps = 55/274 (20%)

Query: 37  HPFDTIKVRLQTSQDTGRFKGPLDCVYQTMR----QQGIRGFYLGFTPPLVGWILMDSVM 92
           HP D  KVRLQ +        P   + Q +R     +GI G Y G +  L+      +  
Sbjct: 25  HPLDLTKVRLQAAPI------PKPTIVQMLRSILKNEGIVGLYAGLSASLLRQCTYTTAR 78

Query: 93  LGCLHNYRMLLKKYVYQHEEKLP----LSGCILSGVLAGWSVSFIAAPVELAKAKLQ--- 145
            G        LK++V   ++       L   ++SG L G + +F     +L   ++Q   
Sbjct: 79  FGMYD----ALKEHVIPRDKLTNMWYLLGASMVSGALGGLAGNF----ADLINIRMQNDS 130

Query: 146 -VQYDAQTTRYRGPLDVIKKVYAADGIRGMY-----KGLVSTLIFRTHFVYWWGSYE--L 197
            +  D +   Y+  +D + K+Y A+G + ++       +V  ++     V  +  ++  L
Sbjct: 131 ALPLDKRRN-YKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMTASQVVTYDMFKNFL 189

Query: 198 LTRWF----KANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDK-----YDG 248
           +T++     K +T+L+ + +                  P+DVIK +++   K     +D 
Sbjct: 190 VTKYNMDPKKNSTHLTSSLL--------AGFVATTVCSPADVIKTIVMNAHKKPGHNHDS 241

Query: 249 SLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFP 282
           S +    A +      G    F+G+VPSF R  P
Sbjct: 242 SFKILMEAINK----EGPSFMFRGWVPSFTRLAP 271

>Scas_645.9
          Length = 391

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 65/278 (23%), Positives = 105/278 (37%), Gaps = 27/278 (9%)

Query: 45  RLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLK 104
            L     + RF G L+   +  + +GI   + G +  L+  I  + V       Y  L  
Sbjct: 119 ELNCKNSSVRFNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFT---GYEYLRD 175

Query: 105 KYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQV--QYDAQTTRYRGPLDVI 162
                     P    ++ G +A    +   AP+EL K KLQ   +    TT +    +++
Sbjct: 176 NSPLATSS--PTFNPLMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELL 233

Query: 163 KKVYAADGIRG----MYKGLVSTLIFRTHF-VYWWGSYELLTR--WFKANTNLSDTA--I 213
           K+      I G    ++KGL  TL     F   +WGSYE      W   + + S+    I
Sbjct: 234 KETRQEMRISGASNALFKGLEITLWRDVPFSAIYWGSYEFCKTHLWMDTSKSHSNLTFFI 293

Query: 214 NXXXXXXXXXXXXXXXAYPSDVIK---QVILC--NDKY---DGSLRSWRNA---ASDIWR 262
           N                +P DV K   Q+     NDK       +   +N      +IW+
Sbjct: 294 NSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWK 353

Query: 263 TRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRVSGA 300
             G    + G VP  ++  P+ A  ++S+E   R+  A
Sbjct: 354 LEGWGALYTGLVPRMVKIAPSCAIMISSYELSKRLFNA 391

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 64/139 (46%), Gaps = 10/139 (7%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQD-TGRFKGPLDCVYQTMRQQGIRGFYLGFTP 80
           FV+G  +G  +  V +PF+  K RLQ +Q  +G  + PL  +Y+T R QG    Y+G   
Sbjct: 14  FVAGAAAGAIEGCVTYPFEFAKTRLQLAQQGSGESRNPLVLLYRTARTQGAGALYVGCPA 73

Query: 81  PLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSG--CILSGVLAGWSVSFIA-APV 137
            +VG      V        R  L+      +E+  LSG   +L+G+ AG   S +A  P 
Sbjct: 74  FVVGNTCKAGVRFLGFDALRRALQ------DERGALSGPRGMLAGLGAGLLESVLAVTPF 127

Query: 138 ELAKAKLQVQYDAQTTRYR 156
           E  K  L     A   RY+
Sbjct: 128 EAVKTALIDDRQAARPRYQ 146

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 73/182 (40%), Gaps = 23/182 (12%)

Query: 15  AYSRMMGFVSGMFSGIAKNAVG-HPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRG 73
           A S   G ++G+ +G+ ++ +   PF+ +K  L   +   R +      YQ   +   R 
Sbjct: 102 ALSGPRGMLAGLGAGLLESVLAVTPFEAVKTALIDDRQAARPR------YQHNGRGAARN 155

Query: 74  F------------YLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSG-CI 120
           +            Y G  P  +      +V  GC    +  +++Y     ++   SG   
Sbjct: 156 YALLLRELGLRGLYGGLVPVALRQASNQAVRFGCYTQLKQAVQRYAGTPADQPLGSGQTF 215

Query: 121 LSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVS 180
           L G L+G    +   PV+  K ++Q   DA   RY   +   + V   +G+R +++G   
Sbjct: 216 LVGALSGIVTVYATMPVDTVKTRMQA-LDA--ARYGSTVGCFRAVVREEGVRALWRGATP 272

Query: 181 TL 182
            L
Sbjct: 273 RL 274

>Scas_669.6
          Length = 373

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/191 (21%), Positives = 77/191 (40%), Gaps = 41/191 (21%)

Query: 24  SGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPL---DCVYQTMRQ--------QGIR 72
           +G+      + V  P + +K RLQ     GR   P       Y+++R         +G++
Sbjct: 152 AGLLGDFVSSFVYVPSEVLKTRLQLQ---GRVNNPFFQSGYNYRSLRTAIRIIVNTEGVK 208

Query: 73  GFYLGFTPPLVGWILMDSVMLGCLHNYRM----LLKKYVYQHEEKLPLSGCILSGVLAGW 128
             + G+   L   +   ++  G    +R     L KK + +H   +P    I +G +AG 
Sbjct: 209 ALFFGYKATLARDLPFSALQFGFYEKFRQTAFKLEKKDITKHNLSIP--NEIFTGAIAGG 266

Query: 129 SVSFIAAPVELAKAKLQVQ--------------YDAQTTRYRGPLDV-------IKKVYA 167
               I  P+++ K +LQ Q                A+T +   P+ +       +K VY 
Sbjct: 267 LAGIITTPMDVIKTRLQTQQADINPNSATTVGAISAKTNKKSRPIVLSNSIFRSLKLVYQ 326

Query: 168 ADGIRGMYKGL 178
           ++G+ G + G+
Sbjct: 327 SEGVIGFFSGV 337

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 71/154 (46%), Gaps = 13/154 (8%)

Query: 37  HPFDTIKVRLQTSQDTGRFKGPLDCVYQTM-RQQGI-RGFYLGFTPPLVGWILMDSVMLG 94
           H  DT+K R Q +  T ++K  +   Y+T+  ++GI RG Y G+   ++G     ++  G
Sbjct: 70  HSLDTVKTRQQGAPMTPKYKN-MTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAIFFG 128

Query: 95  CLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTT- 153
               Y    +K +        +S  + +G+L  +  SF+  P E+ K +LQ+Q       
Sbjct: 129 T---YEWCKRKMIGDLGFNDTVS-HLSAGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPF 184

Query: 154 -----RYRGPLDVIKKVYAADGIRGMYKGLVSTL 182
                 YR     I+ +   +G++ ++ G  +TL
Sbjct: 185 FQSGYNYRSLRTAIRIIVNTEGVKALFFGYKATL 218

 Score = 34.7 bits (78), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 55/123 (44%), Gaps = 33/123 (26%)

Query: 5   SDSNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQ-------------- 50
           +  N  +PNE ++   G ++G  +GI    +  P D IK RLQT Q              
Sbjct: 248 TKHNLSIPNEIFT---GAIAGGLAGI----ITTPMDVIKTRLQTQQADINPNSATTVGAI 300

Query: 51  --DTGRFKGPL---DCVYQTMR----QQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRM 101
              T +   P+   + ++++++     +G+ GF+ G  P  V   +  S+ML     Y+M
Sbjct: 301 SAKTNKKSRPIVLSNSIFRSLKLVYQSEGVIGFFSGVGPRFVWTSVQSSIMLLL---YQM 357

Query: 102 LLK 104
            L+
Sbjct: 358 TLR 360

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 79/199 (39%), Gaps = 24/199 (12%)

Query: 103 LKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVI 162
           L +Y Y    K  L+G I  G     S      P+++ K ++Q++    T   +G +   
Sbjct: 5   LPQYSYSDYAKFALAGAIGCG-----STHSSMVPIDVVKTRIQLE---PTVYNKGMVGSF 56

Query: 163 KKVYAADGIRGMYKGLVSTLI-FRTHFVYWWGSYELLTRWFKANTNLSDTAINXXXXXXX 221
           +K+ A +G   +  G   TL+ +     + +G YE+  ++F  +T   DTA         
Sbjct: 57  RKIIAEEGAGALLTGFGPTLLGYSIQGAFKFGGYEVFKKFF-IDTLGYDTAARYKNSVYI 115

Query: 222 XXXXXXXXAYPSDVIKQVILCNDKYDG----SLRSWRNAA----SDIWRTRGIRGFFKGF 273
                   A  ++ +  + LC  +       S  ++ N      S I +  G+  F+ GF
Sbjct: 116 GS------AAAAEFLADIALCPLEATRIRLVSQPTFANGLVGGFSRILKEEGVGSFYSGF 169

Query: 274 VPSFLRSFPANAAALASFE 292
            P   +  P N A    FE
Sbjct: 170 TPILFKQIPYNIAKFLVFE 188

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 30/146 (20%), Positives = 56/146 (38%), Gaps = 6/146 (4%)

Query: 38  PFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLH 97
           P D +K R+Q  + T   KG +    + + ++G      GF P L+G+ +  +   G   
Sbjct: 33  PIDVVKTRIQL-EPTVYNKGMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQGAFKFGGYE 91

Query: 98  NY-RMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYR 156
            + +  +    Y    +   S  I S   A +       P+E  + +L     +Q T   
Sbjct: 92  VFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEATRIRLV----SQPTFAN 147

Query: 157 GPLDVIKKVYAADGIRGMYKGLVSTL 182
           G +    ++   +G+   Y G    L
Sbjct: 148 GLVGGFSRILKEEGVGSFYSGFTPIL 173

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/223 (21%), Positives = 78/223 (34%), Gaps = 58/223 (26%)

Query: 23  VSGMFSGIAKNAVGHPFDTIKVRLQT----------------SQDTG------------- 53
           +SG  +    N V +P D +K  +QT                SQD               
Sbjct: 8   LSGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDIPPVPIKL 67

Query: 54  ------RFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLL---- 103
                 ++    D +Y+  +Q+GIRG Y G T          SVM G    +        
Sbjct: 68  NENNYLQYNSTFDAIYKIYKQEGIRGLYQGLT---------TSVMAGFFQTFSYFFWYSF 118

Query: 104 -------KKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYR 156
                   K + +   K      +L G++A  +      P+ L  A+ Q +         
Sbjct: 119 VRKCYFRVKLINRKNTKFTTIEELLLGIVAAATSQIFTNPISLISARQQTRQGIDGD--N 176

Query: 157 GPLDVIKKVYAAD-GIRGMYKGLVSTLIFRTHFVYWWGSYELL 198
             L V K++Y     I+G +KGL  +L+   +    + SYE L
Sbjct: 177 DFLTVAKEIYKEQRSIKGFWKGLKVSLMLTINPSITYTSYEKL 219

