Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_33.1543541040520110.0
Sklu_2014.241541811031e-149
AGR323C4024179361e-124
KLLA0E09768g4054189071e-119
Scas_617.74204258841e-116
YGR193C (PDX1)4104088701e-114
CAGL0G09361g4294177343e-93
YNL071W (LAT1)4821972805e-27
Scas_694.104791922514e-23
Sklu_2037.44711902391e-21
CAGL0J10186g4691302372e-21
AER364W4531912337e-21
KLLA0F04741g473812283e-20
Kwal_23.47254721932204e-19
Kwal_56.23934442165950.001
AGL200W43687870.012
KLLA0D16522g46880820.046
Scas_693.2944276780.15
CAGL0E01287g41374760.24
YDR148C (KGD2)463147750.29
Sklu_2172.143259750.29
Scas_713.1146557710.88
Kwal_27.12506654134664.1
CAGL0F05489g48731646.8
YBR208C (DUR1,2)183545648.1
Kwal_27.11951186945638.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.15435
         (405 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.15435                                                         779   0.0  
Sklu_2014.2 YGR193C, Contig c2014 2083-3330 reverse complement        429   e-149
AGR323C [4634] [Homologous to ScYGR193C (PDX1) - SH] (1334333..1...   365   e-124
KLLA0E09768g 865604..866821 similar to sp|P16451 Saccharomyces c...   353   e-119
Scas_617.7                                                            345   e-116
YGR193C (PDX1) [2143] chr7 complement(884512..885744) Pyruvate d...   339   e-114
CAGL0G09361g 893614..894903 similar to sp|P16451 Saccharomyces c...   287   3e-93
YNL071W (LAT1) [4519] chr14 (491522..492970) Dihydrolipoamide S-...   112   5e-27
Scas_694.10                                                           101   4e-23
Sklu_2037.4 YNL071W, Contig c2037 4059-5474 reverse complement         97   1e-21
CAGL0J10186g complement(995223..996632) highly similar to sp|P12...    96   2e-21
AER364W [2865] [Homologous to ScYNL071W (LAT1) - SH] complement(...    94   7e-21
KLLA0F04741g complement(463107..464528) similar to sp|P12695 Sac...    92   3e-20
Kwal_23.4725                                                           89   4e-19
Kwal_56.23934                                                          41   0.001
AGL200W [4112] [Homologous to ScYDR148C (KGD2) - SH] complement(...    38   0.012
KLLA0D16522g complement(1394850..1396256) similar to sp|P19262 S...    36   0.046
Scas_693.29                                                            35   0.15 
CAGL0E01287g 120567..121808 highly similar to sp|P19262 Saccharo...    34   0.24 
YDR148C (KGD2) [993] chr4 complement(753669..755060) 2-oxoglutar...    33   0.29 
Sklu_2172.1 YDR148C, Contig c2172 307-1605                             33   0.29 
Scas_713.11                                                            32   0.88 
Kwal_27.12506                                                          30   4.1  
CAGL0F05489g 553902..555365 similar to tr|Q03944 Saccharomyces c...    29   6.8  
YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea amid...    29   8.1  
Kwal_27.11951                                                          29   8.9  

>Kwal_33.15435
          Length = 410

 Score =  779 bits (2011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/405 (96%), Positives = 389/405 (96%)

Query: 1   MITRGVFRRQLNRLVYVRTLHQSGLVGKAQVFAMPAMSPTMEKGGVVEWKFKVGEPFSAG 60
           MITRGVFRRQLNRLVYVRTLHQSGLVGKAQVFAMPAMSPTMEKGGVVEWKFKVGEPFSAG
Sbjct: 1   MITRGVFRRQLNRLVYVRTLHQSGLVGKAQVFAMPAMSPTMEKGGVVEWKFKVGEPFSAG 60

Query: 61  DVLLEVETDKAQIDVEAQDDGKLAKILVNDGAKDINVGEPIAYLAEPEDDLATLELPQSE 120
           DVLLEVETDKAQIDVEAQDDGKLAKILVNDGAKDINVGEPIAYLAEPEDDLATLELPQSE
Sbjct: 61  DVLLEVETDKAQIDVEAQDDGKLAKILVNDGAKDINVGEPIAYLAEPEDDLATLELPQSE 120

Query: 121 NKQSTKAPEPKVEKDVKASAQKGQGSEPKAQKQTQXXXXXXXXXXXXXXXXADPAQTLLP 180
           NKQSTKAPEPKVEKDVKASAQKGQGSEPKAQKQTQ                ADPAQTLLP
Sbjct: 121 NKQSTKAPEPKVEKDVKASAQKGQGSEPKAQKQTQVSSSSGSKDVSGVMVKADPAQTLLP 180

Query: 181 SVQLLLHANNISNEDALNNIQASGPNGRILKGDVLSYLGKVSQEAIAKLTKYIQKGEVLD 240
           SVQLLLHANNISNEDALNNIQASGPNGRILKGDVLSYLGKVSQEAIAKLTKYIQKGEVLD
Sbjct: 181 SVQLLLHANNISNEDALNNIQASGPNGRILKGDVLSYLGKVSQEAIAKLTKYIQKGEVLD 240

Query: 241 LSNIELKKPEPASKAPESVVKKEPVIFTEQLHLKVEPNVTFEQFSRSLKSYIDEARIISH 300
           LSNIELKKPEPASKAPESVVKKEPVIFTEQLHLKVEPNVTFEQFSRSLKSYIDEARIISH
Sbjct: 241 LSNIELKKPEPASKAPESVVKKEPVIFTEQLHLKVEPNVTFEQFSRSLKSYIDEARIISH 300

Query: 301 GEPVSNVQSDYYDALFEELITPEPRKPRFSVSYDIIPLNARSLNAKQQDDIFDLLAGTKN 360
           GEPVSNVQSDYYDALFEELITPEPRKPRFSVSYDIIPLNARSLNAKQQDDIFDLLAGTKN
Sbjct: 301 GEPVSNVQSDYYDALFEELITPEPRKPRFSVSYDIIPLNARSLNAKQQDDIFDLLAGTKN 360

