Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_33.1544423122912141e-172
Scas_647.42702181475e-11
YJR011C2611011103e-06
AGR326C20290830.007
YFL013C (IES1)69258710.43
Scas_711.20591126652.1
AEL239W55194634.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.15444
         (229 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.15444                                                         472   e-172
Scas_647.4                                                             61   5e-11
YJR011C (YJR011C) [2914] chr10 complement(458555..459340) Protei...    47   3e-06
AGR326C [4637] [Homologous to ScYJR011C - SH] (1338045..1338653)...    37   0.007
YFL013C (IES1) [1669] chr6 complement(107846..109924) Protein wi...    32   0.43 
Scas_711.20                                                            30   2.1  
AEL239W [2267] [Homologous to ScYPL070W - SH] complement(187447....    29   4.5  

>Kwal_33.15444
          Length = 231

 Score =  472 bits (1214), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 229/229 (100%), Positives = 229/229 (100%)

Query: 1   MSSETPKSEFEEELLDCATIIERYIVSLVNVAYYVCYHKLNEEAAEPVSSDKQTVFRTVR 60
           MSSETPKSEFEEELLDCATIIERYIVSLVNVAYYVCYHKLNEEAAEPVSSDKQTVFRTVR
Sbjct: 1   MSSETPKSEFEEELLDCATIIERYIVSLVNVAYYVCYHKLNEEAAEPVSSDKQTVFRTVR 60

Query: 61  DKLLFLAVRTEKITSSKSSGAADIKSLLSREFLRELYYCSNAVSTELYEIMERITSGSDG 120
           DKLLFLAVRTEKITSSKSSGAADIKSLLSREFLRELYYCSNAVSTELYEIMERITSGSDG
Sbjct: 61  DKLLFLAVRTEKITSSKSSGAADIKSLLSREFLRELYYCSNAVSTELYEIMERITSGSDG 120

Query: 121 EYEAPMKLTKVPTHLKNCILGFVQIFHFFRKLPIQEQYQISKLQMRVLELELKTDLLGPW 180
           EYEAPMKLTKVPTHLKNCILGFVQIFHFFRKLPIQEQYQISKLQMRVLELELKTDLLGPW
Sbjct: 121 EYEAPMKLTKVPTHLKNCILGFVQIFHFFRKLPIQEQYQISKLQMRVLELELKTDLLGPW 180

Query: 181 TRQVETLHSTIGWILLSDPHFRNKLDEYKIKVQSDPEVPVFNEWLRNEI 229
           TRQVETLHSTIGWILLSDPHFRNKLDEYKIKVQSDPEVPVFNEWLRNEI
Sbjct: 181 TRQVETLHSTIGWILLSDPHFRNKLDEYKIKVQSDPEVPVFNEWLRNEI 229

>Scas_647.4
          Length = 270

 Score = 61.2 bits (147), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 97/218 (44%), Gaps = 25/218 (11%)

Query: 24  YIVSLVNVAYYVCYHKLNEEAAEPVSSDKQTVFRTVRDKLLFLAVRT--------EKITS 75
           Y+  L+   YYV      EE  +  +++K      ++ +L  L V+         ++   
Sbjct: 60  YMTDLIYTLYYVANT---EENMQEKNTEKSDALLNLKTELCSLVVKLRTRFRNLLDECDL 116

Query: 76  SKSSGAADIKSLLSREFLRELYYCSNAVSTELYEIMERITSGSDGEYEAPMKLTKVPTHL 135
           +        ++L+ +  +  LY  ++ ++ EL E+     S  +G          +   L
Sbjct: 117 NDPETPIVFRNLIDKNIISILYQVNDILTNELGELSNDHDSNFNG----------LIIQL 166

Query: 136 KNCILGFVQIFHFFRKLPIQEQYQISKLQMRVLELELKTDLLGPWTRQVETLHSTIGWIL 195
           +NC  GF  +F+F +K+P+Q QY+++ LQ+ VL   ++ DLL  W  Q++ L+  +   L
Sbjct: 167 QNCFNGFGNLFNFVKKMPLQRQYKVTSLQLDVLITVVRNDLLPTWKTQLDLLNCKLFDDL 226

Query: 196 LSDPH----FRNKLDEYKIKVQSDPEVPVFNEWLRNEI 229
             + +    +R   ++    V+       F  WL+ EI
Sbjct: 227 SRNQNVVSRYREATNDRDSDVKEGESFVKFVNWLKEEI 264

>YJR011C (YJR011C) [2914] chr10 complement(458555..459340) Protein
           of unknown function [786 bp, 261 aa]
          Length = 261

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 54/101 (53%), Gaps = 5/101 (4%)