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 57/137 (41%), Gaps = 18/137 (13%)

Query: 154 RYRGPLDVIKKVYAADGIRGMYKGLVSTLI---FRTHFVYWWGSY--------ELLTRWF 202
           +Y    D I K+Y  +GIRG+Y+GL ++++   F+T   ++W S+        +L+ R  
Sbjct: 74  QYNSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFRVKLINR-- 131

Query: 203 KANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSLRSWRNAASDIWR 262
               N   T I                  P  +I          DG    +   A +I++
Sbjct: 132 ---KNTKFTTIEELLLGIVAAATSQIFTNPISLISARQQTRQGIDGD-NDFLTVAKEIYK 187

Query: 263 T-RGIRGFFKGFVPSFL 278
             R I+GF+KG   S +
Sbjct: 188 EQRSIKGFWKGLKVSLM 204

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 89/208 (42%), Gaps = 30/208 (14%)

Query: 113 KLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPL--DVIKKV---YA 167
           +LP++  ++ G  A    +   AP+EL + +LQ    A+ T     L  D+++++    +
Sbjct: 133 RLPVANPLVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREMRHEVS 192

Query: 168 ADGIRGMYKGLVSTLIFRTHF-VYWWGSYELLTRWF----KANTNLS--DTAINXXXXXX 220
             G R ++KGL  TL     F   +WG+YE     F     A  N S  D  I       
Sbjct: 193 VMGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFIGSFACGS 252

Query: 221 XXXXXXXXXAYPSDVIK---QVILCN----------DKYDGS--LRSWRNAASDIWRTRG 265
                     +P DV K   Q+ + +           K D S  + S+ NA   I ++ G
Sbjct: 253 MGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNA---IRKSEG 309

Query: 266 IRGFFKGFVPSFLRSFPANAAALASFEF 293
           IR  + G +P  ++  P+ A  ++++E 
Sbjct: 310 IRALYTGLLPRVMKIAPSCAIMISTYEL 337

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 25/72 (34%), Gaps = 13/72 (18%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQT-------------SQDTGRFKGPLDCVYQTMRQ 68
           F  G   G     + HPFD  K R+Q              +  T   +G    +    + 
Sbjct: 248 FACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRKS 307

Query: 69  QGIRGFYLGFTP 80
           +GIR  Y G  P
Sbjct: 308 EGIRALYTGLLP 319

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 63/276 (22%), Positives = 111/276 (40%), Gaps = 39/276 (14%)

Query: 25  GMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMR----QQGIRGFYLGFTP 80
           G  +GI    V HP D  KVRLQ +        P   +++ +      +G+ G Y G + 
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRLQAA------PMPKPTLFRMLESILANEGVVGLYSGLSA 73

Query: 81  PLVGWILMDSVMLGCLHNYRMLLKKYVYQHEE------KLPLSGCILSGVLAGWSVSFIA 134
            ++      +V  G       LLK+ V   E+       LP S  + SG + G + +F A
Sbjct: 74  AVLRQCTYTTVRFGAYD----LLKENVIPREQLTNMAYLLPCS--MFSGAIGGLAGNF-A 126

Query: 135 APVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAAD-GIRGMYKG----LVSTLIFRTHFV 189
             V +          A+   Y+  +D + K+Y  + G++ ++ G    +V  ++     V
Sbjct: 127 DVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQV 186

Query: 190 YWWGSYE--LLTRW-FKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKY 246
             +  ++  L+T+  F A+ N +    +                 P+DV+K  I+     
Sbjct: 187 VTYDVFKNYLVTKLDFDASKNYTHLTASLLAGLVATTVCS-----PADVMKTRIMNG--- 238

Query: 247 DGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFP 282
            G  +      +D  R  G    F+G++PSF R  P
Sbjct: 239 SGDHQPALKILADAVRKEGPSFMFRGWLPSFTRLGP 274

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/177 (20%), Positives = 82/177 (46%), Gaps = 13/177 (7%)

Query: 123 GVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTL 182
           G  AG   + +  P++LAK +LQ     + T +R    +++ + A +G+ G+Y GL + +
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRLQAAPMPKPTLFR----MLESILANEGVVGLYSGLSAAV 75

Query: 183 IFR-THFVYWWGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVIL 241
           + + T+    +G+Y+LL         L++ A                  + +DV+  + +
Sbjct: 76  LRQCTYTTVRFGAYDLLKENVIPREQLTNMAYLLPCSMFSGAIGGLAGNF-ADVV-NIRM 133

Query: 242 CNDK--YDGSLRSWRNAASDIWRTR----GIRGFFKGFVPSFLRSFPANAAALASFE 292
            ND        R+++NA   +++      G++  F G+ P+ +R     A+ + +++
Sbjct: 134 QNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTYD 190

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 74/160 (46%), Gaps = 17/160 (10%)

Query: 33  NAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGI-RGFYLGFTPPLVGWILMDSV 91
           ++V H  DT+K R Q +    +++  +        ++G+ RG Y G+   ++G     +V
Sbjct: 68  DSVMHSLDTVKTRQQGAPGEVKYRHMISAYRTLALEEGVRRGLYGGYGAAMLGSFPSAAV 127

Query: 92  MLGCLHNYRMLLKKYVYQ---HEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQ- 147
             G    Y  + ++ + +   HE    L+   L  + +    S +  P E+ K +LQ+Q 
Sbjct: 128 FFG---TYEWVKRQMINEWQIHETYSHLAAGFLGDLFS----SVVYVPSEVLKTRLQLQG 180

Query: 148 -YDAQTTR----YRGPLDVIKKVYAADGIRGMYKGLVSTL 182
            Y+ +  +    YRG  D ++ +   +G+  ++ G  +TL
Sbjct: 181 CYNNRHFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATL 220

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 53/288 (18%), Positives = 113/288 (39%), Gaps = 40/288 (13%)

Query: 23  VSGMFSGIAKNAVGHPFDTIKVRLQT------SQDTG--------RFKGPLDCVYQTMRQ 68
           ++G  +    N   +P D  K  +Q+      S+D+         R+K  +DC+    ++
Sbjct: 8   LTGAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINIFKE 67

Query: 69  QGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKL--------PLSGCI 120
           +GI G Y G T   V   + + V       Y  + K Y+      L        P++   
Sbjct: 68  KGILGLYQGMTVTTVATFVQNFVYFFW---YTFIRKSYMKHKLLGLQSLKNRDGPITPST 124

Query: 121 LSGVLAGWSVSFIA----APVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADG--IRGM 174
           +  ++ G + + I+    +P+ +   + Q  + A++ ++    +VIK +Y  +   I   
Sbjct: 125 IEELVLGVAAASISQLFTSPMAVVATRQQTVHSAESAKFT---NVIKDIYRENNGDITAF 181

Query: 175 YKGLVSTLIFRTHFVYWWGSYELLTRWF---KANTNLSDTAINXXXXXXXXXXXXXXXAY 231
           +KGL + L    +    + S++ L   F    +N   S +A+                  
Sbjct: 182 WKGLRTGLALTINPSITYASFQRLKEVFFHDHSNDAGSLSAVQNFILGVLSKMISTLVTQ 241

Query: 232 PSDVIKQVILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLR 279
           P  V K ++           +++ A   +++  G++  +KG +P   +
Sbjct: 242 PLIVAKAML---QSAGSKFTTFQEALLYLYKNEGLKSLWKGVLPQLTK 286

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 71/181 (39%), Gaps = 19/181 (10%)

Query: 121 LSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVS 180
           L+G +   S      P+++ K ++Q++    T   +G +   K++ A +G   +  G   
Sbjct: 22  LAGAIGCGSTHSSMVPIDVVKTRIQLE---PTVYNKGMVGSFKQIIAGEGAGALLTGFGP 78

Query: 181 TLI-FRTHFVYWWGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQV 239
           TL+ +     + +G YE+  ++F  N    DTA                 A  ++ +  +
Sbjct: 79  TLLGYSIQGAFKFGGYEVFKKFFIDNLGY-DTA------SRYKNSVYMGSAAMAEFLADI 131

Query: 240 ILCNDKYDG----SLRSWRNAA----SDIWRTRGIRGFFKGFVPSFLRSFPANAAALASF 291
            LC  +       S   + N      S I +  GI  F+ GF P   +  P N A    F
Sbjct: 132 ALCPLEATRIRLVSQPQFANGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKFLVF 191

Query: 292 E 292
           E
Sbjct: 192 E 192

 Score = 29.6 bits (65), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 30/146 (20%), Positives = 55/146 (37%), Gaps = 6/146 (4%)

Query: 38  PFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLH 97
           P D +K R+Q  + T   KG +    Q +  +G      GF P L+G+ +  +   G   
Sbjct: 37  PIDVVKTRIQL-EPTVYNKGMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGAFKFGGYE 95

Query: 98  NY-RMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYR 156
            + +  +    Y    +   S  + S  +A +       P+E  + +L     +Q     
Sbjct: 96  VFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIALCPLEATRIRLV----SQPQFAN 151

Query: 157 GPLDVIKKVYAADGIRGMYKGLVSTL 182
           G +    ++   +GI   Y G    L
Sbjct: 152 GLVGGFSRILKEEGIGSFYSGFTPIL 177

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 44/203 (21%), Positives = 82/203 (40%), Gaps = 35/203 (17%)

Query: 21  GFVSGMFSGIAKNAVGHPFDTIKVRLQT---------SQDTGRFKGPLDCVYQTMRQQGI 71
            F   + S +A   V +P D  K  +QT         S++  ++K  +DC+ +  +++G 
Sbjct: 7   AFTGAVASSLAATTV-YPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGF 65

Query: 72  RGFYLGFTPPLVGWILMDSVMLG----CLHNY------RMLLK---KYVYQHE-EKLPLS 117
            G Y G    +    + + +          NY      R+ LK   K++     E+L L 
Sbjct: 66  LGLYQGLATNVAANFVQNFIYFFWYSLIRSNYFVFKAGRLQLKDDSKFIELSTIEELAL- 124

Query: 118 GCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADG--IRGMY 175
                G+ AG     +  P+ +   + Q+  D +    +    VIK++Y      +   +
Sbjct: 125 -----GMSAGAMTQVVTNPISVISTRQQLTKDGEDASLKA---VIKQIYEESNGDLTAFW 176

Query: 176 KGLVSTLIFRTHFVYWWGSYELL 198
           KG    L+  T+    +GSY+ L
Sbjct: 177 KGFKVALVLSTNPAITYGSYQKL 199

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 82/179 (45%), Gaps = 21/179 (11%)

Query: 20  MGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFK-GPLDCVYQTMRQQGIRGFYLGF 78
           + F++G  +G     V  PF+ +K+ LQ    T  +  G ++ V Q  +++G+ G + G 
Sbjct: 13  IAFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGN 72

Query: 79  TPPLVGWILMDSVMLGCLHNYRMLLKKYVYQ-----HEEKLPLSGCILSGVLAGWSVSFI 133
               V      +V    ++ +    KK+++       +E+L     + +G L G      
Sbjct: 73  GLNCVRIFPYSAVQF-VVYEW---CKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLA 128

Query: 134 AAPVELAKAKLQVQYD--AQTTRYR--------GPLDVIKKVYAAD-GIRGMYKGLVST 181
             P++L + +L +Q    A+ ++ +        G  +++ K +  + GIRG+Y+G+  T
Sbjct: 129 TYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGLYRGIYPT 187