Query: 361 TPASTESGNLQSNEVLVNLSVQVSDKFSDAKLKAERFVDYVKDLE 405
           TPASTESGNLQSNEVLVNLSVQVSDKFSDAKLKAERFVDYVKDLE
Sbjct: 361 TPASTESGNLQSNEVLVNLSVQVSDKFSDAKLKAERFVDYVKDLE 405

>Sklu_2014.2 YGR193C, Contig c2014 2083-3330 reverse complement
          Length = 415

 Score =  429 bits (1103), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 232/418 (55%), Positives = 291/418 (69%), Gaps = 24/418 (5%)

Query: 1   MITRGVFRRQLNR-------LVYVRTLHQSGLVGKAQVFAMPAMSPTMEKGGVVEWKFKV 53
           M+   VFR            L   R  H +  + KAQ F MPAMSPTMEKGGVVEWK+KV
Sbjct: 1   MLRYTVFRNSAAYAASAKLLLTSSRGFHSAATLYKAQAFTMPAMSPTMEKGGVVEWKYKV 60

Query: 54  GEPFSAGDVLLEVETDKAQIDVEAQDDGKLAKILVNDGAKDINVGEPIAYLAEPEDDLAT 113
           GEPFSAGDVLLEVETDKAQIDVEAQDDGKLA I++++G+KDI VGE IAYLAE +DDLAT
Sbjct: 61  GEPFSAGDVLLEVETDKAQIDVEAQDDGKLAAIIIDNGSKDIKVGETIAYLAEVDDDLAT 120

Query: 114 LELPQSENKQSTKAPEPKVEKDVKASAQKGQGSEPKAQKQTQXXXXXXXXXXXXXXXXAD 173
           LE+P    KQ   AP+P  +K   A       + P+ +K                   A+
Sbjct: 121 LEIP----KQEPAAPKPTPKKQETAPT---PAATPEPKKDNAPTSEPKKDTPSGILSTAN 173

Query: 174 PAQTLLPSVQLLLHANNISNEDALNNIQASGPNGRILKGDVLSYLGKVSQEAIAKLTKYI 233
           P+QTL PSVQ LLH N IS EDALNNI+ASGPNGRILKGDVL+YLGK+S + + K+T+YI
Sbjct: 174 PSQTLFPSVQSLLHENGISVEDALNNIKASGPNGRILKGDVLAYLGKISNDCVVKVTEYI 233

Query: 234 QKGEVLDLSNIELKKPEPASK--APESVVKKEPVIFTEQLHLKVEPNVTFEQFSRSLKSY 291
           + GE LDL+NIELKKPE   +    ++++K EPV+FTE L L+V   V+ +Q S+SL+SY
Sbjct: 234 KSGESLDLTNIELKKPELKLELGTSKTLLKPEPVVFTETLTLRVPSAVSSDQLSKSLRSY 293

Query: 292 IDEARIISHGEPVSNVQSDYYDALFEELITPEPRKPRFSVSYDIIPLNARSLNAKQQDDI 351
           I+EA  +SH +PV+   SDYYD +FEELITPEPR+PRFSVSY + PL    L+ KQ DDI
Sbjct: 294 INEANYLSHEQPVNASTSDYYDPIFEELITPEPRQPRFSVSYQLTPL-VPVLSPKQHDDI 352

Query: 352 FDLLAGTKNTPASTESGNLQ----SNEVLVNLSVQVSDKFSDAKLKAERFVDYVKDLE 405
           FDLL+GT    A+T S  ++    + E  +++SVQV+ KF DA LKA+RF++Y+KDLE
Sbjct: 353 FDLLSGTS---AATSSPQVEQPSKTTEYSLDVSVQVNGKFDDATLKAQRFIEYLKDLE 407

>AGR323C [4634] [Homologous to ScYGR193C (PDX1) - SH]
           (1334333..1335541) [1209 bp, 402 aa]
          Length = 402

 Score =  365 bits (936), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 202/417 (48%), Positives = 273/417 (65%), Gaps = 36/417 (8%)

Query: 6   VFRRQL----NRLVYVRTLHQSGLVGKAQVFAMPAMSPTMEKGGVVEWKFKVGEPFSAGD 61
           +FR QL     R+ + R  H S        F MPAMSPTMEKGG+V WKFKVGEPF AGD
Sbjct: 1   MFRSQLYKQSARISFRRPFHGSMAPRAITPFHMPAMSPTMEKGGIVSWKFKVGEPFQAGD 60

Query: 62  VLLEVETDKAQIDVEAQDDGKLAKILVNDGAKDINVGEPIAYLAEPEDDLATLELPQ--- 118
           V+LEVETDKAQIDVEAQDDGKLA I+  DG+KD++VGE +A+LAE EDDL+ LE+P+   
Sbjct: 61  VILEVETDKAQIDVEAQDDGKLAAIVKGDGSKDVDVGETVAFLAEVEDDLSALEIPKVVT 120

Query: 119 SEN-KQSTKAPEPKVEKDVKASAQKGQGSEPKAQKQTQXXXXXXXXXXXXXXXXADPAQT 177
           SE  K++   P PKV +   A A+K                             AD  QT
Sbjct: 121 SEAPKEAEAKPSPKVSEQAPAPARK----------------TPSKTVSNGILQQADKNQT 164

Query: 178 LLPSVQLLLHANNISNEDALNNIQASGPNGRILKGDVLSYLGKVSQEAIAKLTKYIQKGE 237
           LLPSV  LLHAN ++ E+A  NI+ASGPNGRILKGDVL YLGK+S +++ K+++YI+K E
Sbjct: 165 LLPSVITLLHANGVTVEEAFANIKASGPNGRILKGDVLGYLGKISADSVVKVSEYIKKFE 224

