Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_33.1543450549826560.0
Sklu_2014.150649922400.0
KLLA0E09812g50250121280.0
Scas_647.251150420950.0
YJR010W (MET3)51150420760.0
CAGL0B03839g50750120460.0
AGR322W50049817990.0
KLLA0B02827g94242740.65
CAGL0L05830g216101710.85
Kwal_26.9189172646665.1
KLLA0E03553g52769655.8
CAGL0H01727g533138648.0
YKL079W (SMY1)65649648.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.15434
         (498 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.15434                                                        1027   0.0  
Sklu_2014.1 YJR010W, Contig c2014 195-1715                            867   0.0  
KLLA0E09812g complement(870664..872172) highly similar to sp|P08...   824   0.0  
Scas_647.2                                                            811   0.0  
YJR010W (MET3) [2912] chr10 (456153..457688) ATP-sulfurylase (su...   804   0.0  
CAGL0B03839g 380291..381814 highly similar to sp|P08536 Saccharo...   792   0.0  
AGR322W [4633] [Homologous to ScYJR010W (MET3) - SH] complement(...   697   0.0  
KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces c...    33   0.65 
CAGL0L05830g 649514..650164 no similarity, hypothetical start          32   0.85 
Kwal_26.9189                                                           30   5.1  
KLLA0E03553g 329904..331487 highly similar to sp|P10614 Saccharo...    30   5.8  
CAGL0H01727g complement(165968..167569) similar to sp|P32474 Sac...    29   8.0  
YKL079W (SMY1) [3182] chr11 (286248..288218) Protein of the kine...    29   8.4  

>Kwal_33.15434
          Length = 505

 Score = 1027 bits (2656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/498 (100%), Positives = 498/498 (100%)

Query: 1   MPAPHGGILQDLIARDAQIKNQLLEEAAKAKITWDLTARQICDLELIQNGGFSPLSGFLN 60
           MPAPHGGILQDLIARDAQIKNQLLEEAAKAKITWDLTARQICDLELIQNGGFSPLSGFLN
Sbjct: 1   MPAPHGGILQDLIARDAQIKNQLLEEAAKAKITWDLTARQICDLELIQNGGFSPLSGFLN 60

Query: 61  QKDYESVVHNSRLSNDLVWTIPITLDVDAEFAKQLKPETRVTLLQDNEIPVAILTVTDVY 120
           QKDYESVVHNSRLSNDLVWTIPITLDVDAEFAKQLKPETRVTLLQDNEIPVAILTVTDVY
Sbjct: 61  QKDYESVVHNSRLSNDLVWTIPITLDVDAEFAKQLKPETRVTLLQDNEIPVAILTVTDVY 120

Query: 121 KPDKDVEAKKVFRGDPEHPAVKYLKETAGEYYVGGEIQAIQYPVHYDYPGLRKTPAQLRL 180
           KPDKDVEAKKVFRGDPEHPAVKYLKETAGEYYVGGEIQAIQYPVHYDYPGLRKTPAQLRL
Sbjct: 121 KPDKDVEAKKVFRGDPEHPAVKYLKETAGEYYVGGEIQAIQYPVHYDYPGLRKTPAQLRL 180

Query: 181 EFESKQWDRIVAFQTRNPMHRAHRELTVRAAREHNAKVLIHPVVGLTKPGDIDHHTRVRV 240
           EFESKQWDRIVAFQTRNPMHRAHRELTVRAAREHNAKVLIHPVVGLTKPGDIDHHTRVRV
Sbjct: 181 EFESKQWDRIVAFQTRNPMHRAHRELTVRAAREHNAKVLIHPVVGLTKPGDIDHHTRVRV 240

Query: 241 YQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGKNSAG 300
           YQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGKNSAG
Sbjct: 241 YQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGKNSAG 300

Query: 301 VDFYGAYDAQELVETYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDLSTTKTLNISGTEL 360
           VDFYGAYDAQELVETYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDLSTTKTLNISGTEL
Sbjct: 301 VDFYGAYDAQELVETYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDLSTTKTLNISGTEL 360