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 64/275 (23%), Positives = 101/275 (36%), Gaps = 42/275 (15%)

Query: 54  RFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEK 113
           +F G L+   +  + +G+   + G +  L+  I  + V        R           ++
Sbjct: 109 KFNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVR-----------DR 157

Query: 114 LPLSGC------ILSGVLAGWSVSFIAAPVELAKAKLQV-----QYDAQTTRYRGPLDVI 162
            PL+G       ++ G  A    +   AP+EL K KLQ        +     YR   + I
Sbjct: 158 SPLNGLYPTINPLICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEI 217

Query: 163 KKVYAADGI-RGMYKGLVSTLIFRTHF-VYWWGSYE--------LLTRWFKANTNLSDTA 212
           K   A  G+ + M+KGL  TL     F   +W SYE        L    F  N++     
Sbjct: 218 KSEIAMRGVAQTMFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHF 277

Query: 213 INXXXXXXXXXXXXXXXAYPSDVIK---QVILCNDKYD-------GSLRSWRNAASDIWR 262
            N                +P DV K   Q+ L  DK         GS  +     + I +
Sbjct: 278 TNSFLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRK 337

Query: 263 TRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRV 297
           T GI   + G  P   +  P+ A  ++S+E   R+
Sbjct: 338 TEGIGALYTGLAPRVAKIAPSCAIMISSYELTKRL 372

 Score = 35.0 bits (79), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 68/154 (44%), Gaps = 12/154 (7%)

Query: 149 DAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFR--THFVYWWGSYELLTRWFKANT 206
           + +  ++ G L+  +K+   +G+  +++G+  TL+     + VY+ G YE +    ++  
Sbjct: 104 NCRNQKFNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTG-YEYVRD--RSPL 160

Query: 207 NLSDTAINXXXXXXXXXXXXXXXAYPSDVIK---QVILCNDKYDGSLRSWRNAASDIWRT 263
           N     IN                 P ++IK   Q I  +   +GS+  +R+  ++I   
Sbjct: 161 NGLYPTINPLICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSE 220

Query: 264 RGIRG----FFKGFVPSFLRSFPANAAALASFEF 293
             +RG     FKG   +  R  P +A   AS+EF
Sbjct: 221 IAMRGVAQTMFKGLEITLWRDVPFSAIYWASYEF 254

 Score = 28.9 bits (63), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 13/52 (25%), Positives = 26/52 (50%), Gaps = 4/52 (7%)

Query: 243 NDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFV 294
           N K++G+L ++   A    +  G+   ++G   + L + PAN      +E+V
Sbjct: 107 NQKFNGTLEAFEKIA----KFEGVTTLWRGISITLLMAIPANVVYFTGYEYV 154

>Scas_705.9
          Length = 323

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/174 (20%), Positives = 77/174 (44%), Gaps = 14/174 (8%)

Query: 12  PNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGR--FKGPLDCVYQTMRQQ 69
           P  + S +   + G+ +      V +P + I  + QT+ D     F   L  +Y  +   
Sbjct: 114 PINSISTVEELIVGVGAAALTQVVNNPIEVILTKQQTTDDKDNVDFYSVLKQIY--VESN 171

Query: 70  G-IRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEE----KLPLSGCILSGV 124
           G +  ++ GF   L+   +  S+       ++ +L K V   E+    +L ++   + G 
Sbjct: 172 GKLSSYWKGFKVSLI-LTVNPSITFAAYQRFKDILLKQVSNSEKSYSGQLTVNQNFILGA 230

Query: 125 LAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGL 178
           LA    + I  P+ +AK  LQ       ++++   +V++ +Y  +G+  ++KG+
Sbjct: 231 LAKIISTIITQPLIVAKVSLQ----RSNSKFKHFEEVLRYLYKEEGVLALWKGV 280

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 39/205 (19%), Positives = 82/205 (40%), Gaps = 32/205 (15%)

Query: 17  SRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQT---SQDTG----------RFKGPLDCVY 63
           S +   ++G  +    N + +P D  K  +Q+   +++T           R +  + C+ 
Sbjct: 2   SNLESAITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLI 61

Query: 64  QTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHN-YRMLLKKY----VYQHEEKLPLSG 118
           +  R++G+RG Y G +      +    V   C    Y  L +KY    + ++ +  P++ 
Sbjct: 62  RIFRKRGLRGLYQGMSTS----VFSKFVQSFCYFFWYSFLRRKYFSLKLLRNTQARPINS 117

Query: 119 C-----ILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADG--I 171
                 ++ GV A      +  P+E+   K Q   D     +     V+K++Y      +
Sbjct: 118 ISTVEELIVGVGAAALTQVVNNPIEVILTKQQTTDDKDNVDF---YSVLKQIYVESNGKL 174

Query: 172 RGMYKGLVSTLIFRTHFVYWWGSYE 196
              +KG   +LI   +    + +Y+
Sbjct: 175 SSYWKGFKVSLILTVNPSITFAAYQ 199

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 55/257 (21%), Positives = 98/257 (38%), Gaps = 30/257 (11%)

Query: 35  VGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLG 94
           +G P +  K    T+    R  G    V     + G+ GFY G  P    W  +++   G
Sbjct: 34  LGQPLEVTK----TTMAANRQFGFSQAVRHVWSRGGVFGFYQGLIP----WAWIEASTKG 85

Query: 95  CLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIA-------APVELAKAKLQVQ 147
            +  +     +Y ++          IL GV  G + +++          VE+ ++K    
Sbjct: 86  AVLLFVSAEAEYQFRRLGLSNFGAGILGGVSGGVAQAYLTMGFCTCMKTVEITRSK---A 142

Query: 148 YDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYWWGSYELLTRWF----- 202
             A        L V K+++AA+G+RG+ KG+ +  I +   +  WGS   L+R       
Sbjct: 143 ASAPGVPVPSSLQVFKQIFAAEGLRGINKGVNAVAIRQ---MTNWGSRFGLSRLVEDGIR 199

Query: 203 KANTNLSDTAINXXXXXXXXXXXXXXXAY--PSDVIKQVIL--CNDKYDGSLRSWRNAAS 258
           +     SD  ++               A+  P +VI+  +    ND       +      
Sbjct: 200 RVTHKRSDEKLSAMEKIVASALGGGLSAWNQPIEVIRVEMQSRTNDPNRPKNLTVGKTFR 259

Query: 259 DIWRTRGIRGFFKGFVP 275
            I+   G+RG ++G  P
Sbjct: 260 YIYENNGLRGLYRGVTP 276

>Kwal_33.15597
          Length = 305

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/199 (21%), Positives = 78/199 (39%), Gaps = 24/199 (12%)

Query: 103 LKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVI 162
           + +Y      K  L+G I  G      V     P+++ K ++Q++    T   +G +   
Sbjct: 5   IPQYTISDYAKFALAGAIGCGTTHSAMV-----PIDVVKTRIQLE---PTVYNKGMISSF 56

Query: 163 KKVYAADGIRGMYKGLVSTLI-FRTHFVYWWGSYELLTRWFKANTNLSDTAINXXXXXXX 221
           K++ +++G   +  G   TL+ +     + +G YE+  + F  +T   D A+N       
Sbjct: 57  KQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGYEVFKKLF-IDTLGYDQAVNYKNSIYI 115

Query: 222 XXXXXXXXAYPSDVIKQVILCNDKYDG----SLRSWRNAA----SDIWRTRGIRGFFKGF 273
                   A  ++    + LC  +       S  ++ N      S I +  G+  F+ GF
Sbjct: 116 GS------AAIAEFFADIALCPLEATRIRLVSQPTFANGLVGGFSRILKEEGLSSFYNGF 169

Query: 274 VPSFLRSFPANAAALASFE 292
            P   +  P N A    FE
Sbjct: 170 TPILFKQIPYNIAKFLVFE 188

 Score = 35.8 bits (81), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 56/146 (38%), Gaps = 6/146 (4%)

Query: 38  PFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLH 97
           P D +K R+Q  + T   KG +    Q +  +G      GF P L+G+ L  S   G   
Sbjct: 33  PIDVVKTRIQL-EPTVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGYE 91

Query: 98  NYRML-LKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYR 156
            ++ L +    Y        S  I S  +A +       P+E  + +L     +Q T   
Sbjct: 92  VFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLV----SQPTFAN 147

Query: 157 GPLDVIKKVYAADGIRGMYKGLVSTL 182
           G +    ++   +G+   Y G    L
Sbjct: 148 GLVGGFSRILKEEGLSSFYNGFTPIL 173

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 23  VSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLG 77
           ++   S +A     +PFD    R+   +  G ++GPLDC+ +T+RQ+G    Y G
Sbjct: 218 LASALSSVAVCIAMNPFDVAMTRMYHHRG-GLYRGPLDCLCKTVRQEGFSALYKG 271

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 66/152 (43%), Gaps = 17/152 (11%)

Query: 38  PFDTIKVRLQTSQD------TGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSV 91
           P   +K R+Q           GR    L  ++   + +G+RG Y G    L+   +  +V
Sbjct: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALF---KDRGVRGLYQGVDAALLRTGVGSAV 193

Query: 92  MLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQ 151
            L    + +  L ++V    + + L    L+  L+  +V     P ++A  ++   Y  +
Sbjct: 194 QLAVYSHAKEALSRHV---PDGMALY--TLASALSSVAVCIAMNPFDVAMTRM---YHHR 245

Query: 152 TTRYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183
              YRGPLD + K    +G   +YKG ++ L+
Sbjct: 246 GGLYRGPLDCLCKTVRQEGFSALYKGHLAQLL 277

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 65/293 (22%), Positives = 97/293 (33%), Gaps = 58/293 (19%)

Query: 37  HPFDTIKVRLQTSQD-----TGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSV 91
           +P +T+K RLQ   +     +  + GP   V    R +G+RG   G        IL++  
Sbjct: 30  NPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNGS 89

Query: 92  MLGCLHNYRMLLKKYVYQHEEKLPLSGCILS-----GVLA-----------GWSVSFIAA 135
            LG     R               L GC+LS     G  A           G   + + +
Sbjct: 90  RLGLYDPLRA-------------ALGGCVLSDRRTYGTAALAVNATAGAAAGMIGAALGS 136

Query: 136 PVELAKAKLQVQYDAQTTRYRGPLD-----VIKKVYAADGIRGMYKGLVSTLIFRT---- 186
           P++L K ++Q    A   R   PL       +  ++   G+RG+Y+G V   + RT    
Sbjct: 137 PLQLVKTRMQ----ALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQG-VDAALLRTGVGS 191

Query: 187 --HFVYWWGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCND 244
                 +  + E L+R       L   A                   P DV    +    
Sbjct: 192 AVQLAVYSHAKEALSRHVPDGMALYTLA------SALSSVAVCIAMNPFDVAMTRM--YH 243

Query: 245 KYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRV 297
              G  R   +      R  G    +KG +   LR  P     L   E  LRV
Sbjct: 244 HRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRV 296

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 72/172 (41%), Gaps = 28/172 (16%)

Query: 21  GFVSGMFSGIAKNAVG-HPFDTIKVRLQTSQDTGRFKG--PLDCVYQTMRQQGIRGFYLG 77
           G + G F+G   +AV   P D +K R Q ++    ++    LD  +Q  R         G
Sbjct: 6   GHLIGGFAGGLSSAVALQPLDLLKTRFQQTKGGTLWQTVKSLDTPWQLWR---------G 56

