Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_33.1543858057230290.0
Sklu_2014.363156518760.0
Scas_617.558157117450.0
YGR194C (XKS1)60057716860.0
KLLA0E09746g58057216780.0
CAGL0G09339g58257115630.0
AGR324C56456815190.0
YHL032C (GUT1)709136780.25
ACL069C644136740.61
YLR454W2628133740.88
Scas_712.1070853657.4
KLLA0B07161g55388649.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.15438
         (572 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.15438                                                        1171   0.0  
Sklu_2014.3 YGR194C, Contig c2014 3590-5485 reverse complement        727   0.0  
Scas_617.5                                                            676   0.0  
YGR194C (XKS1) [2144] chr7 complement(886076..887878) Xylulokina...   654   0.0  
KLLA0E09746g 863295..865037 similar to sp|P42826 Saccharomyces c...   650   0.0  
CAGL0G09339g 891248..892996 similar to sp|P42826 Saccharomyces c...   606   0.0  
AGR324C [4635] [Homologous to ScYGR194C (XKS1) - SH] (1335916..1...   589   0.0  
YHL032C (GUT1) [2254] chr8 complement(36377..38506) Glycerol kin...    35   0.25 
ACL069C [980] [Homologous to ScYHL032C (GUT1) - SH] (232439..234...    33   0.61 
YLR454W (YLR454W) [3828] chr12 (1043995..1051881) Protein of unk...    33   0.88 
Scas_712.10                                                            30   7.4  
KLLA0B07161g complement(621391..623052) similar to sp|P38222 Sac...    29   9.4  

>Kwal_33.15438
          Length = 580

 Score = 1171 bits (3029), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/572 (97%), Positives = 560/572 (97%)

Query: 1   MASHPKANYLGFDLSTQQLKCLVIDQDLKLLHSESIEFDKDLSSYKTEKGVYLRDDGTVE 60
           MASHPKANYLGFDLSTQQLKCLVIDQDLKLLHSESIEFDKDLSSYKTEKGVYLRDDGTVE
Sbjct: 1   MASHPKANYLGFDLSTQQLKCLVIDQDLKLLHSESIEFDKDLSSYKTEKGVYLRDDGTVE 60

Query: 61  CPVAMWLEALDLVFQRMSENKDVDLGSVRAMSGSCQQHGSVYWAEEGPKLLPTLDFKQSL 120
           CPVAMWLEALDLVFQRMSENKDVDLGSVRAMSGSCQQHGSVYWAEEGPKLLPTLDFKQSL
Sbjct: 61  CPVAMWLEALDLVFQRMSENKDVDLGSVRAMSGSCQQHGSVYWAEEGPKLLPTLDFKQSL 120

Query: 121 KDQLFPDAFSRSVAPNWQDHSTGSECQQFEDSVGGPVELARLTGSRAHHRFTGPQMMKIS 180
           KDQLFPDAFSRSVAPNWQDHSTGSECQQFEDSVGGPVELARLTGSRAHHRFTGPQMMKIS
Sbjct: 121 KDQLFPDAFSRSVAPNWQDHSTGSECQQFEDSVGGPVELARLTGSRAHHRFTGPQMMKIS 180

Query: 181 KKEPEVYRKTAKIXXXXXXXXXXXXGEFTSLEEADACGMNLYNIDKRDYEDNLLRNIDDD 240
           KKEPEVYRKTAKI            GEFTSLEEADACGMNLYNIDKRDYEDNLLRNIDDD
Sbjct: 181 KKEPEVYRKTAKISLVSSFLASVLAGEFTSLEEADACGMNLYNIDKRDYEDNLLRNIDDD 240

Query: 241 LSGLREKLGGAPINCDKPTPVGSISSYFVQKYGLNADCQVFPFTGDNLATICSLRLKPND 300
           LSGLREKLGGAPINCDKPTPVGSISSYFVQKYGLNADCQVFPFTGDNLATICSLRLKPND
Sbjct: 241 LSGLREKLGGAPINCDKPTPVGSISSYFVQKYGLNADCQVFPFTGDNLATICSLRLKPND 300

Query: 301 VLVSLGTSTTILLVTDQYHPSPNYHLFIHPTIPKHYMGMICYCNGALAREKIRDQLSDSH 360
           VLVSLGTSTTILLVTDQYHPSPNYHLFIHPTIPKHYMGMICYCNGALAREKIRDQLSDSH
Sbjct: 301 VLVSLGTSTTILLVTDQYHPSPNYHLFIHPTIPKHYMGMICYCNGALAREKIRDQLSDSH 360

Query: 361 DWEPFNAAVTSTTIENDNEIACYFPLGEIVPNVPSVCRRATFEKSETGDSVKLNILESFA 420
           DWEPFNAAVTSTTIENDNEIACYFPLGEIVPNVPSVCRRATFEKSETGDSVKLNILESFA
Sbjct: 361 DWEPFNAAVTSTTIENDNEIACYFPLGEIVPNVPSVCRRATFEKSETGDSVKLNILESFA 420