Query: 238 VLDLSNIELKKPEPASKAPESVVKKEPV-----IFTEQLHLKVEPNVTFEQFSRSLKSYI 292
            LDLSNIEL+  +P   A +   + +P         E+L LKV  +V+FE+FS +LK YI
Sbjct: 225 HLDLSNIELRPAQPPKGAADKKAEPKPAPPAYRTLHERLILKVPEHVSFERFSNALKQYI 284

Query: 293 DEARIISHGEPVSNVQSDYYDALFEELITPEPRKPRFSVSYDIIPLNARSLNAKQQDDIF 352
            EA   +HGE + N  SD +D LFEEL++ +PR+PRF VSYD++PL     + K ++DIF
Sbjct: 285 REATYTAHGEALDNPYSDRFDPLFEELLSVQPREPRFEVSYDVLPLTVVPSSPKPKEDIF 344

Query: 353 DLLAG----TKNTPASTESGNLQSNEVLVNLSVQVSDKFSDAKLKAERFVDYVKDLE 405
           D+L+G    +K  P+S+E     ++E  ++L ++V +KFSD++ +A RF+DY+K+L+
Sbjct: 345 DILSGNSVESKPAPSSSEPS---AHEYALDLYLKVENKFSDSETRAARFIDYIKELD 398

>KLLA0E09768g 865604..866821 similar to sp|P16451 Saccharomyces
           cerevisiae YGR193c PDX1 pyruvate dehydrogenase complex
           protein X, start by similarity
          Length = 405

 Score =  353 bits (907), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 201/418 (48%), Positives = 266/418 (63%), Gaps = 34/418 (8%)

Query: 6   VFRRQLNRLVYVRTLHQSGLVGKAQVFAMPAMSPTMEKGGVVEWKFKVGEPFSAGDVLLE 65
           +FR  +     +R LHQ   + KAQ F MPAMSPTME+GGVV+WKFK G+ FSAGDVLLE
Sbjct: 1   MFRLAIKNRACLRQLHQCRTMLKAQAFGMPAMSPTMERGGVVDWKFKAGDTFSAGDVLLE 60

Query: 66  VETDKAQIDVEAQDDGKLAKILVNDGAKDINVGEPIAYLAEPEDDLATLELPQS-ENKQS 124
           VETDKA IDVEAQDDGKLAKIL  +GAKDI VGEPIAY+A+ +DDLATLE P+  E K+ 
Sbjct: 61  VETDKATIDVEAQDDGKLAKILKENGAKDIPVGEPIAYIADVDDDLATLEFPKPVEAKKE 120

Query: 125 TKAPEPKVE--KDVKASAQKGQGSEPKAQKQTQXXXXXXXXXXXXXXXXADPAQTLLPSV 182
           +K  E K E  K V+ + +K Q S  K   +                  A+ +QTL PSV
Sbjct: 121 SKPVETKKEEAKPVEKTDKKKQTSASKTPSKN-------------GSVQANASQTLFPSV 167

Query: 183 QLLLHANNISNEDALNNIQASGPNGRILKGDVLSYLGKVSQEAIAKLTKYIQKGEVLDLS 242
             LL  NNIS  DAL+ I+A+GPNGRILKGDVL+YLGK+SQ+++ K+T+YI+  E LDL+
Sbjct: 168 LSLLEENNISTADALDKIKATGPNGRILKGDVLAYLGKISQDSLNKVTEYIKSHEKLDLT 227

Query: 243 NIELKKPEPASKAPESVVKKE--------PVIFTEQLHLKVEPNVTFEQFSRSLKSYIDE 294
           NIEL+   PA +   +    +        P++ +EQ+ L V  NVT+ Q S ++ SY+ E
Sbjct: 228 NIELR---PARETAAAAAAAQAAKPAKPLPLVLSEQITLHVPENVTYSQLSAAIASYVKE 284

Query: 295 ARIISHGEPVSNVQSDYYDALFEELITPEPRKPRFSVSYDIIPL--NARSLNAKQQDDIF 352
              ++H EP++N  S+ YD LFEEL+  EP KPRF V+Y+I+ L    R   +  Q DIF
Sbjct: 285 CSFLAHDEPLTNDASELYDPLFEELLVQEPTKPRFKVTYNIVDLEPTPRHRTSSPQPDIF 344

Query: 353 DLLAGTKNTPASTESGNLQS-----NEVLVNLSVQVSDKFSDAKLKAERFVDYVKDLE 405
           DLL+GT       E+  +       +E  +N+SV V +  +DAK +AE FV  + +LE
Sbjct: 345 DLLSGTTTQELQQEASAVSKQQQTRHEYALNVSVAVDESLTDAKQRAENFVAQLSNLE 402

>Scas_617.7
          Length = 420

 Score =  345 bits (884), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 197/425 (46%), Positives = 273/425 (64%), Gaps = 27/425 (6%)

Query: 1   MITRGVFRRQL---NRLVYVRTLHQSGLVGKAQVFAMPAMSPTMEKGGVVEWKFKVGEPF 57
           M++    R  L    R   +R++H S  +  AQ F MPAMSPTMEKGG+V WKFKVGEPF
Sbjct: 1   MLSYNAMRSCLQGQTRRSLIRSIHLSRSLLSAQKFTMPAMSPTMEKGGIVSWKFKVGEPF 60

Query: 58  SAGDVLLEVETDKAQIDVEAQDDGKLAKILVNDGAKDINVGEPIAYLAEPEDDLATLELP 117
           S+GDVLLEVETDKAQIDVEAQDDGKLAKIL  DG+KD++VGE IAYLA+ +DDL+TL++ 
Sbjct: 61  SSGDVLLEVETDKAQIDVEAQDDGKLAKILKGDGSKDVDVGETIAYLADVDDDLSTLKIS 120