Query: 78  FTPPLVGWILMDSVMLGCLHNYRMLLKK---------YVYQHEEKLP---LSGCILSGVL 125
             P  +   +  ++ L  L+  R  L K          V      LP   +   +++G  
Sbjct: 57  TLPSAIRTSVGSALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTGAF 116

Query: 126 AGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKG 177
           A  +V +I  P+ + K    V+Y++    Y+   +  K + A +GIRG ++G
Sbjct: 117 ARGTVGYITMPITIIK----VRYESTLYNYKSIAEAAKSIAAQEGIRGFFRG 164

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 3/47 (6%)

Query: 239 VILCNDKYDGSLRSWRN---AASDIWRTRGIRGFFKGFVPSFLRSFP 282
           + +   +Y+ +L ++++   AA  I    GIRGFF+GF P+ LR  P
Sbjct: 128 ITIIKVRYESTLYNYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAP 174

>Kwal_27.11419
          Length = 298

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/172 (20%), Positives = 75/172 (43%), Gaps = 21/172 (12%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPP 81
           F+ G   G+    +  PFD +K RLQ ++ +      LD V +++   G    + G  P 
Sbjct: 11  FIGGFVGGLTSAVILQPFDLLKTRLQQNKSSNL----LDVV-RSIETPG--QLWKGTLPS 63

Query: 82  LVGWILMDSVMLGCLHNYRMLL----------KKYVYQHEEKLPLSGCILSGVLAGWSVS 131
            +   +  ++ L  L+  R  +          K        +L +   ++SG +   +V 
Sbjct: 64  ALRTSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAVG 123

Query: 132 FIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183
               P+ +    L+V++++    Y+   +    +Y ++GIRG++ G  +T++
Sbjct: 124 VATMPITV----LKVRFESTMYNYKSLGEAATHIYRSEGIRGLFSGCGATVM 171

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 251 RSWRNAASDIWRTRGIRGFFKGFVPSFLRSFP 282
           +S   AA+ I+R+ GIRG F G   + +R  P
Sbjct: 144 KSLGEAATHIYRSEGIRGLFSGCGATVMRDAP 175

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 3/47 (6%)

Query: 239 VILCNDKYDGSL---RSWRNAASDIWRTRGIRGFFKGFVPSFLRSFP 282
           + +   +Y+ +L    S R A S I+RT G+RGFF+GF  + LR  P
Sbjct: 125 ITVIKVRYESTLYQYTSLRYATSHIFRTEGLRGFFRGFGATALRDAP 171

 Score = 32.3 bits (72), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 35/170 (20%), Positives = 71/170 (41%), Gaps = 23/170 (13%)

Query: 21  GFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQ-QGIRGFYLGFT 79
           GF  G+ S I    +  PFD +K RLQ  QD          +++T++  +     + G  
Sbjct: 14  GFSGGLVSAI----ILQPFDLLKTRLQ--QD------KTSTLWKTLKSIETPSQLWRGAL 61

Query: 80  PPLVGWILMDSVMLGCLHNYRMLLKK------YVYQHEEKLPLSGCILSGVLAGWSVSFI 133
           P  +   +  ++ L  L++ R  + K          +  +L +   + SG +       I
Sbjct: 62  PSCIRTSVGSAMYLTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRALTGLI 121

Query: 134 AAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183
             P+ + K    V+Y++   +Y         ++  +G+RG ++G  +T +
Sbjct: 122 TMPITVIK----VRYESTLYQYTSLRYATSHIFRTEGLRGFFRGFGATAL 167

 Score = 28.5 bits (62), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 18/91 (19%), Positives = 38/91 (41%), Gaps = 5/91 (5%)

Query: 17  SRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYL 76
           S ++   S   + +   ++  PFDT+K R+Q   +  +F       +    ++ +R  + 
Sbjct: 209 STLINGSSAFSAAVIATSITAPFDTVKTRMQL--EPAKFHSFTSTFWHIATKESVRNLFA 266

Query: 77  GFTPPLVGWILMDSVMLGCLHNYRMLLKKYV 107
           G +  L        +  G    Y  ++KK+V
Sbjct: 267 GISLRLTRKAFSAGIAWGI---YEEIVKKFV 294

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 43/102 (42%), Gaps = 16/102 (15%)

Query: 13  NEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIR 72
           NE ++ ++G +S      A      P D IK R+Q       ++  ++C Y+   ++G  
Sbjct: 233 NEYFATLLGLISS----CAVVGATQPLDVIKTRMQAKDSVLLYRNSINCAYRIFVEEGFA 288

Query: 73  GFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKL 114
             + G+ P L+   L  SV  G            +YQ+ E +
Sbjct: 289 MLWKGWLPRLMKVGLSGSVSFG------------IYQYTENM 318

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/111 (20%), Positives = 48/111 (43%), Gaps = 7/111 (6%)

Query: 67  RQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLA 126
           RQ G+R ++ G  P L+  +    V        +    K  YQ+ E        L G+++
Sbjct: 190 RQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQFAPKE-YQNNEYF----ATLLGLIS 244

Query: 127 GWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKG 177
             +V     P+++ K ++Q +       YR  ++   +++  +G   ++KG
Sbjct: 245 SCAVVGATQPLDVIKTRMQAK--DSVLLYRNSINCAYRIFVEEGFAMLWKG 293

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 10/38 (26%), Positives = 22/38 (57%)

Query: 257 ASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFV 294
           A++++R  G+R +FKG +P+ +R    +     +F  +
Sbjct: 185 AAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTML 222

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 4/70 (5%)

Query: 232 PSDVIKQVILCND----KYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAA 287
           P D IK +   ++    KY GS +   NA   IW    +RG F+G   + LR FP  A  
Sbjct: 73  PLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVFQGHSATLLRIFPYAAVK 132

Query: 288 LASFEFVLRV 297
             ++E +  V
Sbjct: 133 FIAYEQIRNV 142

 Score = 34.7 bits (78), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 42/82 (51%), Gaps = 16/82 (19%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTM--------RQQGIRG 73
            ++G  +G+A     +PF+ I+ RLQ     G    PL+  + +M         ++G RG
Sbjct: 294 LLAGGLAGMASQTAAYPFEIIRRRLQ----VGAVTNPLEHKFTSMSEMAKIIFHERGWRG 349

Query: 74  FYLGFTPPLVGWILMDSVMLGC 95
           F++G +   +G+I + + M+ C
Sbjct: 350 FFVGLS---IGYIKV-TPMVAC 367

 Score = 34.7 bits (78), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 47/232 (20%), Positives = 89/232 (38%), Gaps = 49/232 (21%)

Query: 8   NAVVPNEAY-SRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQ--TSQDTGRFKGPLDCVYQ 64
           N ++P++ Y +      SG  +G+      +P D I+VRL   T     R    +  +Y 
Sbjct: 141 NVIIPSKEYETHFRRLCSGSLAGLCSVFCTYPLDLIRVRLAYVTEHHKVRVWPLVKQIYS 200

Query: 65  TMRQQGIR-------------GFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVY--- 108
               + +               FY G+ P ++G I    V       +  +L+  V    
Sbjct: 201 EPASEALSSKAYVPKWFAQWCNFYRGYIPTVIGMIPYAGVSFFAHDLFHDILRHPVIAPY 260

Query: 109 --------------------QHEEKLPLS--GCILSGVLAGWSVSFIAAPVELAKAKLQV 146
                               +  +++PL+    +L+G LAG +    A P E+ + +LQV
Sbjct: 261 SVLRVDDLDADDLKVDVQTTRTGKRIPLNTWAELLAGGLAGMASQTAAYPFEIIRRRLQV 320

Query: 147 Q--YDAQTTRYRGPLDVIKKVYAADGIRGMYKGL------VSTLIFRTHFVY 190
               +    ++    ++ K ++   G RG + GL      V+ ++  + FVY
Sbjct: 321 GAVTNPLEHKFTSMSEMAKIIFHERGWRGFFVGLSIGYIKVTPMVACSFFVY 372

>Kwal_55.21106
          Length = 328

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 43/219 (19%), Positives = 83/219 (37%), Gaps = 42/219 (19%)

Query: 23  VSGMFSGIAKNAVGHPFDTIKVRLQTSQ-------DTG-------------RFKGPLDCV 62
           ++G  +    N V +P D +K  +QT         + G             R+K  LD +
Sbjct: 8   ITGAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDAL 67

Query: 63  YQTMRQQGIRGFYLGFTPPLVGWILMD-------SVMLGCLHNYRML---LKKYVYQHEE 112
            +  + +G+ G Y G    ++   L         S++      Y++L   L K+    E 
Sbjct: 68  IKIFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLGKFSTPEE- 126

Query: 113 KLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAA-DGI 171
                  +L G++A        +P+ +   + Q         +R   +V+ ++Y+  + I
Sbjct: 127 -------LLLGIVAAAVSQIFTSPIGVISTRQQTSTSGSKGGFR---EVLHQIYSEQNNI 176

Query: 172 RGMYKGLVSTLIFRTHFVYWWGSYELLTRWFKANTNLSD 210
            G ++G   +LI   +    + SYE L   F  +    D
Sbjct: 177 TGFWRGFKVSLILTVNPSITFASYEKLQDIFITSKRAVD 215

 Score = 28.1 bits (61), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 39/88 (44%), Gaps = 4/88 (4%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQ-TSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTP 80
           F+ G+FS +    +  P    K  LQ T  +   F+  L  +Y   +Q+G+   + G  P
Sbjct: 233 FLLGVFSKVISTLITQPLIVSKAYLQRTGSNFQSFQQVLLYLY---KQEGLISLWKGLAP 289

Query: 81  PLVGWILMDSVMLGCLHNYRMLLKKYVY 108
            L   IL+  ++         L+K+ ++
Sbjct: 290 QLSKGILVQGLLFMFKGELTKLIKRCIF 317

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 29/41 (70%), Gaps = 2/41 (4%)

Query: 154 RYRGPLDVIKKVYAADGIRGMYKGLVSTLI--FRTHFVYWW 192
           +Y+G LD ++++Y A+G+ G+Y+GL S+ +  F   F Y++
Sbjct: 71  QYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFF 111

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 38/187 (20%), Positives = 81/187 (43%), Gaps = 32/187 (17%)

Query: 44  VRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYR--- 100
           + L++ Q   ++KG LD + +    +G+ G Y G         L  S + G + ++    
Sbjct: 61  IALRSPQAAEQYKGALDALQRIYGAEGVAGLYRG---------LGSSTVAGFIQSFSYFF 111

Query: 101 --MLLKKYVYQHEE------KLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQT 152
              L++K+ ++ ++      +      ++ G++A  +      P+ +   + Q +  A  
Sbjct: 112 WYTLVRKHYFRLKQARGGDARFSTPEELVLGIVAAATSQLFVNPINVVATRQQTRGQAA- 170

Query: 153 TRYRGPLD---VIKKVYAADGIRGMYKGLVSTLIFRTHFVYWWGSYELLTRWF----KAN 205
               G  D   V ++V+A +G RG + GL  +L+   +    + +YE L         A 
Sbjct: 171 ----GAADMRTVAREVHAENGWRGFWAGLKVSLVLTVNPSITYATYERLREALFPTPAAA 226

Query: 206 TNLSDTA 212
           ++L D+A
Sbjct: 227 SHLVDSA 233

>Kwal_34.15907
          Length = 312

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 57/260 (21%), Positives = 106/260 (40%), Gaps = 36/260 (13%)