Query: 421 NVAHDARNIVESQALSCRVRISPLLSSDCTDTNSEMGDSKVLFDYDNFPLSEYRKRPRRA 480
           NVAHDARNIVESQALSCRVRISPLLSSDCTDTNSEMGDSKVLFDYDNFPLSEYRKRPRRA
Sbjct: 421 NVAHDARNIVESQALSCRVRISPLLSSDCTDTNSEMGDSKVLFDYDNFPLSEYRKRPRRA 480

Query: 481 FFVGGASKNDAIVNLFAQVLGATDGNFRLETPNSCALGGCYRALWSHLHYSNLISSPFDQ 540
           FFVGGASKNDAIVNLFAQVLGATDGNFRLETPNSCALGGCYRALWSHLHYSNLISSPFDQ
Sbjct: 481 FFVGGASKNDAIVNLFAQVLGATDGNFRLETPNSCALGGCYRALWSHLHYSNLISSPFDQ 540

Query: 541 FLNEAFRWDFDVQSLGLTDEKDWKHYNTKIQA 572
           FLNEAFRWDFDVQSLGLTDEKDWKHYNTKIQA
Sbjct: 541 FLNEAFRWDFDVQSLGLTDEKDWKHYNTKIQA 572

>Sklu_2014.3 YGR194C, Contig c2014 3590-5485 reverse complement
          Length = 631

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/565 (60%), Positives = 424/565 (75%), Gaps = 3/565 (0%)

Query: 9   YLGFDLSTQQLKCLVIDQDLKLLHSESIEFDKDLSSYKTEKGVYLRDDGTVECPVAMWLE 68
           +LGFDLSTQQLKCLV+DQ L+L+HSE ++FD+DL  Y T KGVY  DDG++E PVAMW +
Sbjct: 60  FLGFDLSTQQLKCLVVDQQLQLVHSEVVDFDRDLPEYHTHKGVYFNDDGSIEAPVAMWCD 119

Query: 69  ALDLVFQRMSENKDVDLGSVRAMSGSCQQHGSVYWAEEGPKLLPTLDFKQSLKDQLFPDA 128
           ALD +F  ++      L  V  +SGSCQQHGSVYW+++G + L  LD +Q+L  QL P A
Sbjct: 120 ALDHLFAGLANQNVFSLDRVLGISGSCQQHGSVYWSKDGEEALRNLDAQQTLLTQLAPKA 179

Query: 129 FSRSVAPNWQDHSTGSECQQFEDSVGGPVELARLTGSRAHHRFTGPQMMKISKKEPEVYR 188
           FSRSVAPNWQDHSTG+EC+ FE S GGP  LA +TGSRAH+RFTGPQ+ K++ +EPEVY 
Sbjct: 180 FSRSVAPNWQDHSTGNECKLFESSCGGPQGLAAITGSRAHYRFTGPQICKVAHREPEVYA 239

Query: 189 KTAKIXXXXXXXXXXXXGEFTSLEEADACGMNLYNIDKRDYEDNLLRNIDDDLSGLREKL 248
            TA I            G    LEEADACGMNLY+I  RDY+  LL+NID D+  ++ KL
Sbjct: 240 NTANITLVSNFLASLLCGYIAPLEEADACGMNLYDIVNRDYDSGLLQNIDPDVESIKRKL 299

Query: 249 GGAPINCDKPTPVGSISSYFVQKYGLNADCQVFPFTGDNLATICSLRLKPNDVLVSLGTS 308
            G+P   D   P+  +SSY+V++YGLN  CQVFPFTGDNLATICSL LK NDVLVSLGTS
Sbjct: 300 KGSPTPADNAGPLSCVSSYYVRRYGLNPQCQVFPFTGDNLATICSLPLKKNDVLVSLGTS 359

Query: 309 TTILLVTDQYHPSPNYHLFIHPTIPKHYMGMICYCNGALAREKIRDQLSDSHDWEPFNAA 368
           TTIL+VTDQY+PSPNYHLFIHPTIP  YMGMICYCNG+LARE +RD LS  H W+PFN A
Sbjct: 360 TTILIVTDQYYPSPNYHLFIHPTIPGLYMGMICYCNGSLARENVRDLLSADHSWDPFNKA 419

Query: 369 VTSTTIENDNEIACYFPLGEIVPNVPSVCRRATFEKSETGDSVKLNILESFANVAHDARN 428
           +  ++++N +EI  YFPL EIVP+V S  +RA F KS+  + + L  +E F+++ HD +N
Sbjct: 420 LLDSSVDNHDEIGVYFPLSEIVPSVRSCTKRAKFTKSD--NDINLEPVEQFSDIKHDVKN 477