Query: 118 QSENKQSTKAPEPKVEKDVKASAQKGQGSEPKAQKQTQXXXXXXXXXXXXXXXXADPAQT 177
             E +Q    P  KVE+   +      G++   Q   +                A   QT
Sbjct: 121 AEEEEQVKVTPVSKVEEKTTS------GNKEPLQNTKKAKESPIATDKNGVLQVAKSNQT 174

Query: 178 LLPSVQLLLHANNISNEDALNNIQASGPNGRILKGDVLSYLGKVSQEAIAKLTKYIQKGE 237
           LLPSV LLL ANNIS EDA+ NI+ASG +G +LKGDVL+YLGK+ + ++ K+++Y++  E
Sbjct: 175 LLPSVSLLLAANNISKEDAIRNIKASGRDGLLLKGDVLAYLGKIPESSLIKVSEYVKNKE 234

Query: 238 VLDLSNIE---LKKPEP------ASKAPESVVKKEPVIFTEQLHLKVEPNVTFEQFSRSL 288
             D S+IE   L K EP        KA E  + KEPV+   ++ LKV  NV+ E+   ++
Sbjct: 235 KQDFSHIELGSLTKAEPPQSEKLEDKAIEK-ISKEPVLLHSEITLKVPSNVSRERLDNTV 293

Query: 289 KSYIDEARIISHGEPVSNVQSDYYDALFEELITPEPRKPRFSVSYDI-IPLNARS-LNAK 346
           KS+I+E    +H  P+SN+ S Y+D +FE+LIT  PR+PRF V+Y++  P+        K
Sbjct: 294 KSFIEEGFEYTHAMPLSNINSQYFDDIFEDLITTAPREPRFQVNYELYCPVEEEERFTRK 353

Query: 347 QQDDIFDLLAGTKN-TP-----ASTESGNLQSNEVLVNLSVQVSDKFSDAKLKAERFVDY 400
            ++DIFDLLAG+++ TP      S    +  ++E  ++L ++VSDK+SD+K KAERF++Y
Sbjct: 354 DREDIFDLLAGSESRTPLRGPVVSNSEASTPASEWTLSLELEVSDKYSDSKQKAERFLEY 413

Query: 401 VKDLE 405
           +  L+
Sbjct: 414 MWQLD 418

>YGR193C (PDX1) [2143] chr7 complement(884512..885744) Pyruvate
           dehydrogenase complex protein X, the binding protein for
           Lpd1p [1233 bp, 410 aa]
          Length = 410

 Score =  339 bits (870), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/408 (47%), Positives = 264/408 (64%), Gaps = 22/408 (5%)

Query: 9   RQLNRLVYVRTLHQSGLVGKAQVFAMPAMSPTMEKGGVVEWKFKVGEPFSAGDVLLEVET 68
           +   R +     H S  +   + F+MPAMSPTMEKGG+V WK+KVGEPFSAGDV+LEVET
Sbjct: 12  KSCTRYLTKCNYHASAKLLAVKTFSMPAMSPTMEKGGIVSWKYKVGEPFSAGDVILEVET 71

Query: 69  DKAQIDVEAQDDGKLAKILVNDGAKDINVGEPIAYLAEPEDDLATLELPQSENKQSTKAP 128
           DK+QIDVEA DDGKLAKIL ++G+KD++VGEPIAY+A+ +DDLAT++LPQ  N  + K+ 
Sbjct: 72  DKSQIDVEALDDGKLAKILKDEGSKDVDVGEPIAYIADVDDDLATIKLPQEANTANAKSI 131

Query: 129 EPKVEKDVKASAQKGQGSEPKAQKQTQXXXXXXXXXXXXXXXXADPAQTLLPSVQLLLHA 188
           E K     K SA   + ++   +K T                 A+  QTLLPSV LLL  
Sbjct: 132 EIK-----KPSADSTEATQQHLKKAT------VTPIKTVDGSQANLEQTLLPSVSLLLAE 180

Query: 189 NNISNEDALNNIQASGPNGRILKGDVLSYLGKVSQEAIAKLTKYIQKGEVLDLSNIE--L 246
           NNIS + AL  I  SG NGR+LKGDVL+YLGK+ Q+++ K+T++I+K E LDLSNI+   
Sbjct: 181 NNISKQKALKEIAPSGSNGRLLKGDVLAYLGKIPQDSVNKVTEFIKKNERLDLSNIKPIQ 240

Query: 247 KKPEPASKAPESVVKK---EPVIFTEQLHLKVEPNVTFEQFSRSLKSYIDEARIISHGEP 303
            KP+ A +A      K    PV F EQL      ++ F++ S SL S++ EA   SHG P
Sbjct: 241 LKPKIAEQAQTKAADKPKITPVEFEEQLVFHAPASIPFDKLSESLNSFMKEAYQFSHGTP 300

Query: 304 VSNVQSDYYDALFEELITPEPRKPRFSVSYDI--IPLNARSLNAKQQDDIFDLLAGTKNT 361
           + +  S Y+D +FE+L+T  PR+PRF  SYD+  IP      +   Q+DIFDLL G+  T
Sbjct: 301 LMDTNSKYFDPIFEDLVTLSPREPRFKFSYDLMQIPKANNMQDTYGQEDIFDLLTGSDAT 360

Query: 362 PASTE--SGNL-QSNEVLVNLSVQVSD-KFSDAKLKAERFVDYVKDLE 405
            +S      NL + NE ++ L+V V++ KF+DA+ KA+RF+DYV++LE
Sbjct: 361 ASSVRPVEKNLPEKNEYILALNVSVNNKKFNDAEAKAKRFLDYVRELE 408

>CAGL0G09361g 893614..894903 similar to sp|P16451 Saccharomyces
           cerevisiae YGR193c PDX1 pyruvate dehydrogenase complex
           protein X, hypothetical start
          Length = 429

 Score =  287 bits (734), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 175/417 (41%), Positives = 240/417 (57%), Gaps = 76/417 (18%)