Query: 35  VGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLG 94
           +G P + IK  +  +++   F   +  V+    + G+ GFY G  P    W  +++   G
Sbjct: 35  LGQPLEVIKTTMAANRNL-NFGQSVKHVWS---RGGVFGFYQGLIP----WAWIEASTKG 86

Query: 95  CLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIA-------APVELAKAKLQVQ 147
            +  +     +Y ++          I+ GV  G + +++          VE+ KAK  V 
Sbjct: 87  AVLLFVSAEAEYQFKRLGLGNFGAGIMGGVSGGVAQAYLTMGFCTCMKTVEITKAKSAVA 146

Query: 148 YDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYWWGSYELLTRW------ 201
                + +       K++Y+ +GI+G+ KG+ +  I +   +  WGS   L+R       
Sbjct: 147 GAIPQSSW----SAFKEIYSKEGIKGINKGVNAVAIRQ---MTNWGSRFGLSRLVEQGIR 199

Query: 202 -FKANTNLSD--TAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSLRSWRNAAS 258
            F   TN  D  TA+                  P +VI+ V + + K D +        S
Sbjct: 200 DFTGKTNPDDKLTALEKIFASALGGGLSAWN-QPIEVIR-VEMQSKKEDPNRPKKLTVGS 257

Query: 259 D---IWRTRGIRGFFKGFVP 275
               I+++ GI+G ++G  P
Sbjct: 258 AFKYIYQSSGIKGLYRGVAP 277

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 57/133 (42%), Gaps = 11/133 (8%)

Query: 154 RYRGPLDVIKKVYAADGIRGMYKGLVSTLI--FRTHFVY-WWGSYELLTR-WFKANTNLS 209
           RY+  LDVI KVY  +G  G+Y GL ++L+  F   F Y +W  Y L+ R +F+      
Sbjct: 86  RYKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFW--YTLIRRHYFRVKKVKG 143

Query: 210 DTA----INXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSLRSWRNAASDIWRTRG 265
           + A    I                  P +++          +G   S++  A +++   G
Sbjct: 144 EAARFSTIEELLLSMLAAATSQLFTNPINIVSTKQQTRRGLEGD-NSFKAIAKEVYDEDG 202

Query: 266 IRGFFKGFVPSFL 278
           I GF+K    S +
Sbjct: 203 ITGFWKSLKVSLV 215

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 61/151 (40%), Gaps = 12/151 (7%)

Query: 54  RFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDS-----VMLGCLHNYRMLLKKYVY 108
           R+K  LD + +  R +G  G Y G +  L+G  +          L   H +R+   K V 
Sbjct: 86  RYKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFWYTLIRRHYFRV---KKVK 142

Query: 109 QHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQ-TTRYRGPLDVIKKVYA 167
               +      +L  +LA  +      P+ +   K Q +   +    ++    + K+VY 
Sbjct: 143 GEAARFSTIEELLLSMLAAATSQLFTNPINIVSTKQQTRRGLEGDNSFKA---IAKEVYD 199

Query: 168 ADGIRGMYKGLVSTLIFRTHFVYWWGSYELL 198
            DGI G +K L  +L+   +    + S E L
Sbjct: 200 EDGITGFWKSLKVSLVLTINPSITYASAEKL 230

>Scas_673.17
          Length = 314

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 69/181 (38%), Gaps = 19/181 (10%)

Query: 121 LSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVS 180
           L+G +   +      PV++ K ++Q++    T   +G +   KK+ A +G   +  G   
Sbjct: 25  LAGAIGCGTTHSSLVPVDVVKTRIQLE---PTVYNKGMVGSFKKIIADEGAGALLTGFGP 81

Query: 181 TLI-FRTHFVYWWGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQV 239
           TL+ +     + +G YE+  +       LS   I                A  ++ +  +
Sbjct: 82  TLLGYSVQGAFKFGGYEVFKK-------LSIDTIGYENAVHYKNSVYMGSAAVAEFLADI 134

Query: 240 ILCNDKYDG----SLRSWRNAA----SDIWRTRGIRGFFKGFVPSFLRSFPANAAALASF 291
            LC  +       S  ++ N      S I +  G+  F+ GF P   +  P N A    F
Sbjct: 135 ALCPLEATRIRLVSQPTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVF 194

Query: 292 E 292
           E
Sbjct: 195 E 195

 Score = 34.3 bits (77), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 68/151 (45%), Gaps = 12/151 (7%)

Query: 38  PFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLH 97
           P +  ++RL  SQ T    G +    + ++++G+  FY GFTP L   I  +        
Sbjct: 138 PLEATRIRL-VSQPT-FANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFE 195

Query: 98  NYRMLLKKYVYQHEEKLPLSGC---ILSGVLAGWSVSFIAAPVE--LAKAKLQVQYDAQT 152
               +    V   E    ++     +LSG+ AG++ +F++ P +  L+K     +   Q+
Sbjct: 196 RASEVYYGIVGAKETLSDMTNTGINLLSGLTAGFAAAFVSQPADTLLSKVNKTKKAPGQS 255

Query: 153 TRYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183
           T     + ++ ++    G+ G + GL + LI
Sbjct: 256 T-----IGLLAQLAKQLGVIGSFAGLPTRLI 281

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 39/186 (20%), Positives = 72/186 (38%), Gaps = 14/186 (7%)

Query: 38  PFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLH 97
           P D +K R+Q  + T   KG +    + +  +G      GF P L+G+ +  +   G   
Sbjct: 40  PVDVVKTRIQL-EPTVYNKGMVGSFKKIIADEGAGALLTGFGPTLLGYSVQGAFKFGGYE 98

Query: 98  NYRML-LKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYR 156
            ++ L +    Y++      S  + S  +A +       P+E  + +L     +Q T   
Sbjct: 99  VFKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLADIALCPLEATRIRLV----SQPTFAN 154

Query: 157 GPLDVIKKVYAADGIRGMYKGLVSTLIFR-----THFVYWWGSYELLTRWFKANTNLSD- 210
           G +    ++   +G+   Y G    L  +       F+ +  + E+      A   LSD 
Sbjct: 155 GLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFERASEVYYGIVGAKETLSDM 214

Query: 211 --TAIN 214
             T IN
Sbjct: 215 TNTGIN 220

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 1/62 (1%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPP 81
           FVS +F   A   V  P D IK R+Q S++    +     V  T++ +G   F+ G TP 
Sbjct: 212 FVSSIFGASASLIVSAPLDVIKTRIQ-SRNFESAESGFTIVKNTLKNEGATAFFKGLTPK 270

Query: 82  LV 83
           L+
Sbjct: 271 LL 272

 Score = 28.5 bits (62), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 29/150 (19%), Positives = 68/150 (45%), Gaps = 18/150 (12%)

Query: 38  PFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLG-CL 96
           P D +K++ QT+ ++ R +G L    + +R +G+ G Y G+     GW    +      L
Sbjct: 137 PLDVLKIKRQTNPESFRGRGFL----RILRDEGM-GLYRGW-----GWTAARNAPGSFAL 186

Query: 97  HNYRMLLKKYVYQHEE--KLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQ-YDAQTT 153
                  K+Y+   ++  +       +S +    +   ++AP+++ K ++Q + +++  +
Sbjct: 187 FGGNAFAKEYILGLKDYSQATWGQNFVSSIFGASASLIVSAPLDVIKTRIQSRNFESAES 246

Query: 154 RYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183
            +     ++K     +G    +KGL   L+
Sbjct: 247 GF----TIVKNTLKNEGATAFFKGLTPKLL 272

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 29/55 (52%)

Query: 23  VSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLG 77
           ++G+ +     A+  P D +K R+ +      +K  L+C+Y+   Q+G+  F+ G
Sbjct: 199 ITGLATSFTLVAMTQPIDVVKTRMMSQNAKTEYKNTLNCMYRIFVQEGMATFWKG 253

 Score = 33.1 bits (74), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 34/193 (17%), Positives = 77/193 (39%), Gaps = 40/193 (20%)

Query: 16  YSRMMGF---VSGMFSGIAKNAVGHPFDTIKVRL-------------------------- 46
           + R+ G+   ++G  +GI ++    PF+ IK  L                          
Sbjct: 70  FQRLTGYNLLIAGTLTGIVESLFIIPFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHK 129

Query: 47  --QTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLK 104
               S    R +  L  V    + +G   F  G T  +   I   S+       ++ LL+
Sbjct: 130 VATKSTPVARIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQ 189

Query: 105 KYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKK 164
                  +K   +  +++G+   +++  +  P+++ K ++  Q +A+T  Y+  L+ + +
Sbjct: 190 A----RNDK---ASSVITGLATSFTLVAMTQPIDVVKTRMMSQ-NAKT-EYKNTLNCMYR 240

Query: 165 VYAADGIRGMYKG 177
           ++  +G+   +KG
Sbjct: 241 IFVQEGMATFWKG 253

>Kwal_27.11626
          Length = 299

 Score = 36.6 bits (83), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 29/65 (44%), Gaps = 7/65 (10%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGP---LDCVYQTMRQQGIRGFYLGF 78
           FVS +    A   V  P D IK R+Q       F  P      V  T++ +GI  F+ G 
Sbjct: 212 FVSSIVGASASLIVSAPLDVIKTRIQNRH----FDNPESGFRIVQNTLKNEGITAFFKGL 267

Query: 79  TPPLV 83
           TP L+
Sbjct: 268 TPKLL 272

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 31/150 (20%), Positives = 68/150 (45%), Gaps = 18/150 (12%)

Query: 38  PFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLG-CL 96
           P D +K++ QT+ ++  FKG      + ++ +G  G Y G+     GW    +      L
Sbjct: 137 PLDVLKIKRQTNPES--FKG--RGFIKILKDEGF-GLYRGW-----GWTAARNAPGSFAL 186

Query: 97  HNYRMLLKKYVYQHEE--KLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQ-YDAQTT 153
                  K+Y+   ++      S   +S ++   +   ++AP+++ K ++Q + +D   +
Sbjct: 187 FGGNAFAKEYILGLKDYSSATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRHFDNPES 246

Query: 154 RYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183
            +R    +++     +GI   +KGL   L+
Sbjct: 247 GFR----IVQNTLKNEGITAFFKGLTPKLL 272

>Scas_562.12
          Length = 300

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 67/150 (44%), Gaps = 17/150 (11%)

Query: 38  PFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLG-CL 96
           P D +K++ QT+ +   FKG      + ++ +GI   Y G+     GW    +      L
Sbjct: 138 PLDVLKIKRQTNPEA--FKG--RGFVKILKDEGIFNLYRGW-----GWTAARNAPGSFAL 188

Query: 97  HNYRMLLKKYVYQHEE--KLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQ-YDAQTT 153
                  K+Y+   E+  +   S   +S ++       ++AP+++ K ++Q + +D   T
Sbjct: 189 FGGNAFAKEYILGLEDYSQASWSQNFISSIVGASCSLIVSAPLDVIKTRIQNRSFDNPET 248

Query: 154 RYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183
                L ++K  +  +GI   +KGL   L+
Sbjct: 249 ----GLTIVKNTFKNEGITAFFKGLTPKLL 274

 Score = 35.0 bits (79), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 32/76 (42%), Gaps = 10/76 (13%)