Query: 429 IVESQALSCRVRISPLLSSDC-TDTNSEMGDSKVLFDYDNFPLSEYRKRPRRAFFVGGAS 487
           IVESQALSCRVRISPLLS +C   +N+      V FDYD FP+SEYRKRPRRAFFVGGAS
Sbjct: 478 IVESQALSCRVRISPLLSDNCAAASNNSSTSYTVKFDYDTFPISEYRKRPRRAFFVGGAS 537

Query: 488 KNDAIVNLFAQVLGATDGNFRLETPNSCALGGCYRALWSHLHYSNLISSPFDQFLNEAFR 547
           +NDAIV  FAQV+GAT+GN++LETPNSCALGGCY+ALWS+++        FD FLNE F 
Sbjct: 538 RNDAIVRTFAQVIGATEGNYKLETPNSCALGGCYKALWSYMYSGGFTKLSFDLFLNEHFD 597

Query: 548 WDFDVQSLGLTDEKDWKHYNTKIQA 572
           W  D + +  ++ + W++YNTKIQA
Sbjct: 598 WQHDAEFICDSETESWEYYNTKIQA 622

>Scas_617.5
          Length = 581

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/571 (59%), Positives = 418/571 (73%), Gaps = 15/571 (2%)

Query: 9   YLGFDLSTQQLKCLVIDQDLKLLHSESIEFDKDLSSYKTEKGVYLRDDGTVECPVAMWLE 68
           YLG DLSTQQLK L I++ L+++ +E+++FDK+L  Y T KGVY+  +  +ECPV MWLE
Sbjct: 7   YLGLDLSTQQLKGLAINETLEIVVTETVDFDKELPHYNTTKGVYINGN-DIECPVGMWLE 65

Query: 69  ALDLVFQRMSENKDVDLGSVRAMSGSCQQHGSVYWAEEGPKLLPTL--DFKQSLKDQLFP 126
           ALDL+F++  + K   L +VRA+SGSCQQHGSVYW++    LL  L  D  +SL   L P
Sbjct: 66  ALDLLFEKFKK-KGFSLNNVRAISGSCQQHGSVYWSQNANTLLKNLGSDTDKSLVSHLIP 124

Query: 127 DAFSRSVAPNWQDHSTGSECQQFEDSVGGPVELARLTGSRAHHRFTGPQMMKISKKEPEV 186
           DAFSR  APNWQDHSTGS+CQ FE  VGGP  LA +TGSRAH RFTGPQ+MKI++KEP  
Sbjct: 125 DAFSRQTAPNWQDHSTGSQCQSFERKVGGPQALAEITGSRAHFRFTGPQIMKIAEKEPGN 184

Query: 187 YRKTAKIXXXXXXXXXXXXGEFTSLEEADACGMNLYNIDKRDYEDNLLRNIDDDLSGLRE 246
           Y  T+ +            GE T LEEAD+CGMNLY+I KR + ++LL  ID +   +R 
Sbjct: 185 YANTSSVSLVSSFITSLLCGELTPLEEADSCGMNLYDIRKRQFNEDLLSLIDSNEDNIRT 244

Query: 247 KLGGAPINCDKPTPVGSISSYFVQKYGLNADCQVFPFTGDNLATICSLRLKPNDVLVSLG 306
           KL   P+ CDKP  +GSIS YFVQKYG N  C +FP TGDNLATICSL LK NDVLVSLG
Sbjct: 245 KLMDPPLKCDKPVRLGSISKYFVQKYGFNPSCSIFPLTGDNLATICSLPLKTNDVLVSLG 304

Query: 307 TSTTILLVTDQYHPSPNYHLFIHPTIPKHYMGMICYCNGALAREKIRDQLSDS---HDWE 363
           TSTTILLVT+QY PSPNYHLFIHPTIP HYMGMICYCNGALAREKIRD+L+++   + W 
Sbjct: 305 TSTTILLVTNQYQPSPNYHLFIHPTIPDHYMGMICYCNGALAREKIRDELNETGEGNSWN 364

Query: 364 PFNAAVTSTTIENDNEIACYFPLGEIVPNVPSVCRRATFEKSETGDSVKLNILESFANVA 423
            FN AV   TI+N +E+  YFPLGEIVP+V ++ +RA F+K+ TG+ +K  I++ FAN  
Sbjct: 365 LFNEAVLDDTIDNSDELGIYFPLGEIVPSVSAIYKRAKFDKA-TGE-IKA-IVDEFANKK 421

Query: 424 HDARNIVESQALSCRVRISPLLSSDCTDTNSEMGDSK---VLFDYDNFPLSEY-RKRPRR 479
           HDA+NIVESQALSCR+RISPLLS +     +EM  ++   V FDY   P+S+Y  KRP R
Sbjct: 422 HDAKNIVESQALSCRIRISPLLSKEGNSNKNEMTSNENGTVKFDYAEIPISDYLSKRPNR 481