Query: 32  FAMPAMSPTMEKGGVVEWKFKVGEPFSAGDVLLEVETDKAQIDVEAQDDGKLAKILVNDG 91
           F MPAMSPTMEKGG+V WKFK  + F+AGDVLLEVETDKAQIDVEAQDDGKLAKI+  DG
Sbjct: 43  FLMPAMSPTMEKGGIVSWKFKENDSFNAGDVLLEVETDKAQIDVEAQDDGKLAKIIRGDG 102

Query: 92  AKDINVGEPIAYLAEPEDDLATLELPQ-------------SENKQSTKAPEPKVEKDVKA 138
           +KD+ VG+ IA+ A+PEDDL+TL++P+              E+++  K+ EP       A
Sbjct: 103 SKDVLVGDVIAFTADPEDDLSTLKIPEVTESMKQVSSGSGKEDQKPAKSEEP-------A 155

Query: 139 SAQKGQG---SEPKAQKQTQXXXXXXXXXXXXXXXXADPAQTLLPSVQLLLHANNISNED 195
             Q+ +G   SE K  K +                 AD +QTLLPSV + L  N IS ED
Sbjct: 156 PLQRKEGKNVSESKTAKSS-----------GDVLTTADASQTLLPSVVMALADNGISKED 204

Query: 196 ALNNIQASGPNGRILKGDVLSYLGKVSQEAIAKLTKYIQKGEVLDLSNIELKKPEPASKA 255
           AL NI+ASG NGRILKGDVL+Y GK+ Q+++ K+ +Y+ + + LDLSNIE    E  S+ 
Sbjct: 205 ALANIKASGANGRILKGDVLAYAGKIQQDSVVKVAEYVNRNQKLDLSNIERIVLEVNSEE 264

Query: 256 PESV--------------------------VKKEPVIFTEQLHLKVEPNVTFEQFSRSLK 289
                                          + EP+   E++ L+V   V F +F R+++
Sbjct: 265 GGDGQAQAQAQAQAQGQGQDSGKTGKLAKPAQVEPIRIQEEILLEVRRGVDFTRFERAVR 324

Query: 290 SYIDEARIISHGEPVSNVQSDYYDALFEELITPEPRKPRFSVSYDIIPLNARSLNAKQQD 349
            YID+    +H +P+ N  S+ YD+LFE+L+T +PR  RF V Y ++     S      +
Sbjct: 325 EYIDDIYQYTHEQPLENTMSERYDSLFEDLVTVDPRSARFDVEYSLLETTDGS------E 378

Query: 350 DIFDLLAGTKNTPASTESG-NLQSNEVLVNLSVQVSDKFSDAKLKAERFVDYVKDLE 405
           DIFDLL      P   + G  + S EV    SV V+DK+ DA  KA+RF++ ++ L+
Sbjct: 379 DIFDLLG-----PGEVKEGKQVYSLEV----SVTVNDKYDDAVEKADRFMECLRQLQ 426

>YNL071W (LAT1) [4519] chr14 (491522..492970) Dihydrolipoamide
           S-acetyltransferase component (E2) of pyruvate
           dehydrogenase complex [1449 bp, 482 aa]
          Length = 482

 Score =  112 bits (280), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 76/197 (38%), Positives = 106/197 (53%), Gaps = 29/197 (14%)

Query: 31  VFAMPAMSPTMEKGGVVEWKFKVGEPFSAGDVLLEVETDKAQIDVEAQDDGKLAKILVND 90
           +  MPA+SPTM +G +  W  K G+  S G+V+ E+ETDKAQ+D E Q+DG LAKILV +
Sbjct: 36  IIGMPALSPTMTQGNLAAWTKKEGDQLSPGEVIAEIETDKAQMDFEFQEDGYLAKILVPE 95

Query: 91  GAKDINVGEPIAYLAEPEDDLAT-----LELPQSENKQSTKA--PEPKVEKDVKASAQKG 143
           G KDI V +PIA   E + D+       LE   S++K STKA   EP+ EK  +A A++ 
Sbjct: 96  GTKDIPVNKPIAVYVEDKADVPAFKDFKLEDSGSDSKTSTKAQPAEPQAEKKQEAPAEET 155

Query: 144 QGSEPKAQKQTQXXXXXXXXXXXXXXXXADPAQTLL--PSVQLLLHANNISNEDALNNIQ 201
           + S P+A+K                   A P   +   P  + +     IS    L ++ 
Sbjct: 156 KTSAPEAKKS----------------DVAAPQGRIFASPLAKTIALEKGIS----LKDVH 195

Query: 202 ASGPNGRILKGDVLSYL 218
            +GP GRI K D+ SYL
Sbjct: 196 GTGPRGRITKADIESYL 212

>Scas_694.10
          Length = 479

 Score =  101 bits (251), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 101/192 (52%), Gaps = 22/192 (11%)

Query: 31  VFAMPAMSPTMEKGGVVEWKFKVGEPFSAGDVLLEVETDKAQIDVEAQDDGKLAKILVND 90
           +  MP++SPTM  G +V W  +VG+  + GDVL E+ETDKAQ+D E QDDG LAKILV +
Sbjct: 40  IIGMPSLSPTMTHGNLVAWSKQVGDQLAPGDVLAELETDKAQMDFEFQDDGYLAKILVPE 99

Query: 91  GAKDINVGEPIAYLAEPEDDLATLELPQSENK-------QSTKAPEPKVEKDVKASAQKG 143
           G KD+ + +PIA   E  DD+A  +  + E+         +T+  E K ++  K +AQ+ 
Sbjct: 100 GTKDVPINKPIAVYVEDADDVAAFKDFKIEDSADAAATTTTTEVKEEKPQQPEKINAQQQ 159

Query: 144 QGSEPKAQKQTQXXXXXXXXXXXXXXXXADPAQTLLPSVQLLLHANNISNEDALNNIQAS 203
              + K QK +                  D    ++ S   L     + N  AL   + S
Sbjct: 160 PTQKSKEQKSSPVTQE-------------DTTGRIIASP--LAKKIALENGVALKGFKGS 204