Query: 14  EAYSRM---MGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGP---LDCVYQTMR 67
           E YS+      F+S +        V  P D IK R+Q       F  P   L  V  T +
Sbjct: 203 EDYSQASWSQNFISSIVGASCSLIVSAPLDVIKTRIQNRS----FDNPETGLTIVKNTFK 258

Query: 68  QQGIRGFYLGFTPPLV 83
            +GI  F+ G TP L+
Sbjct: 259 NEGITAFFKGLTPKLL 274

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 7/65 (10%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGP---LDCVYQTMRQQGIRGFYLGF 78
           F+S +    +   V  P D IK R+Q       F  P   L  V  T++ +G+  F+ G 
Sbjct: 214 FISSIVGACSSLIVSAPLDVIKTRIQNRN----FDNPESGLRIVKNTLKNEGVTAFFKGL 269

Query: 79  TPPLV 83
           TP L+
Sbjct: 270 TPKLL 274

 Score = 34.3 bits (77), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 32/150 (21%), Positives = 68/150 (45%), Gaps = 17/150 (11%)

Query: 38  PFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLG-CL 96
           P D +K++ QT+ ++  FKG      + +R +G+   Y G+     GW    +      L
Sbjct: 138 PLDVLKIKRQTNPES--FKG--RGFIKILRDEGLFNLYRGW-----GWTAARNAPGSFAL 188

Query: 97  HNYRMLLKKYVYQHEE--KLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQ-YDAQTT 153
                  K+Y+   ++  +   S   +S ++   S   ++AP+++ K ++Q + +D   +
Sbjct: 189 FGGNAFAKEYILGLKDYSQATWSQNFISSIVGACSSLIVSAPLDVIKTRIQNRNFDNPES 248

Query: 154 RYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183
             R    ++K     +G+   +KGL   L+
Sbjct: 249 GLR----IVKNTLKNEGVTAFFKGLTPKLL 274

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 64/283 (22%), Positives = 101/283 (35%), Gaps = 28/283 (9%)

Query: 20  MGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFT 79
           +  +SG  +G + + V  P DTIK RLQ     G F              G +G Y G  
Sbjct: 6   LSLLSGAAAGTSTDLVFFPIDTIKTRLQAK---GGF----------FANGGYKGIYRGLG 52

Query: 80  PPLVGWILMDSVMLGCLHNYRMLLKKYVYQ-----HEEKLPLSGCILSGVLAGWSVSFIA 134
             +V      S+        ++  + Y+ +      E+ +  +  +LS  +       + 
Sbjct: 53  SAVVASAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEICACLVR 112

Query: 135 APVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIR-GMYKGLVSTLIFRTHFV-YWW 192
            P E+ K + QV     T      L  I +    +G+R  +Y+G  +T++    F    +
Sbjct: 113 VPAEVVKQRTQVH---STNSSWQTLQSILRNDNKEGLRKNLYRGWSTTIMREIPFTCIQF 169

Query: 193 GSYELLTR-WFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSLR 251
             YE L + W KAN                          P D +K  ++ N K   SL 
Sbjct: 170 PLYEYLKKTWAKANGQSQVEPWKGAICGSIAGGIAAATTTPLDFLKTRLMLN-KTTASLG 228

Query: 252 SWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFV 294
           S       I+R  G   FF G  P  +      A  L  +E V
Sbjct: 229 S---VIIRIYREEGPAVFFSGVGPRTMWISAGGAIFLGMYETV 268

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
          Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 34.3 bits (77), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 38/78 (48%), Gaps = 11/78 (14%)

Query: 12 PNEA--YSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTG-----RFKGPLDCVYQ 64
          PN A  Y   MG +SG   G+A+  V +PFD ++ R Q     G     R+K   D +  
Sbjct: 6  PNLANLYKLAMGAISG---GVAQTLV-YPFDLLRRRFQVLAMGGNELGFRYKSVSDALIT 61

Query: 65 TMRQQGIRGFYLGFTPPL 82
            + +G +G+Y G T  L
Sbjct: 62 IGKTEGPKGYYKGLTANL 79

 Score = 29.3 bits (64), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/68 (23%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 231 YPSDVIK---QVI-LCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAA 286
           YP D+++   QV+ +  ++     +S  +A   I +T G +G++KG   +  +  P+ A 
Sbjct: 29  YPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEGPKGYYKGLTANLFKVIPSTAV 88

Query: 287 ALASFEFV 294
           +   +E +
Sbjct: 89  SWLVYEVI 96

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 35.8 bits (81), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 82/207 (39%), Gaps = 29/207 (14%)

Query: 120 ILSGVLAGWSVSFIAAPVELAKAKLQ----VQYDAQTT-RYRGPLDVIKKVYAADGIRGM 174
           +  G  A    +   AP+EL K +LQ     + D  T   ++  L   +    + G + +
Sbjct: 157 LFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSGGYKVL 216

Query: 175 YKGLVSTLIFRTHF-VYWWGSYELLTR--WFKANT-----NLS---DTAINXXXXXXXXX 223
           +KGL  TL     F   +WGSYE   +  W   +      NLS   D  IN         
Sbjct: 217 FKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINSFIGGSVSG 276

Query: 224 XXXXXXAYPSDVIK---QVIL-CNDKYDGSLRSWRNAAS---------DIWRTRGIRGFF 270
                  +P DV K   Q+ +   +K   +L S +   S         +I +T G    +
Sbjct: 277 SSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQTEGYGALY 336

Query: 271 KGFVPSFLRSFPANAAALASFEFVLRV 297
            G +P  ++  P+ A  ++++E   R+
Sbjct: 337 TGLIPRVMKIAPSCAIMISTYELSKRL 363

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 27/74 (36%), Gaps = 14/74 (18%)

Query: 21  GFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGR--------------FKGPLDCVYQTM 66
            F+ G  SG +   + HPFD  K R+Q + D                  +G    +Y   
Sbjct: 268 SFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIK 327

Query: 67  RQQGIRGFYLGFTP 80
           + +G    Y G  P
Sbjct: 328 QTEGYGALYTGLIP 341

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 35.8 bits (81), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 7/65 (10%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGP---LDCVYQTMRQQGIRGFYLGF 78
           FVS +    A   +  P D IK R+Q       F+ P      V  T++ +G   F+ G 
Sbjct: 212 FVSSIVGASASLIISAPLDVIKTRIQNKN----FENPESGFTIVKNTLKNEGFSAFFKGL 267

Query: 79  TPPLV 83
           TP L+
Sbjct: 268 TPKLL 272

>Kwal_23.4354
          Length = 343

 Score = 35.4 bits (80), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 39/87 (44%), Gaps = 9/87 (10%)

Query: 6   DSNAVVPNEAYSR----MMGFVSGMFSGIAKNAVGHPFDTIKVRLQ-TSQDTGRFKGPLD 60
           DS   + N + S     +  FV G F G     + HPFD  K R+Q T  ++   K P  
Sbjct: 235 DSEKSIVNSSNSNWNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSK 294

Query: 61  CVYQTMRQ----QGIRGFYLGFTPPLV 83
            +++ + Q    +G+   Y G  P ++
Sbjct: 295 NMFKYLNQMRKSEGLAALYTGLVPRVI 321

 Score = 35.4 bits (80), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 42/210 (20%), Positives = 86/210 (40%), Gaps = 27/210 (12%)

Query: 111 EEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQV--QYDAQTTRYRGPLDVIKKV--- 165
           ++K P    ++ G LA    +   AP+EL + +LQ   +   ++T      D+IK+    
Sbjct: 135 QDKYPTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIKESRYE 194

Query: 166 YAADGIRGMYKGLVSTLIFRTHF-VYWWGSYELLTRWFKANTNLSDTA------------ 212
            +  G + +++GL  TL     F   +WG YE    ++K+N ++                
Sbjct: 195 ISKVGYKALFRGLEITLWRDVPFSSIYWGCYE----FYKSNVSIDSEKSIVNSSNSNWNH 250

Query: 213 -INXXXXXXXXXXXXXXXAYPSDVIK---QVILCNDKYDGS-LRSWRNAASDIWRTRGIR 267
            +N                +P DV K   Q+   N   +    ++     + + ++ G+ 
Sbjct: 251 FVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLA 310

Query: 268 GFFKGFVPSFLRSFPANAAALASFEFVLRV 297
             + G VP  ++  P+ A  ++++E   R+
Sbjct: 311 ALYTGLVPRVIKIAPSCAIMISTYEVCKRL 340

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 35.0 bits (79), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 56/146 (38%), Gaps = 6/146 (4%)

Query: 38  PFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLH 97
           P D +K R+Q  + T   KG +    Q +  +G      GF P L+G+ L  S   G   
Sbjct: 33  PIDVVKTRIQL-EPTVYNKGMVSSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGYE 91

Query: 98  NYRML-LKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYR 156
            ++ L +    Y +      +  I S  +A +       P+E  + +L     +Q T   
Sbjct: 92  LFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIALCPLEATRIRLV----SQPTFAN 147

Query: 157 GPLDVIKKVYAADGIRGMYKGLVSTL 182
           G      ++   +G+   Y G    L
Sbjct: 148 GLFGGFSRILKEEGVGSFYNGFTPIL 173

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 34.7 bits (78), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 53/256 (20%), Positives = 100/256 (39%), Gaps = 28/256 (10%)

Query: 35  VGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLG 94
           +G P + +K    T+    R    L+ V     + GI G+Y G  P    W  +++   G
Sbjct: 37  LGQPLEVVK----TTMAANRNFTFLESVKHVWSRGGILGYYQGLIP----WAWIEASTKG 88

Query: 95  CLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTR 154
            +  +     +Y ++       +  IL GV  G + +++          +++      + 
Sbjct: 89  AVLLFVSAEAEYRFKSLGLNNFASGILGGVTGGVTQAYLTMGFCTCMKTVEITRHKSASA 148

Query: 155 YRGPLD---VIKKVYAADGIRGMYKGLVSTLIFRTHFVYWWGSYELLTRWFK-------A 204
              P     V K +Y  +GIRG+ KG+ +  I +   +  WGS   L+R  +        
Sbjct: 149 GGVPQSSWSVFKNIYKKEGIRGINKGVNAVAIRQ---MTNWGSRFGLSRLVEDGIRKITG 205

Query: 205 NTNLSDTAINXXXXXXXXXXXXXXXAY--PSDVIKQVILCNDKYDGSLRSWRNAASD--- 259
            TN  D  +N               A+  P +VI+ V + + K D +             
Sbjct: 206 KTN-KDDKLNPFEKIGASALGGGLSAWNQPIEVIR-VEMQSKKEDPNRPKNLTVGKTFKY 263

Query: 260 IWRTRGIRGFFKGFVP 275
           I+++ G++G ++G  P
Sbjct: 264 IYQSNGLKGLYRGVTP 279

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 34.7 bits (78), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 57/262 (21%), Positives = 103/262 (39%), Gaps = 41/262 (15%)

Query: 35  VGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLG 94
           +G P + +K  +  ++    F+     +     + G+ GFY G  P    W  +++   G
Sbjct: 32  LGQPLEVVKTTMAANRQFTFFQ----AINHIWSRGGVFGFYQGLIP----WAWIEASTKG 83

Query: 95  CLHNYRMLLKKYVYQHEEKLPLS---GCILSGVLAGWSVSFIA-------APVELAKAKL 144
            +  +     +Y   H +KL L+     I+ GV  G + +++          VE+ K K 
Sbjct: 84  AVLLFVSAEAEY---HFKKLGLNNFGAGIMGGVSGGVAQAYLTMGFCTCMKTVEITKHKS 140