Query: 480 AFFVGGASKNDAIVNLFAQVLGATDGNFRLETPNSCALGGCYRALWSHLHYSNLISSPFD 539
           AFFVGGASKNDAIV  FAQ++GA +GN+RLETPNSCALGGCY+A+WS L++       FD
Sbjct: 482 AFFVGGASKNDAIVKKFAQIIGAQEGNYRLETPNSCALGGCYKAIWSQLYHLGETKESFD 541

Query: 540 QFLNEAFRWDFDVQSLGLTDEKDWKHYNTKI 570
            +L++ F W  +V+ +   DEK W+ YN KI
Sbjct: 542 VYLDKHFPWG-EVERICEPDEKAWELYNKKI 571

>YGR194C (XKS1) [2144] chr7 complement(886076..887878) Xylulokinase,
           required for growth on D-xylulose [1803 bp, 600 aa]
          Length = 600

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/577 (57%), Positives = 410/577 (71%), Gaps = 25/577 (4%)

Query: 9   YLGFDLSTQQLKCLVIDQDLKLLHSESIEFDKDLSSYKTEKGVYLRDDGTVECPVAMWLE 68
           YLGFDLSTQQLKCL I+QDLK++HSE++EF+KDL  Y T+KGVY+  D T+ECPVAMWLE
Sbjct: 23  YLGFDLSTQQLKCLAINQDLKIVHSETVEFEKDLPHYHTKKGVYIHGD-TIECPVAMWLE 81

Query: 69  ALDLVFQRMSENKDVDLGSVRAMSGSCQQHGSVYWAEEGPKLLPTLDFKQSLKDQLF--- 125
           ALDLV  +  E K   L  V A+SGSCQQHGSVYW+ +   LL  L+ K+  KD L    
Sbjct: 82  ALDLVLSKYREAK-FPLNKVMAVSGSCQQHGSVYWSSQAESLLEQLN-KKPEKDLLHYVS 139

Query: 126 PDAFSRSVAPNWQDHSTGSECQQFEDSVGGPVELARLTGSRAHHRFTGPQMMKISKKEPE 185
             AF+R  APNWQDHST  +CQ+FE+ +GGP ++A+LTGSRAH RFTGPQ++KI++ EPE
Sbjct: 140 SVAFARQTAPNWQDHSTAKQCQEFEECIGGPEKMAQLTGSRAHFRFTGPQILKIAQLEPE 199

Query: 186 VYRKTAKIXXXXXXXXXXXXGEFTSLEEADACGMNLYNIDKRDYEDNLLRNIDDDLS--G 243
            Y KT  I            G    LEEADACGMNLY+I +R + D LL  ID       
Sbjct: 200 AYEKTKTISLVSNFLTSILVGHLVELEEADACGMNLYDIRERKFSDELLHLIDSSSKDKT 259

Query: 244 LREKLGGAPINCDKPTPVGSISSYFVQKYGLNADCQVFPFTGDNLATICSLRLKPNDVLV 303
           +R+KL  AP+   K    G+I  YF++KYG N +C+V P TGDNLATICSL L+ NDVLV
Sbjct: 260 IRQKLMRAPM---KNLIAGTICKYFIEKYGFNTNCKVSPMTGDNLATICSLPLRKNDVLV 316

Query: 304 SLGTSTTILLVTDQYHPSPNYHLFIHPTIPKHYMGMICYCNGALAREKIRDQLS------ 357
           SLGTSTT+LLVTD+YHPSPNYHLFIHPT+P HYMGMICYCNG+LARE+IRD+L+      
Sbjct: 317 SLGTSTTVLLVTDKYHPSPNYHLFIHPTLPNHYMGMICYCNGSLARERIRDELNKERENN 376

Query: 358 --DSHDWEPFNAAVTSTTIENDNEIACYFPLGEIVPNVPSVCRRATFEKSETGDSVKLNI 415
              ++DW  FN AV   +  ++NE+  YFPLGEIVP+V ++ +R  F   +TG  +    
Sbjct: 377 YEKTNDWTLFNQAVLDDSESSENELGVYFPLGEIVPSVKAINKRVIF-NPKTG--MIERE 433

Query: 416 LESFANVAHDARNIVESQALSCRVRISPLLSSDCTDTNSEMG-DSKVLFDYDNFPLSEY- 473
           +  F +  HDA+NIVESQALSCRVRISPLLS     +   +  D+ V FDYD  PL +Y 
Sbjct: 434 VAKFKDKRHDAKNIVESQALSCRVRISPLLSDSNASSQQRLNEDTIVKFDYDESPLRDYL 493

Query: 474 RKRPRRAFFVGGASKNDAIVNLFAQVLGATDGNFRLETPNSCALGGCYRALWSHLHYSNL 533
            KRP R FFVGGASKNDAIV  FAQV+GAT GNFRLETPNSCALGGCY+A+WS L+ SN 
Sbjct: 494 NKRPERTFFVGGASKNDAIVKKFAQVIGATKGNFRLETPNSCALGGCYKAMWSLLYDSNK 553