Query: 204 GPNGRILKGDVL 215
           GP+GRI+K DVL
Sbjct: 205 GPHGRIVKDDVL 216

>Sklu_2037.4 YNL071W, Contig c2037 4059-5474 reverse complement
          Length = 471

 Score = 96.7 bits (239), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 64/190 (33%), Positives = 90/190 (47%), Gaps = 10/190 (5%)

Query: 31  VFAMPAMSPTMEKGGVVEWKFKVGEPFSAGDVLLEVETDKAQIDVEAQDDGKLAKILVND 90
           +  MPA+SPTM +G +  W  KVG+  S G+V+ E+ETDKAQ+D E Q++G LAKILV +
Sbjct: 34  IIGMPALSPTMTQGNLAVWSKKVGDSLSPGEVIAEIETDKAQMDFEFQEEGFLAKILVPE 93

Query: 91  GAKDINVGEPIAYLAEPEDDLATLELPQSENKQSTKAPEPKVEKDVKASAQKGQGSEPKA 150
           G KDI V +PIA   E E D+   +    ++  S    E   E+  K   Q         
Sbjct: 94  GTKDIPVNKPIAVYVEEEGDVEAFKDFTVDDSASPAKKEAPKEEAPKEEEQAATKPASST 153

Query: 151 QKQTQXXXXXXXXXXXXXXXXADPAQTLLPSVQLLLHANNISNEDALNNIQASGPNGRIL 210
             Q +                A P          L     +    AL N+  +GP+GRI 
Sbjct: 154 PSQNKSSSSSSSSSAHAGRIFASP----------LAKTIALEKGIALKNVTGTGPHGRIT 203

Query: 211 KGDVLSYLGK 220
           K D+ ++L K
Sbjct: 204 KADIETFLAK 213

>CAGL0J10186g complement(995223..996632) highly similar to sp|P12695
           Saccharomyces cerevisiae YNL071w LAT1 dihydrolipoamide
           S-acetyltransferase, start by similarity
          Length = 469

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 72/130 (55%), Gaps = 6/130 (4%)

Query: 2   ITRGVFRRQLNRLVYVRTLHQSGLVGKAQVFAMPAMSPTMEKGGVVEWKFKVGEPFSAGD 61
           ++R   R    RLV   TL          V  MPA+SPTM +G +  W  K G+  + GD
Sbjct: 11  VSRTALR---GRLVTPMTLRLYASFPPHTVIGMPALSPTMSQGNLAVWSKKEGDSLAPGD 67

Query: 62  VLLEVETDKAQIDVEAQDDGKLAKILVNDGAKDINVGEPIAYLAEPEDDLATLE---LPQ 118
           VL E+ETDKAQ+D E QD+G LAKILV  G KD+ V  PIA   E E D+A  +   +  
Sbjct: 68  VLAEIETDKAQMDFEFQDEGYLAKILVPAGTKDVAVSRPIAVYVEDEADVAAFKDFTVED 127

Query: 119 SENKQSTKAP 128
           +   QS+ AP
Sbjct: 128 AGGSQSSSAP 137

>AER364W [2865] [Homologous to ScYNL071W (LAT1) - SH]
           complement(1312487..1313848) [1362 bp, 453 aa]
          Length = 453

 Score = 94.4 bits (233), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 68/191 (35%), Positives = 90/191 (47%), Gaps = 18/191 (9%)

Query: 31  VFAMPAMSPTMEKGGVVEWKFKVGEPFSAGDVLLEVETDKAQIDVEAQDDGKLAKILVND 90
           +  MPA+SPTM +G +  W  K G+  S G+VL EVETDKAQ+D E Q++G LAKILV +
Sbjct: 33  IIGMPALSPTMTQGNLAVWTKKEGDKLSPGEVLAEVETDKAQMDFEFQEEGFLAKILVPE 92

Query: 91  GAKDINVGEPIAYLAEPEDDLATLELPQSENKQSTKAPEPKVEKDVKASAQKGQGSEPKA 150
           GAKD+ V +PIA   E E D+A  +             + KVE+    S       E   
Sbjct: 93  GAKDVPVNKPIAVYVEEEGDVAAFK-------------DFKVEESAAESKDAPAKEEAAP 139

Query: 151 QKQTQXXXXXXXXXXXXXXXXADPAQTLL-PSVQLLLHANNISNEDALNNIQASGPNGRI 209
            K                   A   + +  P  + +     IS    L  +  +GPNGRI
Sbjct: 140 AKAAPAAAAPAKAAKKSTGSAASGGRIMASPLAKTIALEKGIS----LKEVTGTGPNGRI 195

Query: 210 LKGDVLSYLGK 220
            K DV  YL K
Sbjct: 196 TKEDVEKYLAK 206

>KLLA0F04741g complement(463107..464528) similar to sp|P12695
           Saccharomyces cerevisiae YNL071w LAT1 dihydrolipoamide
           S-acetyltransferase, start by similarity
          Length = 473

 Score = 92.4 bits (228), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 45/81 (55%), Positives = 56/81 (69%)

Query: 31  VFAMPAMSPTMEKGGVVEWKFKVGEPFSAGDVLLEVETDKAQIDVEAQDDGKLAKILVND 90
           +  MPA+SPTM +GG+ EW   VG+    GDVL EVETDKAQ+D E Q++G LAKILV  
Sbjct: 34  IIGMPALSPTMVQGGLTEWSKNVGDRLEPGDVLAEVETDKAQMDFEFQEEGYLAKILVPA 93

Query: 91  GAKDINVGEPIAYLAEPEDDL 111
           G KDI V +P+A   E E D+
Sbjct: 94  GTKDIPVNKPLAVYVEEESDV 114

>Kwal_23.4725
          Length = 472

 Score = 89.4 bits (220), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 64/193 (33%), Positives = 91/193 (47%), Gaps = 14/193 (7%)