Query: 361 RNRLRSGGAIPEWFSYPEVVKILRESNPPRPQQGFAIVLSSALSNNKQLATALLSTFLQF 420
           RNRLRSGGAIPEWFSYPEVVKILRESNPPRPQQGFAIVLSSALSNNKQLATALLSTFLQF
Sbjct: 361 RNRLRSGGAIPEWFSYPEVVKILRESNPPRPQQGFAIVLSSALSNNKQLATALLSTFLQF 420

Query: 421 GGGRHYKVLEHSDESSVLELVPDFIRSGAGLIIPSEYKNASATTNAYQVGTSDGADIKLE 480
           GGGRHYKVLEHSDESSVLELVPDFIRSGAGLIIPSEYKNASATTNAYQVGTSDGADIKLE
Sbjct: 421 GGGRHYKVLEHSDESSVLELVPDFIRSGAGLIIPSEYKNASATTNAYQVGTSDGADIKLE 480

Query: 481 SNDESVLHVVQKVVLFLE 498
           SNDESVLHVVQKVVLFLE
Sbjct: 481 SNDESVLHVVQKVVLFLE 498

>Sklu_2014.1 YJR010W, Contig c2014 195-1715
          Length = 506

 Score =  867 bits (2240), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/499 (81%), Positives = 452/499 (90%), Gaps = 1/499 (0%)

Query: 1   MPAPHGGILQDLIARDAQIKNQLLEEAAKAKITWDLTARQICDLELIQNGGFSPLSGFLN 60
           MPAPHGG+LQDLIARDA IK QLL+EA+ +K+TW LT RQICDLELI NGGFSPL+GFLN
Sbjct: 1   MPAPHGGVLQDLIARDASIKPQLLQEASDSKLTWSLTGRQICDLELILNGGFSPLTGFLN 60

Query: 61  QKDYESVVHNSRLSNDLVWTIPITLDVDAEFAKQLKPETRVTLLQDNEIPVAILTVTDVY 120
           +KDY SVV++SRLSN LVWT+PITLDVD+EFA +L+ + R+ LLQ+NEIP+A LTVTDVY
Sbjct: 61  EKDYTSVVNDSRLSNGLVWTMPITLDVDSEFASKLQIDDRILLLQENEIPLAFLTVTDVY 120

Query: 121 KPDKDVEAKKVFRGDPEHPAVKYLKETAGEYYVGGEIQAIQYPVHYDYPGLRKTPAQLRL 180
           KPDK VEAKKVFRGDPEHPA+ YL   AGEYYVGGE+QAIQ P HYDYPGLR+TPAQLRL
Sbjct: 121 KPDKSVEAKKVFRGDPEHPAISYLNNIAGEYYVGGELQAIQLPQHYDYPGLRRTPAQLRL 180

Query: 181 EFESKQWDRIVAFQTRNPMHRAHRELTVRAAREHNAKVLIHPVVGLTKPGDIDHHTRVRV 240
           EF+SKQWDRIVAFQTRNPMHRAHRELTVRAARE NAK+LIHPVVGLTKPGDIDHHTRVRV
Sbjct: 181 EFDSKQWDRIVAFQTRNPMHRAHRELTVRAAREQNAKILIHPVVGLTKPGDIDHHTRVRV 240

Query: 241 YQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGKNSAG 300
           YQEIIKRYPNGMA LSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGKNS G
Sbjct: 241 YQEIIKRYPNGMAHLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGKNSKG 300

Query: 301 VDFYGAYDAQELVETYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDLSTTKTLNISGTEL 360
           VDFYGAYDAQELVE+YK+EL+IEVVPFRMVTYLPDEDRYAPIDQIDL+TTKTLNISGTEL
Sbjct: 301 VDFYGAYDAQELVESYKNELEIEVVPFRMVTYLPDEDRYAPIDQIDLATTKTLNISGTEL 360