Query: 534 ISSPFDQFLNEAFRWDFDVQSLGLTDEKDWKHYNTKI 570
           I+ PFD+FLN+ F W   ++S+   D ++W  YN+KI
Sbjct: 554 IAVPFDKFLNDNFPWHV-MESISDVDNENWDRYNSKI 589

>KLLA0E09746g 863295..865037 similar to sp|P42826 Saccharomyces
           cerevisiae YGR194c XKS1 xylulokinase singleton, start by
           similarity
          Length = 580

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/572 (55%), Positives = 405/572 (70%), Gaps = 17/572 (2%)

Query: 9   YLGFDLSTQQLKCLVIDQDLKLLHSESIEFDKDLSSYKTEKGVYLRDDGTVECPVAMWLE 68
           YLGFDLSTQQLKCL ID  L ++ + +IEFDKD   Y T KGVY++D+G ++ PVAMWLE
Sbjct: 7   YLGFDLSTQQLKCLAIDDQLNIVTTAAIEFDKDFPHYNTRKGVYIKDEGVIDAPVAMWLE 66

Query: 69  ALDLVFQRMSENKDVDLGSVRAMSGSCQQHGSVYW-AEEGPK-LLPTLDFKQSLKDQLFP 126
           A+DL F+R+   K +DL  V++MSGSCQQHG+V+W  +  PK L P+ +  + L      
Sbjct: 67  AIDLCFERLG--KCIDLKKVKSMSGSCQQHGTVFWNCDHLPKDLQPSSNLVKQLAS---- 120

Query: 127 DAFSRSVAPNWQDHSTGSECQQFEDSVGGPVELARLTGSRAHHRFTGPQMMKISKKEPEV 186
             FSR VAPNWQDHST  +C +  D VGGP ELAR+TGS +H+RF+G Q+ K+ + EPEV
Sbjct: 121 -CFSRDVAPNWQDHSTRKQCDELTDKVGGPQELARITGSSSHYRFSGSQIAKVHETEPEV 179

Query: 187 YRKTAKIXXXXXXXXXXXXGEFTSLEEADACGMNLYNIDKRDYEDNLLRNIDDDLSGLRE 246
           Y  T KI            G+   LEEADACGMNLY I+K ++ ++LL  +D+D++ ++ 
Sbjct: 180 YANTKKISLVSSFLASVLVGDIVPLEEADACGMNLYGIEKHEFNEDLLSVVDEDIASIKR 239

Query: 247 KLGGAPINCDKPTPVGSISSYFVQKYGLNADCQVFPFTGDNLATICSLRLKPNDVLVSLG 306
           KL   P + D+P  +G +S+YF +KYG+N DCQ++PFTGDNLATICSL L+ NDVL+SLG
Sbjct: 240 KLFDPPTSSDEPKSLGPVSTYFQEKYGVNPDCQIYPFTGDNLATICSLPLQKNDVLISLG 299

Query: 307 TSTTILLVTDQYHPSPNYHLFIHPTIPKHYMGMICYCNGALAREKIRDQL---SDSHDWE 363
           TSTTILL+TDQYH SPNYHLFIHPT+P HYMGMICYCNG+LAREKIRD +   S +HDW 
Sbjct: 300 TSTTILLITDQYHSSPNYHLFIHPTVPNHYMGMICYCNGSLAREKIRDDINGESQTHDWT 359

Query: 364 PFNAAVTSTTIENDNEIACYFPLGEIVPNVPSVCRRATFEKSETGDSVKLNILESFANVA 423
            FN A+   ++ NDNEI  YFPLGEIVPN+ +V +R  F+  +  + V L  +  F +  
Sbjct: 360 KFNEALLDNSLSNDNEIGLYFPLGEIVPNMDAVTKRCYFKYID--NKVVLTNVNMFPDKR 417

Query: 424 HDARNIVESQALSCRVRISPLLSSDCTDTNSEM---GDSKVLFDYDNFPLSEYRKRPRRA 480
            DA+NIVESQALSCRVRISPLLS +    N       + KV FDYD FPL+ Y KRP RA
Sbjct: 418 LDAKNIVESQALSCRVRISPLLSEEANAINETQVLKSELKVKFDYDFFPLASYAKRPNRA 477

Query: 481 FFVGGASKNDAIVNLFAQVLGATDGNFRLETPNSCALGGCYRALWSHLHYSNLISSPFDQ 540
           FFVGGASKN+AI+   A V+GA +GN+RLET NSCALGGCY+ALWS L   N  +  FD+
Sbjct: 478 FFVGGASKNEAIIKTMANVIGAKNGNYRLETANSCALGGCYKALWSLLKEQNPETPSFDR 537

Query: 541 FLNEAFRWDFDVQSLGLTDEKDWKHYNTKIQA 572
           +LN  F W+ D + +  +D   W++YN KI+ 
Sbjct: 538 WLNAFFNWERDCEFVCNSDAAKWENYNNKIRT 569