Query: 145 QVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYWWGS-------YEL 197
                 Q++         K++Y  +GIRG+ KG+ +  I +   +  WGS        E 
Sbjct: 141 AAAGAKQSS-----WAAFKEIYNKEGIRGINKGVNAVAIRQ---MTNWGSRFGFSRLVEE 192

Query: 198 LTRWFKANTNLSD--TAINXXXXXXXXXXXXXXXAYPSDVIKQVIL--CNDKYDGSLRSW 253
             R F   TN  D  TA+                  P +VI+  +    ND       + 
Sbjct: 193 GLRKFTGKTNPDDKLTALEKIFASAIGGGLSAWN-QPIEVIRVEMQSKTNDPNRPKDLTV 251

Query: 254 RNAASDIWRTRGIRGFFKGFVP 275
             A   I+++ G++G ++G  P
Sbjct: 252 GKAFRYIYQSNGVKGLYRGVTP 273

 Score = 28.9 bits (63), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 17/93 (18%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQT-SQDTGRFKGPLDC--------VYQTMRQQGIR 72
           F S +  G++  A   P + I+V +Q+ + D  R   P D         +YQ+    G++
Sbjct: 214 FASAIGGGLS--AWNQPIEVIRVEMQSKTNDPNR---PKDLTVGKAFRYIYQS---NGVK 265

Query: 73  GFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKK 105
           G Y G TP +   I     M+GC    R  + K
Sbjct: 266 GLYRGVTPRIGLGIWQTVFMVGCGDIAREFVGK 298

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 34.7 bits (78), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 50/256 (19%), Positives = 102/256 (39%), Gaps = 28/256 (10%)

Query: 35  VGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLG 94
           +G P + IK  +  ++    F    + +     + G+ GFY G  P    W  +++   G
Sbjct: 35  LGQPLEVIKTTMAANRSFSFF----NAIKHVWSRGGVFGFYQGLIP----WAWIEASTKG 86

Query: 95  CLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIA-------APVELAKAKLQVQ 147
            +  +     +Y ++          I+ GV  G + +++          VE+ K K    
Sbjct: 87  AVLLFVSAESEYQFKRMGLSNFGSGIMGGVTGGVAQAYLTMGFCTCMKTVEITKKKSAGA 146

Query: 148 YDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFR-THFVYWWGSYELLTRWFKANT 206
                + +       K++Y  DGI+G+ KG+ +  I + T++   +G   L+    +  T
Sbjct: 147 GAIPQSSW----GAFKEIYKKDGIKGINKGVNAVAIRQMTNWGSRFGFSRLVEEGIRNAT 202

Query: 207 NLS--DTAINXXXXXXXXXXXXXXXAY--PSDVIKQVILCNDKYDGSLRSWRNAASD--- 259
             +  D  +                A+  P +VI+ V + + K D +       +S    
Sbjct: 203 GKTNPDDKLTALEKIAASAIGGGLSAWNQPIEVIR-VEMQSKKEDPNRPKNLTVSSAFKY 261

Query: 260 IWRTRGIRGFFKGFVP 275
           I+++ GI+G ++G  P
Sbjct: 262 IYQSSGIKGLYRGVAP 277

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 34.7 bits (78), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 28/65 (43%), Gaps = 7/65 (10%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGP---LDCVYQTMRQQGIRGFYLGF 78
           F+S +    A   V  P D IK R+Q       F  P      V  T++ +G   F+ G 
Sbjct: 214 FISSIVGASASLIVSAPLDVIKTRIQNRN----FDNPESGFKIVKNTLKNEGFTAFFKGL 269

Query: 79  TPPLV 83
           TP L+
Sbjct: 270 TPKLL 274

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 34.3 bits (77), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 28/65 (43%), Gaps = 7/65 (10%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGP---LDCVYQTMRQQGIRGFYLGF 78
           FVS +    A   V  P D IK R+Q       F  P      +  T++ +G   F+ G 
Sbjct: 213 FVSSIVGASASLIVSAPLDVIKTRIQNRN----FDNPESGFKIIKNTLKNEGFTAFFKGL 268

Query: 79  TPPLV 83
           TP L+
Sbjct: 269 TPKLL 273

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 30/150 (20%), Positives = 68/150 (45%), Gaps = 18/150 (12%)

Query: 38  PFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLG-CL 96
           P D +K++ QT+ ++ + +G L  +    + +G  G Y G+     GW    +      L
Sbjct: 138 PLDVLKIKRQTNPESFKGRGFLKII----KDEGF-GLYRGW-----GWTAARNAPGSFAL 187

Query: 97  HNYRMLLKKYVYQHEE--KLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQ-YDAQTT 153
                  K+Y+   ++  +   S   +S ++   +   ++AP+++ K ++Q + +D   +
Sbjct: 188 FGGNAFAKEYILGLKDYGQATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRNFDNPES 247

Query: 154 RYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183
            ++    +IK     +G    +KGL   L+
Sbjct: 248 GFK----IIKNTLKNEGFTAFFKGLTPKLL 273

>Scas_702.10
          Length = 302

 Score = 34.3 bits (77), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 59/276 (21%), Positives = 109/276 (39%), Gaps = 38/276 (13%)

Query: 25  GMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVG 84
           G  +GI    + HP D  KVRLQ +       G +  +   +R + + G Y G +  ++ 
Sbjct: 16  GGAAGIFACVMTHPLDLAKVRLQAAPLPKPTLGRM--LTTILRNENVMGLYSGLSAAVLR 73

Query: 85  WILMDSVMLGC--LHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKA 142
                +V  G   L    ++ + ++      LP S  + SG + G   +F          
Sbjct: 74  QCTYTTVRFGAYDLMKENLIPQGHINDMVYLLPCS--MFSGAIGGLVGNFADV------V 125

Query: 143 KLQVQYDAQTT-----RYRGPLDVIKKVYAAD-GIRGMYKG----LVSTLIFRTHFVYWW 192
            +++Q D+         YR  +D + K+Y  + GI+ +  G    +V  ++     V  +
Sbjct: 126 NIRMQNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVRGVLMTASQVVTY 185

Query: 193 GSYE--LLTRWF----KANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKY 246
             ++  L+T+      K +T+LS + +                  P+DVIK  I+   K 
Sbjct: 186 DVFKNYLVTKLSFDPKKNSTHLSASLL--------AGLVATTICSPADVIKTRIMNAHKT 237

Query: 247 DGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFP 282
           +    S     +   +  G    F+G++P F R  P
Sbjct: 238 ES--ESAIKILTSAIKKEGPSFMFRGWLPIFTRLGP 271

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 34.3 bits (77), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 55/146 (37%), Gaps = 6/146 (4%)

Query: 38  PFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLH 97
           P D +K R+Q  + T   KG +    Q +  +G      GF P L+G+ L  S   G   
Sbjct: 33  PIDVVKTRIQL-EPTVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGYE 91

Query: 98  NYRMLLKKYV-YQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYR 156
            ++ L    + Y        S  I S  +A +       P+E  + +L     +Q T   
Sbjct: 92  VFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLV----SQPTFAN 147

Query: 157 GPLDVIKKVYAADGIRGMYKGLVSTL 182
           G +    ++   +G    Y G    L
Sbjct: 148 GLVGGFSRILKEEGAGSFYNGFTPIL 173

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 54/287 (18%), Positives = 102/287 (35%), Gaps = 25/287 (8%)

Query: 14  EAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRG 73
           ++ S ++   SG  +G + +    P DT+K RLQ     G F              G +G
Sbjct: 2   DSSSFLVSLASGAAAGTSTDLAFFPIDTLKTRLQAK---GGF----------FANGGYKG 48

Query: 74  FYLGFTPPLVGWILMDSVMLGCLHNYRM----LLKKYVYQHEEKLPLSGCILSGVLAGWS 129
            Y G    ++      S+      + ++    ++ KYV  + +       + S  +   S
Sbjct: 49  VYRGLGSAVIASAPSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLSHMFSSSIGEVS 108

Query: 130 VSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFV 189
              +  P E+ K + Q       + ++    +++       +R +Y+G  +T++    F 
Sbjct: 109 ACLVRVPAEVIKQRTQTH--KTNSSWQTFTKILQNENGEGVLRNLYRGWNTTIMREIPFT 166

Query: 190 -YWWGSYELLTR-WFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYD 247
              +  YE L + W K N                          P DV+K  ++ + K  
Sbjct: 167 CIQFPLYEFLKKTWAKRNGQDHVAPWQGSVCGSVAGAIAAATTTPLDVLKTRLMLSHKSI 226

Query: 248 GSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFV 294
              +     A +I+   G + FF G  P  +      A  L  +E V
Sbjct: 227 PVAQ----LAKNIYAEEGFKVFFSGVGPRTMWISAGGAIFLGVYETV 269

>Scas_696.9
          Length = 312

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 64/290 (22%), Positives = 121/290 (41%), Gaps = 34/290 (11%)

Query: 6   DSNAVVPNEAYSRMMGFVSGMFSGIAKN-----AVGHPFDTIKVRLQTSQDTGRFKGPLD 60
            S AV P     R + F S +  G   N     ++G P + +K  +  +++   F   + 
Sbjct: 2   SSTAVQPQSPKKRSINF-SNIILGATINMAEVTSLGQPLEVVKTTMAANRNL-NFVNSMK 59

Query: 61  CVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCI 120
            V+    + GI GFY G  P    W  +++   G +  +     +Y ++       +  I
Sbjct: 60  YVWS---RGGIVGFYQGLIP----WAWIEASTKGAVLLFVSAESEYRFKLLGMGNFTSGI 112

Query: 121 LSGVLAGWSVSFIA-------APVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRG 173
           L GVL G + S++          VE+ + K      +     +   +V + +YA +G+RG
Sbjct: 113 LGGVLGGVTQSYLTMGFCTCMKTVEITRLK----SASAGAPVQSSWNVFRSIYAKEGLRG 168

Query: 174 MYKGLVSTLIFR-THFVYWWGSYELLTRWFKANTNLS--DTAINXXXXXXXXXXXXXXXA 230
           +YKG+ +  I + T++   +G   L+  W +  T  +  +  +N               A
Sbjct: 169 IYKGVNAVAIRQMTNWGSRFGFSRLVEDWVRKATGKTKPEDRLNAWEKIGATAVGGGLSA 228

Query: 231 Y--PSDVIKQVILCNDKYDGSLRSWRNAASD---IWRTRGIRGFFKGFVP 275
           +  P +VI+ V + + K D +       A     I +T G++G ++G  P
Sbjct: 229 WNQPIEVIR-VEMQSKKEDPNRPKNLTVAKTFKYIMKTNGVKGLYRGVTP 277

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 61/167 (36%), Gaps = 31/167 (18%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKG--PLDCVYQTMRQQGIRGFYLGFT 79
            + G F G+       P D +K R+Q  +    +K    +D   Q  R         G  
Sbjct: 14  LIGGFFGGLTSAVALQPLDLLKTRIQQDKKATLWKNLKEIDSPLQLWR---------GTL 64

Query: 80  PPLVGWILMDSVMLGCLHNYRMLLKK-------------YVYQHEEKLP---LSGCILSG 123
           P  +   +  ++ L CL+  R  L K              VY     LP   +   +L+G
Sbjct: 65  PSALRTSIGSALYLSCLNLMRSSLAKRRNAVPSLTNDSNIVYNKSSSLPRLTMYENLLTG 124