Query: 361 RNRLRSGGAIPEWFSYPEVVKILRESNPPRPQQGFAIVLSSALSNNKQLATALLSTFLQF 420
           RNRLR GG IP WFSYPEVVKILRES+PPRP QGFA+VL  +L NNKQL+ ALLSTFLQF
Sbjct: 361 RNRLRDGGEIPAWFSYPEVVKILRESSPPRPNQGFAVVLDDSLKNNKQLSIALLSTFLQF 420

Query: 421 GGGRHYKVLEHSDES-SVLELVPDFIRSGAGLIIPSEYKNASATTNAYQVGTSDGADIKL 479
           GGGRHYK+  HS+ +  ++EL+PDFIRSGAGLI+P ++  +S  TN + VG +D A+IKL
Sbjct: 421 GGGRHYKIFNHSNNNEELVELIPDFIRSGAGLIVPGQFNGSSDATNVFTVGVADDAEIKL 480

Query: 480 ESNDESVLHVVQKVVLFLE 498
           ES DE +LHVVQKVVLFLE
Sbjct: 481 ESEDEPILHVVQKVVLFLE 499

>KLLA0E09812g complement(870664..872172) highly similar to sp|P08536
           Saccharomyces cerevisiae YJR010w MET3 sulfate
           adenylyltransferase singleton, start by similarity
          Length = 502

 Score =  824 bits (2128), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/501 (78%), Positives = 438/501 (87%), Gaps = 9/501 (1%)

Query: 1   MPAPHGGILQDLIARDAQIKNQLLEEAAKAKIT-WDLTARQICDLELIQNGGFSPLSGFL 59
           MP+PHGG+LQDL+ARDA  K +LLE A    +T W LTARQICDLELI NGGFSPL GFL
Sbjct: 1   MPSPHGGVLQDLVARDASKKAELLEIAQSGDLTSWSLTARQICDLELILNGGFSPLDGFL 60

Query: 60  NQKDYESVVHNSRLSNDLVWTIPITLDVDAEFAKQLKPETRVTLLQDNEIPVAILTVTDV 119
           NQ+DY+SVV  SRL N LVWTIPITLDVDAEFA QL P+ R+ LLQDNE P+AILTV+DV
Sbjct: 61  NQQDYQSVVEKSRLQNGLVWTIPITLDVDAEFASQLSPDQRIVLLQDNEFPLAILTVSDV 120

Query: 120 YKPDKDVEAKKVFRGDPEHPAVKYLKETAGEYYVGGEIQAIQYPVHYDYPGLRKTPAQLR 179
           Y+PDK VEAKKVFRGDPEHPAVKYL E AGE+YVGG ++AIQ PVHYDYPG RKTPAQLR
Sbjct: 121 YQPDKAVEAKKVFRGDPEHPAVKYLFEQAGEFYVGGSLEAIQLPVHYDYPGWRKTPAQLR 180

Query: 180 LEFESKQWDRIVAFQTRNPMHRAHRELTVRAAREHNAKVLIHPVVGLTKPGDIDHHTRVR 239
           LEFESKQWDR+VAFQTRNPMHRAHRELTVRAAR +N+K+LIHPVVGLTKPGDIDHHTRVR
Sbjct: 181 LEFESKQWDRVVAFQTRNPMHRAHRELTVRAARSNNSKILIHPVVGLTKPGDIDHHTRVR 240

Query: 240 VYQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGKNSA 299
           VYQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGA+HFIVGRDHAGPGKNS 
Sbjct: 241 VYQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK 300

Query: 300 GVDFYGAYDAQELVETYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDLSTTKTLNISGTE 359
           GVDFYG YDAQELVE+YK+ELDIEVVPFRMVTYLPDEDRYAPID+ID   T+TLNISGTE
Sbjct: 301 GVDFYGPYDAQELVESYKNELDIEVVPFRMVTYLPDEDRYAPIDEIDTDKTRTLNISGTE 360

Query: 360 LRNRLRSGGAIPEWFSYPEVVKILRESNPPRPQQGFAIVLSSALSNNKQLATALLSTFLQ 419
           LRNRLR GG IP WFSYPEVVKILRESNP RP+QGFA+VLS  L    QL TALLSTFLQ
Sbjct: 361 LRNRLRDGGEIPAWFSYPEVVKILRESNPSRPKQGFALVLSETLP--AQLKTALLSTFLQ 418