Query: 31  VFAMPAMSPTMEKGGVVEWKFKVGEPFSAGDVLLEVETDKAQIDVEAQDDGKLAKILVND 90
           V  MPA+SPTM +G +  W  K G+    G+ + E+ETDKAQ++ E Q+DG LAKILV +
Sbjct: 34  VIGMPALSPTMTQGNLAVWLKKAGDKLEPGEAIAEIETDKAQMEFEFQEDGYLAKILVPE 93

Query: 91  GAKDINVGEPIAYLAEPEDDLATL-ELPQSENKQSTKAPEPKVEKDVKASAQKGQGSEPK 149
           G+KD+ VG+PIA   E E D+    +    E      A  P+ ++D           EP+
Sbjct: 94  GSKDLPVGKPIAVYVEEEGDVGAFADFTAEEAAPEKPAAAPEKKQD-----------EPQ 142

Query: 150 AQKQTQXXXXXXXXXXXXXXXXADPAQTLLPSVQLLLHANNISNEDALNNIQASGPNGRI 209
            Q   +                A     ++ S   L     +    +L  +  +GP GRI
Sbjct: 143 QQAAQKEESGKPAKKSSGATSAAPSGDRIIASP--LAKTIALDKGISLKAVTGTGPRGRI 200

Query: 210 LKGDVLSYLGKVS 222
            K DV  YL K S
Sbjct: 201 TKADVEEYLSKSS 213

>Kwal_56.23934
          Length = 442

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 80/165 (48%), Gaps = 18/165 (10%)

Query: 3   TRGVFRRQLNRLVYVRTLHQSGLVGKAQVFAM-------PAMSPTMEKGGVVEWKFKVGE 55
           TR V    L     +    + GLV +  V  M       P M+ ++ +G + E+  +VGE
Sbjct: 22  TRAVGGFTLPNCGNITQFQKGGLVLRVAVARMASTTVKVPPMAESLTEGSLKEYTKQVGE 81

Query: 56  PFSAGDVLLEVETDKAQIDVEAQDDGKLAKILVNDGAKD-INVGEPIAYL-----AEPED 109
                ++L  +ETDK  ++V A   GK+ K+  N   +D + VG+ +A +     A    
Sbjct: 82  FIKQDELLATIETDKIDVEVNAPTSGKVTKL--NFQPEDTVTVGDDLAEIEAGAEAPASG 139

Query: 110 DLATLELPQSENKQSTKAPEPKVEKDVKASAQKGQGSEPKAQKQT 154
             A  E  Q + KQS+++  PK E++  A+A K Q + PK + ++
Sbjct: 140 QDAPKETSQEQPKQSSES-APKKEQE--AAAPKPQETAPKEESKS 181

>AGL200W [4112] [Homologous to ScYDR148C (KGD2) - SH]
           complement(321080..322390) [1311 bp, 436 aa]
          Length = 436

 Score = 38.1 bits (87), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 46/87 (52%), Gaps = 3/87 (3%)

Query: 21  HQSGLVGKAQVFAMPAMSPTMEKGGVVEWKFKVGEPFSAGDVLLEVETDKAQIDVEAQDD 80
           H  GL   +    +P M+ ++ +G + E+  +VGE     ++L  +ETDK  I+V A   
Sbjct: 52  HLCGLRYASTSVQVPPMAESLTEGSLKEFTKQVGEYIEQDELLATIETDKIDIEVNAPVS 111

Query: 81  GKLAKILVNDGAKD-INVGEPIAYLAE 106
           G + K+  N   +D + VGE +A + E
Sbjct: 112 GTVTKL--NFKPEDTVTVGEELAQIEE 136

>KLLA0D16522g complement(1394850..1396256) similar to sp|P19262
           Saccharomyces cerevisiae YDR148c KGD2 2-oxoglutarate
           dehydrogenase complex E2 component, start by similarity
          Length = 468

 Score = 36.2 bits (82), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 43/80 (53%), Gaps = 3/80 (3%)

Query: 26  VGKAQVFAMPAMSPTMEKGGVVEWKFKVGEPFSAGDVLLEVETDKAQIDVEAQDDGKLAK 85
           V  A    +P M+ ++ +G + E+  KVG+     ++L  +ETDK  ++V +   G +AK
Sbjct: 76  VRHATSVPVPPMAESLTEGSLKEYTKKVGDFIEKDELLATIETDKIDVEVISPISGTIAK 135

Query: 86  ILVNDGAKD-INVGEPIAYL 104
           +  N    D + VGE IA +
Sbjct: 136 L--NFSPDDTVTVGEEIAQI 153

>Scas_693.29
          Length = 442

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 3/76 (3%)

Query: 34  MPAMSPTMEKGGVVEWKFKVGEPFSAGDVLLEVETDKAQIDVEAQDDGKLAKILVNDGAK 93
           +P M+ ++ +G + E+   VG+     ++L  +ETDK  I+V A   G ++K+  N   +
Sbjct: 68  VPQMAESLTEGSLKEFTKAVGDFIEQDELLATIETDKIDIEVIAPVSGTVSKL--NFKPE 125

Query: 94  D-INVGEPIAYLAEPE 108
           D + VGE +A + E E
Sbjct: 126 DTVTVGEELATIEEGE 141

>CAGL0E01287g 120567..121808 highly similar to sp|P19262
           Saccharomyces cerevisiae YDR148c oxoglutarate
           dehydrogenase complex E2 component, hypothetical start
          Length = 413

 Score = 33.9 bits (76), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 43/74 (58%), Gaps = 3/74 (4%)

Query: 34  MPAMSPTMEKGGVVEWKFKVGEPFSAGDVLLEVETDKAQIDVEAQDDGKLAKILVNDGAK 93
           +P+M+ ++ +G + E+  KVGE     ++L  +ETDK  I+V +   G + K+  N   +
Sbjct: 45  VPSMAESLTEGSLKEFTKKVGEFVEQDELLATIETDKIDIEVNSPVSGTVTKL--NFEPE 102