>CAGL0G09339g 891248..892996 similar to sp|P42826 Saccharomyces
           cerevisiae YGR194c XKS1 xylulokinase, start by
           similarity
          Length = 582

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/571 (53%), Positives = 391/571 (68%), Gaps = 15/571 (2%)

Query: 9   YLGFDLSTQQLKCLVIDQDLKLLHSESIEFDKDLSSYKTEKGVYLRDDGTVECPVAMWLE 68
           YLG DLSTQQLKCL ID D+++ H+E ++FD+DL  Y T KGVY   D  VECPV MWLE
Sbjct: 7   YLGLDLSTQQLKCLAIDGDMQIKHTEVVDFDRDLPHYNTHKGVYSHGD-VVECPVGMWLE 65

Query: 69  ALDLVFQRMSENKDVDLGSVRAMSGSCQQHGSVYWAEEGPKLLPTL-DFKQSLKDQLFPD 127
           A+DLVF++  +    DL  V+A+SGSCQQHGSVYW      LL  L D   +L DQL+PD
Sbjct: 66  AIDLVFEKY-KGAGFDLSQVKAISGSCQQHGSVYWKTGAGDLLKHLNDANGNLVDQLYPD 124

Query: 128 AFSRSVAPNWQDHSTGSECQQFEDSVGGPVELARLTGSRAHHRFTGPQMMKISKKEPEVY 187
            FSR  APNWQDHSTG +C Q E   GGP +LA +TGSRAH RFTGPQ+MKI++ E + Y
Sbjct: 125 GFSRKTAPNWQDHSTGKQCTQIEKKAGGPEKLAEITGSRAHFRFTGPQIMKIAENEEDNY 184

Query: 188 RKTAKIXXXXXXXXXXXXGEFTSLEEADACGMNLYNIDKRDYEDNLLRNIDDDLSG--LR 245
           + T  I             +   +EEADACGMN+Y+I  + Y+D+LL  I        L 
Sbjct: 185 KNTETISLVSSFLTSILCAKLVPIEEADACGMNIYDIKAKRYDDSLLDVISGKFGKEDLL 244

Query: 246 EKLGGAPINCDKPTPVGSISSYFVQKYGLNADCQVFPFTGDNLATICSLRLKPNDVLVSL 305
           +KL G+   C+ P  +G+I++YFV KYG +++C ++PFTGDNLATICSL L+ ND+LVSL
Sbjct: 245 KKLSGSVTKCNSPQLMGNIANYFVSKYGFDSECAIYPFTGDNLATICSLPLEKNDILVSL 304

Query: 306 GTSTTILLVTDQYHPSPNYHLFIHPTIPKHYMGMICYCNGALAREKIRDQLSD--SHDWE 363
           GTSTTIL+VTDQYHPSPNYHLF HP I   YM MICYCNG+LAREK+RD L++  S  W 
Sbjct: 305 GTSTTILMVTDQYHPSPNYHLFTHPAIANCYMAMICYCNGSLAREKVRDSLNENQSTSWT 364

Query: 364 PFNAAVTSTTIENDNEIACYFPLGEIVPNVPSVCRRATFEKSETGDSVKLNILESFANVA 423
            F+ AV   +++   E+A YFPLGEIVP+V ++ +R  ++  +  + VK   ++ F N  
Sbjct: 365 NFDEAVLDESLDTSGELAVYFPLGEIVPSVDAITKRVLYD-PKNCEIVKY--VDKFDNNR 421

Query: 424 HDARNIVESQALSCRVRISPLLSSDCTDTNSEMGDSKVLFDYDNFPLSEY-RKRPRRAFF 482
           HDA+ IVESQALS RVR++PLLS    ++N E  ++ V FDYD+   SEY  KRP R +F
Sbjct: 422 HDAKIIVESQALSARVRVAPLLSGTVDESNDEKSETMVHFDYDSMKFSEYSSKRPNRVYF 481

Query: 483 VGGASKNDAIVNLFAQVLGATDGNFRLETPNSCALGGCYRALWSHLHYSNLISSP--FDQ 540
           VGGASKNDAIV  F++VLGA +GNFRLETPNSCALGGC++ALWS L     I     FD 
Sbjct: 482 VGGASKNDAIVKKFSEVLGAKNGNFRLETPNSCALGGCFKALWSDLWKKKKIDEKVTFDS 541

Query: 541 FLNEAFRWDFDVQSLGLTD-EKDWKHYNTKI 570
           FLN  F  D +++ + + D  K W+ Y  KI
Sbjct: 542 FLNRYFPTD-ELEEIKVDDITKKWEAYKDKI 571

>AGR324C [4635] [Homologous to ScYGR194C (XKS1) - SH]
           (1335916..1337610) [1695 bp, 564 aa]
          Length = 564