Query: 134 HLKNCILGFVQIFHFFRKLPI-QEQYQISKLQMRVLELELKTDLLGPWTRQVETLHSTIG 192
            ++NC+ GFV ++ F  K+P+ ++Q Q++ LQM++L   L+ +LL  W  Q++ L+  + 
Sbjct: 155 QMQNCLSGFVNLYKFLNKIPMSKQQSQMNDLQMKILVNVLQNELLPIWKFQLDLLNCKLF 214

Query: 193 WILLSDPH----FRNKLDEYKIKVQSDPEVPVFNEWLRNEI 229
             L  D      +R   ++  I V        +  WL+++I
Sbjct: 215 NELSKDKGLINIYRKATNDSVIDVSKGEPFIRYVNWLKDQI 255

>AGR326C [4637] [Homologous to ScYJR011C - SH] (1338045..1338653)
           [609 bp, 202 aa]
          Length = 202

 Score = 36.6 bits (83), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 41/90 (45%), Gaps = 5/90 (5%)

Query: 99  CSNAVSTELYEIMERITSGSDGEYEAPMKLTKVPTHLKNCILGFVQIFHFFRKLPI---Q 155
           C   +   + + + RI      + +   K T++   L NC  GFV    F RKLP+   Q
Sbjct: 80  CRGVIDRPMLQGLGRIKDKMQAQLQVA-KETRLVNVLANCYNGFVHTLQFMRKLPVGNGQ 138

Query: 156 EQYQISKLQMRVLELELKTDLLGPWTRQVE 185
             Y+I   Q +VL L+ +  +   W  Q++
Sbjct: 139 VSYEIPAHQWKVL-LDEQESMNSNWKAQLK 167

>YFL013C (IES1) [1669] chr6 complement(107846..109924) Protein with
           weak similarity to Ifh1p and Nab3p [2079 bp, 692 aa]
          Length = 692

 Score = 32.0 bits (71), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 121 EYEAPMKLTKVPTHLKNCILGFVQIFHFFRKLPIQEQYQISKLQMRVLELELKTDLLG 178
           E+ A +K ++VP  LK   +G ++IF+ F  +P+     I   + +    + K +LLG
Sbjct: 602 EFLADLKKSQVPNRLKRRDIGLIKIFNEFEDIPVASVLGIRGKKRK----KFKDNLLG 655

>Scas_711.20
          Length = 591

 Score = 29.6 bits (65), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 57/126 (45%), Gaps = 22/126 (17%)

Query: 15  LDCATIIERYIVSLVNVAYYVCYHKLNEEAAEPVSSDKQTVFRTVRDKLLFLAVRTEKIT 74
           +D + + ER + S  N   ++ Y +  ++  +   +   T +RT+    L L++ TE   
Sbjct: 6   IDRSVVAERPVTS--NTYDWLQYRESIDQNQQGRRTSYGTFYRTLSSHSLPLSIFTEDAN 63

Query: 75  SSKSSGAADIKSLLSR------------------EFLRELYYCSNAVSTELYEIMERITS 116
           + K+    DI+  + R                  EFL  + +C N+++  + E++ RI +
Sbjct: 64  TIKTE-VYDIQLSVFRPVTGYPSRPLKNPKSEEAEFLAIVQHCRNSINRNVKELV-RIKT 121

Query: 117 GSDGEY 122
           GS G Y
Sbjct: 122 GSSGSY 127

>AEL239W [2267] [Homologous to ScYPL070W - SH]
           complement(187447..189102) [1656 bp, 551 aa]
          Length = 551

 Score = 28.9 bits (63), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 43/94 (45%), Gaps = 7/94 (7%)

Query: 131 VPTHLKNCILGFVQIFHFFRKLPIQEQYQISKLQMRVLELELKTDLLGPWTRQVETLHST 190
            P H     + F+++F + RKL   EQY ++ +   +  LE  T    P T +     S 
Sbjct: 336 TPVHTLYLNVQFIKLFRYSRKLMGSEQYAVTNMTAALYFLENLTINDLPGTAKGHAKPSD 395

Query: 191 IGWILLSDPHFRNKLDEYKIKVQSDPEVPVFNEW 224
           I   +LS    R KL +  I  Q+ PE+P  N +
Sbjct: 396 I--FVLS---HRVKLPD--ISRQAKPELPRTNSY 422

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,212,650
Number of extensions: 279666
Number of successful extensions: 799
Number of sequences better than 10.0: 16
Number of HSP's gapped: 799
Number of HSP's successfully gapped: 16
Length of query: 229
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 131
Effective length of database: 13,203,545
Effective search space: 1729664395
Effective search space used: 1729664395
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)