Query: 420 FGGGRHYKVLEHSDESSVLELVPDFIRSGAGLIIPSEYKNASAT--TNAYQVGTSDGADI 477
           +GGGRHYKVLEH +   +L LVPDF+RSG GLI+    +NAS+   TN +++G   G+DI
Sbjct: 419 YGGGRHYKVLEHGNNEEILALVPDFVRSGTGLIL----QNASSLKGTNVFKIGEESGSDI 474

Query: 478 KLESNDESVLHVVQKVVLFLE 498
            LE+ D+++LH+VQ+VVLFLE
Sbjct: 475 PLETEDKNILHIVQRVVLFLE 495

>Scas_647.2
          Length = 511

 Score =  811 bits (2095), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/504 (76%), Positives = 437/504 (86%), Gaps = 6/504 (1%)

Query: 1   MPAPHGGILQDLIARDAQIKNQLLEEAAKAKIT-WDLTARQICDLELIQNGGFSPLSGFL 59
           MPAPHGGILQDL+ARDA  K  L +EA    +  W LTARQICD+ELI NGGFSPL+GFL
Sbjct: 1   MPAPHGGILQDLVARDASKKAALSQEAQSGSLAQWTLTARQICDIELILNGGFSPLTGFL 60

Query: 60  NQKDYESVVHNSRLSNDLVWTIPITLDVDAEFAKQLKPETRVTLLQDNEIPVAILTVTDV 119
            +KDY SVV NSRL++  +WT+PITLDVD  FAK + P +R+TLLQD EIP+AILTVTDV
Sbjct: 61  TEKDYLSVVKNSRLADGTLWTMPITLDVDETFAKSVAPNSRITLLQDGEIPIAILTVTDV 120

Query: 120 YKPDKDVEAKKVFRGDPEHPAVKYLKETAGEYYVGGEIQAIQYPVHYDYPGLRKTPAQLR 179
           Y+PDK +EAK+VFRGDPEHPA++YL   AGEYY+GG ++AIQ P HYDYPGLRK PAQLR
Sbjct: 121 YRPDKALEAKEVFRGDPEHPAIRYLNNIAGEYYIGGSLEAIQLPQHYDYPGLRKAPAQLR 180

Query: 180 LEFESKQWDRIVAFQTRNPMHRAHRELTVRAAREHNAKVLIHPVVGLTKPGDIDHHTRVR 239
           LEF+S+QWDRIVAFQTRNPMHRAHRELTVRAARE NAKVLIHPVVGLTKPGDIDHHTRVR
Sbjct: 181 LEFQSRQWDRIVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR 240

Query: 240 VYQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGKNSA 299
           VYQEIIKRYPNG+A LSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPG NS 
Sbjct: 241 VYQEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGSNSK 300

Query: 300 GVDFYGAYDAQELVETYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDLSTTKTLNISGTE 359
           GVDFYG YDAQELVE+YK+ELDI+VVPFRMVTYLPDEDRYAPIDQID S T+TLNISGTE
Sbjct: 301 GVDFYGPYDAQELVESYKNELDIQVVPFRMVTYLPDEDRYAPIDQIDTSKTRTLNISGTE 360

Query: 360 LRNRLRSGGAIPEWFSYPEVVKILRESNPPRPQQGFAIVLSSALSN-NKQLATALLSTFL 418
           LR RLR GG IPEWFSYPEVVKILRESNPPRP+QGFAIVL  +L+  + QLA ALLSTFL
Sbjct: 361 LRKRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFAIVLEDSLNAPSGQLAIALLSTFL 420

Query: 419 QFGGGRHYKVLEHSDESSVLELVPDFIRSGAGLIIPSEY--KNAS--ATTNAYQVGTSDG 474
           QFGGGRHYKV EH +   +LEL+PDFI++G+GLI+P+++  KN S  A  N Y +G S  
Sbjct: 421 QFGGGRHYKVFEHENNDKLLELIPDFIQAGSGLIVPNQWTSKNVSFGADQNVYTLGASAN 480