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/568 (52%), Positives = 378/568 (66%), Gaps = 22/568 (3%)

Query: 9   YLGFDLSTQQLKCLVIDQDLKLLHSESIEFDKDLSSYKTEKGVYLRDDGTVECPVAMWLE 68
           YLGFDLSTQQLKCL ID+DL +  +  ++FD+DL+ Y+T KGVY R+D  VE PV MWLE
Sbjct: 7   YLGFDLSTQQLKCLAIDEDLAIKCTAVVDFDRDLAGYETVKGVYTREDNVVESPVEMWLE 66

Query: 69  ALDLVFQRMSENKDVDLGSVRAMSGSCQQHGSVYWAEEGPKLLPTLDFKQSLKDQLFPDA 128
           ALDL F+R++  ++VDLG+V A+SGSCQQH SVYW E+    +  LD +  L+ QL P  
Sbjct: 67  ALDLCFERLA--REVDLGAVEAISGSCQQHASVYWTEDVKTRIRELDSRSGLRAQLGP-C 123

Query: 129 FSRSVAPNWQDHSTGSECQQFEDSVGGPVELARLTGSRAHHRFTGPQMMKISKKEPEVYR 188
            SR+ APNWQDHST ++ +QFE   GGP ELA+LTGS+AH RFTG Q+ KI   EP    
Sbjct: 124 LSRANAPNWQDHSTEAQREQFEAHCGGPQELAQLTGSKAHFRFTGLQIKKIRDTEPATLT 183

Query: 189 KTAKIXXXXXXXXXXXXGEFTSLEEADACGMNLYNIDKRDYEDNLLRNIDDDLSGLREKL 248
            T  I            G+    EEADACGM LYNI +  Y + LL+ +DD    L +KL
Sbjct: 184 ATPSISLASSFLASVLVGKLVPPEEADACGMILYNIAQHRYVEGLLQMVDD---ALFDKL 240

Query: 249 GGAPINCDKPTPVGSISSYFVQKYGLNADCQVFPFTGDNLATICSLRLKPNDVLVSLGTS 308
            G P+ CD   P+G++S YF +KYG+N  C ++  TGDNLATICSL L+ ND+LVSLGTS
Sbjct: 241 CGNPVRCDNVRPLGTVSRYFKEKYGINTSCNIYQLTGDNLATICSLPLQKNDLLVSLGTS 300

Query: 309 TTILLVTDQYHPSPNYHLFIHPTIPKHYMGMICYCNGALAREKIRDQLSDSHDWEPFNAA 368
           TT+L VT++Y PSPNYH+FIHPTIP +YMGM+CYCNGALARE+I+D L D   W  F+ A
Sbjct: 301 TTVLAVTEKYSPSPNYHMFIHPTIPGNYMGMVCYCNGALARERIKDTLGDESGWAAFSKA 360

Query: 369 VTSTTIENDNEIACYFPLGEIVPNV--PSVCRRATFEKSETGDSVKLNILESFANVAHDA 426
           +   +++   E+  YFPL EIVP+V  P V R     K        L  +ESFA+ AHDA
Sbjct: 361 LEDDSVDTSAELGVYFPLPEIVPSVDHPLVKRVRISPKG-------LQEVESFASPAHDA 413

Query: 427 RNIVESQALSCRVRISPLLSSDCTDTNSEMGDS--KVLFDYDNFPLSEYRKRPRRAFFVG 484
           +NIVESQALSCRVR++PLLS     T  E+ D+     FD     ++E+ +RP R FFVG
Sbjct: 414 KNIVESQALSCRVRVAPLLS-----TPPEISDTGGHAAFDGQQRDVAEFTRRPNRVFFVG 468

Query: 485 GASKNDAIVNLFAQVLGATDGNFRLETPNSCALGGCYRALWSHLHYSNLISSPFDQFLNE 544
           GASKNDAIV     +LGA  GN+RLET NSCALGGCY+A WS L Y    ++ F  +L+ 
Sbjct: 469 GASKNDAIVRAMPNILGAKGGNYRLETSNSCALGGCYKAFWSDLLYKQKTNASFADWLDS 528

Query: 545 AFRWDFDVQSLGLTDEKDWKHYNTKIQA 572
            F+WD D + L  TD + W     KI A
Sbjct: 529 VFKWDRDCKMLCKTDNRKWAASLGKIAA 556

>YHL032C (GUT1) [2254] chr8 complement(36377..38506) Glycerol
           kinase, catalyzes conversion of glycerol to
           glycerol-3-phosphate [2130 bp, 709 aa]
          Length = 709

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 58/136 (42%), Gaps = 10/136 (7%)

Query: 416 LESFANVAHDARNIVESQALSCRVRISPLLSSDCTDTNSEMGDSKVLFDYDNFPLSEYRK 475
           +  F   +H AR  VE      R  I   +SSD     S+  D   L +  +     Y K
Sbjct: 520 MSQFTTASHIARAAVEGVCFQARA-ILKAMSSDAFGEGSK--DRDFLEEISDV---TYEK 573