Query: 124 VLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADG 170
             A   V +I  P+ + K    V+Y++    Y    + I  +Y  +G
Sbjct: 125 AFARGLVGYITMPITVIK----VRYESTLYNYSSLKEAITHIYTKEG 167

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 32.0 bits (71), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 15/68 (22%), Positives = 32/68 (47%), Gaps = 1/68 (1%)

Query: 21  GFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPL-DCVYQTMRQQGIRGFYLGFT 79
            F+ G    +A     +P+ T+K R+   Q+  + +  +   + + +++ G+ G Y G  
Sbjct: 200 AFLLGAIGKLAATGTTYPYITLKTRMHLMQNDPKHQKSMWSLIVEIVKKDGVSGLYNGVA 259

Query: 80  PPLVGWIL 87
             LV  I+
Sbjct: 260 VKLVQSIM 267

 Score = 31.6 bits (70), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 6/74 (8%)

Query: 121 LSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVS 180
           ++G L G +   +  P+      LQ + +      R  L+ IK++Y  +GI G + GL S
Sbjct: 16  IAGSLGGAASIAVTYPLVTITTNLQTKEN----EARPKLETIKEIYNKNGIIGYFLGLES 71

Query: 181 TL--IFRTHFVYWW 192
            +  +  T+FVY++
Sbjct: 72  AVYGMATTNFVYYY 85

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 31.2 bits (69), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 60/284 (21%), Positives = 99/284 (34%), Gaps = 34/284 (11%)

Query: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPP 81
            VSG  +G + +    P DT+K RLQ     G F              G +G Y G    
Sbjct: 10  LVSGAAAGTSTDLAFFPIDTLKTRLQAK---GGF----------FANGGYKGVYRGLGSA 56

Query: 82  LVG--------WILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFI 133
           +V         ++  DS+          LL K   Q  + L     ++S      S   +
Sbjct: 57  VVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTL---SHMVSSSFGEISACMV 113

Query: 134 AAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGI-RGMYKGLVSTLIFRTHFV-YW 191
             P E+ K + Q     +T      L  + +    +G+ R +Y+G  +T++    F    
Sbjct: 114 RVPAEVIKQRTQTH---RTNSSLQTLQALLRNENGEGLRRNLYRGWSTTIMREIPFTCIQ 170

Query: 192 WGSYELL-TRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQVILCNDKYDGSL 250
           +  YE +  RW +                            P DV+K  I+ + K   +L
Sbjct: 171 FPLYEYMKKRWAEVQGKERAAPWQGSVCGCIAGGIAAAATTPLDVLKTRIMLHHKSVSAL 230

Query: 251 RSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFV 294
               + A  + +  G++ FF G  P  +      A  L  +E V
Sbjct: 231 ----HLAKTMLQEEGVKVFFSGVGPRTMWISAGGAIFLGVYETV 270

>Sklu_1982.3 YDL238C, Contig c1982 3793-5223
          Length = 476

 Score = 31.2 bits (69), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 19/35 (54%)

Query: 246 YDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRS 280
           YD SL+ W     D +R +G   FF GFV + + +
Sbjct: 60  YDASLKPWEIGVVDTFREQGSTFFFPGFVDTHVHA 94

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 34/182 (18%), Positives = 67/182 (36%), Gaps = 21/182 (11%)

Query: 121 LSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYR-GPLDVIKKVYAADGIRGMYKGLV 179
           L+G +   +      P+++ K ++Q++      +Y  G +   +K+   +G   +  G  
Sbjct: 20  LAGAIGCGATHSAMVPIDVVKTRIQLE----PLKYSSGMVGSFRKIVGEEGAAALLTGFG 75

Query: 180 STLI-FRTHFVYWWGSYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIKQ 238
            TL+ +     + +G YE+  + F         A+                A  ++    
Sbjct: 76  PTLLGYSMQGAFKFGGYEVFKKAFV-------DALGYETACQYRTPIYIGSAAIAEFFAD 128

Query: 239 VILCNDKYDG----SLRSWRNAA----SDIWRTRGIRGFFKGFVPSFLRSFPANAAALAS 290
           + LC  +       S  ++ N      + I +  GI  F+ GF P   +  P N A    
Sbjct: 129 IALCPLEATRIRLVSQPTFANGLVGGFARILKEEGIGSFYNGFTPILFKQIPYNIAKFVV 188

Query: 291 FE 292
           FE
Sbjct: 189 FE 190

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 60/292 (20%), Positives = 103/292 (35%), Gaps = 46/292 (15%)

Query: 19  MMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGF 78
           ++  +SG  +G + + V  P DT+K RLQ     G F           R  G RG Y G 
Sbjct: 6   LISLLSGAAAGTSTDLVFFPIDTLKTRLQAK---GGF----------FRNGGYRGVYRGL 52

Query: 79  TPPLVG--------WILMDSVMLGCLHNYRMLLKKY----VYQHEEKLPLSGCILSGVLA 126
              +V         +I  D+        +R LL       V  H         + S  + 
Sbjct: 53  GSAVVASAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVTH---------MFSSSMG 103

Query: 127 GWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRT 186
             +   +  P E+ K + Q    A  + +    +++K        R +Y+G  +T++   
Sbjct: 104 EIAACMVRVPAEVVKQRSQTH--ASHSSWETLREILKNENGEGVRRNLYRGWSTTIMREI 161

Query: 187 HFV-YWWGSYELLTR-WFKANTNLSDTAINXXXXXXXXXXXXXXXAYPSDVIK-QVILCN 243
            F    +  YE + + W + + +                        P D +K +++LC 
Sbjct: 162 PFTCIQFPLYEYMKKVWAELDESDRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRLMLCK 221

Query: 244 DKYD-GSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFV 294
                G+L       S I++  G + FF G  P  +      A  L  +E V
Sbjct: 222 KSIPLGTL------VSTIYKEEGFKVFFSGVGPRTMWISAGGAIFLGIYETV 267

>Scas_558.2
          Length = 289

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 39/85 (45%), Gaps = 5/85 (5%)

Query: 21  GFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTP 80
           G + G  +G    A   P D +K RL  ++D+   K  +  +Y   +++G + F+ G  P
Sbjct: 199 GAICGSIAGGIAAATTTPLDFLKTRLMLNKDSIPIKSLIRNIY---KEEGFKIFFSGIYP 255

Query: 81  PLVGWILM-DSVMLGCLHNYRMLLK 104
             + WI    ++ LG       +L+
Sbjct: 256 RTM-WISAGGAIFLGVYETMHFMLQ 279

 Score = 29.6 bits (65), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 36/181 (19%), Positives = 71/181 (39%), Gaps = 29/181 (16%)

Query: 19  MMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGF 78
           +M  +SG  +G + + V  P DT+K RLQ     G F           +  G  G Y G 
Sbjct: 7   VMSLLSGAAAGTSTDLVFFPIDTLKTRLQAK---GGF----------FQNGGYHGIYRGL 53

Query: 79  TPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGC-----------ILSGVLAG 127
              +V      S+      + ++ ++ +V   E  +  SG            +++  +  
Sbjct: 54  GSAVVASAPSASLFFVTYDSMKVRVRPHV---ERVINSSGTRSPHSVDTIVHMIASSMGE 110

Query: 128 WSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTH 187
            +   +  P E+ K + QV   +  + ++    ++K       IR +Y+G  +T++    
Sbjct: 111 LAACLVRVPAEVIKQRTQVH--STNSSWQTFRTILKNENQEGIIRNLYRGWSTTIMREIP 168

Query: 188 F 188
           F
Sbjct: 169 F 169

>Kwal_27.9912
          Length = 266

 Score = 29.6 bits (65), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 139 LAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYWWGSY 195
           LA+   + +Y AQ  +   P + +    A+D + GM KG ++  I +T  + WW ++
Sbjct: 96  LAQVLSEGKYLAQKDKPETPANPLTDPNASDAMMGMVKGNLANYIPQT-LIMWWVNH 151

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 29.3 bits (64), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 35/173 (20%), Positives = 68/173 (39%), Gaps = 21/173 (12%)

Query: 35  VGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLG 94
           +G P + +K  +   ++       L        + GI GFY G  P    W  +++   G
Sbjct: 29  LGQPLEVVKTTMAAHREFNF----LQATKHVWSRGGIFGFYQGLIP----WAWIEASTKG 80

Query: 95  CLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIA-------APVELAKAKLQVQ 147
            +  +     +Y ++          I+ G+  G + +++          VE+ + K    
Sbjct: 81  AVLLFVSAEAEYRFKVLGLNNFGAGIMGGITGGVTQAYLTMGFCTCMKTVEITRQKAA-- 138

Query: 148 YDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYWWGSYELLTR 200
            +      +    V K +Y  +GIRG+ KG+ +  I +   +  WGS   L+R
Sbjct: 139 -NVPGVIPQSSWQVFKSIYKKEGIRGINKGVNAVAIRQ---MTNWGSRFGLSR 187

>Kwal_23.5757
          Length = 307

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 37/179 (20%), Positives = 68/179 (37%), Gaps = 13/179 (7%)

Query: 38  PFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLH 97
           P++ IKVR QT+      +   D   + +  +G    Y G TP     I           
Sbjct: 136 PWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFE 195

Query: 98  NYRMLLKKYVYQHEEKLPLSGCI----LSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTT 153
               ++   +   + ++   G I      G LAG   + ++ P ++  +K+  +  +  +
Sbjct: 196 RIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGES 255

Query: 154 RYRGPLDVIKKVYAADGIRGMYKGL-VSTLIFRTHFVYWWGSYELLTRWFKANTNLSDT 211
                L    ++Y   G  G++ GL V  L+  T   + W    L+   FKA   L  +
Sbjct: 256 T----LQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQW----LIYDSFKAAAGLPTS 306

>Kwal_0.232
          Length = 274

 Score = 28.5 bits (62), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 41/195 (21%), Positives = 76/195 (38%), Gaps = 31/195 (15%)

Query: 120 ILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLV 179
           +L+G  AG S      P++  K +LQ                    +A  G  G+Y+GL 
Sbjct: 10  LLAGAAAGTSTDLFFFPIDTLKTRLQAA---------------GGFFANGGYLGVYRGLG 54

Query: 180 STLIFRT-----HFVYWWG----SYELLTRWFKANTNLSDTAINXXXXXXXXXXXXXXXA 230
           S ++         FV + G    S  +      ++  +++TA +                
Sbjct: 55  SAVVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSSSAGEIAACMVRV 114

Query: 231 YPSDVIKQVILCNDKYDGSLRSWRNAASDIWRTRGI-RGFFKGFVPSFLRSFPANAAALA 289
            P++VIKQ    + K D SL++ +    +     GI R  ++G+  + +R  P       
Sbjct: 115 -PAEVIKQRTQTH-KSDSSLQTLKKLLQN-ENGEGIRRNLYRGWSTTVMREIPFTCIQFP 171

Query: 290 SFEFVLR---VSGAK 301
            +EF+ +   +SG +
Sbjct: 172 LYEFLKKQWAISGGR 186

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.138    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,789,903
Number of extensions: 335653
Number of successful extensions: 2254
Number of sequences better than 10.0: 210
Number of HSP's gapped: 1503
Number of HSP's successfully gapped: 480
Length of query: 301
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 200
Effective length of database: 13,099,691
Effective search space: 2619938200
Effective search space used: 2619938200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 61 (28.1 bits)