Query: 94  D-INVGEPIAYLAE 106
           D + VG+ +A + E
Sbjct: 103 DTVTVGDELAQIEE 116

>YDR148C (KGD2) [993] chr4 complement(753669..755060) 2-oxoglutarate
           dehydrogenase (alpha-ketoglutarate dehydrogenase)
           complex KE2 component dihydrolipoamide
           S-succinyltransferase [1392 bp, 463 aa]
          Length = 463

 Score = 33.5 bits (75), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 64/147 (43%), Gaps = 29/147 (19%)

Query: 28  KAQVFAMPAMSPTMEKGGVVEWKFKVGEPFSAGDVLLEVETDKAQIDVEAQDDGKLAKIL 87
           K+    +P M+ ++ +G + E+   VG+     ++L  +ETDK  I+V +   G + K+ 
Sbjct: 72  KSTSIEVPPMAESLTEGSLKEYTKNVGDFIKEDELLATIETDKIDIEVNSPVSGTVTKL- 130

Query: 88  VNDGAKD-INVGEPIAYL--------------------AEPEDDLATLELPQSENKQSTK 126
            N   +D + VGE +A +                    AEP   +A  E   SE   S K
Sbjct: 131 -NFKPEDTVTVGEELAQVEPGEAPAEGSGESKPEPTEQAEPSQGVAARE-NSSEETASKK 188

Query: 127 APEPKVEKDVKASAQKGQGSEPKAQKQ 153
              PK     K +A K + +EPK   Q
Sbjct: 189 EAAPK-----KEAAPKKEVTEPKKADQ 210

>Sklu_2172.1 YDR148C, Contig c2172 307-1605
          Length = 432

 Score = 33.5 bits (75), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 34/59 (57%)

Query: 28  KAQVFAMPAMSPTMEKGGVVEWKFKVGEPFSAGDVLLEVETDKAQIDVEAQDDGKLAKI 86
           ++ V  +P M+ ++ +G + E+  +VGE     ++L  +ETDK  ++V +   G + K+
Sbjct: 52  QSTVVKVPPMAESLTEGSLKEFTKQVGEFIEQDELLATIETDKIDVEVNSPVSGTITKL 110

>Scas_713.11
          Length = 465

 Score = 32.0 bits (71), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 303 PVSNVQSDYYDALFEELITPEPRKPRFSVSYDIIPLNARSLNAKQQDDIFDLLAGTK 359
           P S  ++D Y  +  +LIT  P   +FS SYD++  +  +++AKQ+  +F  L   K
Sbjct: 361 PNSKFENDIYTCMMLDLITDAPCSAQFSRSYDLV-RHQNTIHAKQK-IVFHCLQCIK 415

>Kwal_27.12506
          Length = 654

 Score = 30.0 bits (66), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 58/134 (43%), Gaps = 16/134 (11%)

Query: 267 FTEQLHLKVEPNVTFEQFSRSLKSYIDEAR-IISHGE----PVSNVQSDYYDALFEELIT 321
           F E+L+  ++P+V           ++D    +I+ G     P   +Q    D +F ++IT
Sbjct: 378 FVERLNSDIKPHVVI-----MFGPFLDVTHPLIASGNVPDFPDLKIQPKTLDEVFTKVIT 432

Query: 322 PEPRKPRFSVSYDIIP--LNARSLNAKQQDDIFD--LLAGTKNTPASTESGNLQSNEVLV 377
           P  +K    +S  +IP  L++ S +A    D  +  LL   KN    T     Q NE+ V
Sbjct: 433 PILKKIDSKISVILIPSTLDSASNHAAYPQDSLNRKLLQLPKNFKCFTNPSTFQLNELFV 492

Query: 378 NLSVQVSDKFSDAK 391
             S    D F D K
Sbjct: 493 GCS--NVDAFKDIK 504

>CAGL0F05489g 553902..555365 similar to tr|Q03944 Saccharomyces
           cerevisiae YDR200c or tr|Q06001 Saccharomyces cerevisiae
           YLR238w, hypothetical start
          Length = 487

 Score = 29.3 bits (64), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 21/31 (67%)

Query: 353 DLLAGTKNTPASTESGNLQSNEVLVNLSVQV 383
           DLL G   +P+S +S +L SN+VL+  ++ V
Sbjct: 446 DLLNGKTRSPSSIKSNDLSSNKVLITAAITV 476

>YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea
            amidolyase, contains urea carboxylase and allophanate
            hydrolase activities fused together in a single
            polypeptide [5508 bp, 1835 aa]
          Length = 1835

 Score = 29.3 bits (64), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 49   WK--FKVGEPFSAGDVLLEVETDKAQIDVEAQDDGKLAKILVNDG 91
            WK    VG+   AG  LL +E  KA++ + A   GK+ KI   +G
Sbjct: 1775 WKSIASVGDVIEAGQGLLIIEAMKAEMIISAPKSGKIIKICHGNG 1819

>Kwal_27.11951
          Length = 1869

 Score = 28.9 bits (63), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 49   WK--FKVGEPFSAGDVLLEVETDKAQIDVEAQDDGKLAKILVNDG 91
            WK    VG+   AGD L+ VE  K ++ V A   GK+ K++  +G
Sbjct: 1812 WKPLVSVGDVVKAGDGLIVVEAMKTEMMVSAPKGGKVLKVVHKNG 1856

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.130    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,692,765
Number of extensions: 553486
Number of successful extensions: 1750
Number of sequences better than 10.0: 64
Number of HSP's gapped: 1718
Number of HSP's successfully gapped: 66
Length of query: 405
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 301
Effective length of database: 12,995,837
Effective search space: 3911746937
Effective search space used: 3911746937
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 63 (28.9 bits)