Query: 476 RPRRAFFV-GGASKNDAIVNLFAQVLGATDGNFRLETPNSCALGGCYRALWSHLHYSNLI 534
            P     V GG S+++ ++ + A +LG      R  T    ALG    A+ +++ + ++ 
Sbjct: 574 SPLSVLAVDGGMSRSNEVMQIQADILGPCVKVRRSPTAECTALGA---AIAANMAFKDVN 630

Query: 535 SSPFDQFLNEAFRWDF 550
             P  + L++  +W F
Sbjct: 631 ERPLWKDLHDVKKWVF 646

>ACL069C [980] [Homologous to ScYHL032C (GUT1) - SH]
           (232439..234373) [1935 bp, 644 aa]
          Length = 644

 Score = 33.1 bits (74), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 54/136 (39%), Gaps = 10/136 (7%)

Query: 416 LESFANVAHDARNIVESQALSCRVRISPLLSSDCTDTNSEMGDSKVLFDYDNFPLSEYRK 475
           +  F   +H AR  +E      R  I   +SSD     ++  D    F  +      Y  
Sbjct: 462 MSQFTTASHIARAAIEGVCFQARA-ILKAMSSDAFGEGAKDHD----FLEEIVDTGTYEH 516

Query: 476 RPRRAFFV-GGASKNDAIVNLFAQVLGATDGNFRLETPNSCALGGCYRALWSHLHYSNLI 534
            P     V GG SK+D ++ + A +LG      R  T  S ALG    A  ++   +  +
Sbjct: 517 SPLSVLAVDGGMSKSDEVMQIQADILGPCVKVRRSPTAESTALGAAIAACMAYKDPNERV 576

Query: 535 SSPFDQFLNEAFRWDF 550
                + LN+A +W F
Sbjct: 577 W----KDLNDAKKWIF 588

>YLR454W (YLR454W) [3828] chr12 (1043995..1051881) Protein of unknown
            function, has low similarity to uncharacterized C.
            albicans Orf6.6103p [7887 bp, 2628 aa]
          Length = 2628

 Score = 33.1 bits (74), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 66/133 (49%), Gaps = 28/133 (21%)

Query: 283  FTGDNLATICSL------RLKPNDVLVSLGTSTTILLVTDQYHPSPNYHLFIH-PTIPKH 335
            F+ + ++ I +L      + +P    +++    TI  V+ QY     + + +  PT P  
Sbjct: 900  FSSEYISQIIALPNGLRTKFEPTSTFITVKNCNTIS-VSGQY-----FRMMVESPTQPNF 953

Query: 336  YMGMICYCNGA-------LAREKIRDQLSDSHDWEPFNAAVTSTTIENDN---EIACYFP 385
            +  MIC  NG        L +++++ +L+   +WE   +A+   T+END+    I  +F 
Sbjct: 954  WERMIC-INGFKVMIHIDLLKQQMK-KLNSLQNWEKLPSAI---TLENDSWHFSIPHHFE 1008

Query: 386  LGEIVPNVPSVCR 398
            + +I+ ++P++ +
Sbjct: 1009 MFKIIDSIPTIFK 1021

>Scas_712.10
          Length = 708

 Score = 29.6 bits (65), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 27/53 (50%)

Query: 117 KQSLKDQLFPDAFSRSVAPNWQDHSTGSECQQFEDSVGGPVELARLTGSRAHH 169
           K ++ +Q F  A+   +   + D +   E ++F+DS+   +EL  + G R  H
Sbjct: 220 KAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLELLGIKGDRITH 272

>KLLA0B07161g complement(621391..623052) similar to sp|P38222
           Saccharomyces cerevisiae YBR030w singleton, start by
           similarity
          Length = 553

 Score = 29.3 bits (64), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 16/88 (18%)

Query: 45  YKTEKGVYLRDDGTVECPVAMWLE---------ALDLVFQRMSENKDVDLGSVRAMSGSC 95
           YK  K +  R +G++  P A W +         ALD+VF+ +S  ++++ G    ++ S 
Sbjct: 101 YKYLKSISHRQNGSLYLPPAYWEDNEKILLKNTALDVVFEALSPQEEIENGFKVGIALSR 160

Query: 96  QQHGSVYWAEEGPKLLPTLDFKQSLKDQ 123
           +      W EE    +P L F  +L+DQ
Sbjct: 161 K------WNEEFGLKIPYL-FDFNLEDQ 181

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,653,866
Number of extensions: 873490
Number of successful extensions: 1930
Number of sequences better than 10.0: 16
Number of HSP's gapped: 1937
Number of HSP's successfully gapped: 16
Length of query: 572
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 465
Effective length of database: 12,891,983
Effective search space: 5994772095
Effective search space used: 5994772095
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)