Query: 475 ADIKLESNDESVLHVVQKVVLFLE 498
           +DIKL+S DE++ H+VQKVVLFLE
Sbjct: 481 SDIKLDSVDETIFHIVQKVVLFLE 504

>YJR010W (MET3) [2912] chr10 (456153..457688) ATP-sulfurylase
           (sulfate adenylyltransferase), catalyzes incorporation
           of inorganic sulfate into ATP to form adenosine
           5'-phosphosulfate (APS) [1536 bp, 511 aa]
          Length = 511

 Score =  804 bits (2076), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/504 (75%), Positives = 440/504 (87%), Gaps = 6/504 (1%)

Query: 1   MPAPHGGILQDLIARDAQIKNQLLEEAAKAKI-TWDLTARQICDLELIQNGGFSPLSGFL 59
           MPAPHGGILQDLIARDA  KN+LL EA  + I  W+LT RQ+CD+ELI NGGFSPL+GFL
Sbjct: 1   MPAPHGGILQDLIARDALKKNELLSEAQSSDILVWNLTPRQLCDIELILNGGFSPLTGFL 60

Query: 60  NQKDYESVVHNSRLSNDLVWTIPITLDVDAEFAKQLKPETRVTLLQDNEIPVAILTVTDV 119
           N+ DY SVV +SRL++  +WTIPITLDVD  FA Q+KP+TR+ L QD+EIP+AILTV DV
Sbjct: 61  NENDYSSVVTDSRLADGTLWTIPITLDVDEAFANQIKPDTRIALFQDDEIPIAILTVQDV 120

Query: 120 YKPDKDVEAKKVFRGDPEHPAVKYLKETAGEYYVGGEIQAIQYPVHYDYPGLRKTPAQLR 179
           YKP+K +EA+KVFRGDPEHPA+ YL   AG+YYVGG ++AIQ P HYDYPGLRKTPAQLR
Sbjct: 121 YKPNKTIEAEKVFRGDPEHPAISYLFNVAGDYYVGGSLEAIQLPQHYDYPGLRKTPAQLR 180

Query: 180 LEFESKQWDRIVAFQTRNPMHRAHRELTVRAAREHNAKVLIHPVVGLTKPGDIDHHTRVR 239
           LEF+S+QWDR+VAFQTRNPMHRAHRELTVRAARE NAKVLIHPVVGLTKPGDIDHHTRVR
Sbjct: 181 LEFQSRQWDRVVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR 240

Query: 240 VYQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGKNSA 299
           VYQEIIKRYPNG+A LSLLPLAMRM GDREAVWHAIIRKNYGA+HFIVGRDHAGPGKNS 
Sbjct: 241 VYQEIIKRYPNGIAFLSLLPLAMRMSGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK 300

Query: 300 GVDFYGAYDAQELVETYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDLSTTKTLNISGTE 359
           GVDFYG YDAQELVE+YKHELDIEVVPFRMVTYLPDEDRYAPIDQID + T+TLNISGTE
Sbjct: 301 GVDFYGPYDAQELVESYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDTTKTRTLNISGTE 360

Query: 360 LRNRLRSGGAIPEWFSYPEVVKILRESNPPRPQQGFAIVLSSALS-NNKQLATALLSTFL 418
           LR RLR GG IPEWFSYPEVVKILRESNPPRP+QGF+IVL ++L+ + +QL+ ALLSTFL
Sbjct: 361 LRRRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFSIVLGNSLTVSREQLSIALLSTFL 420

Query: 419 QFGGGRHYKVLEHSDESSVLELVPDFIRSGAGLIIPSEYKNASATT----NAYQVGTSDG 474
           QFGGGR+YK+ EH++++ +L L+ DFI SG+GLIIP+++++   +     N Y + TS  
Sbjct: 421 QFGGGRYYKIFEHNNKTELLSLIQDFIGSGSGLIIPNQWEDDKDSVVGKQNVYLLDTSSS 480

Query: 475 ADIKLESNDESVLHVVQKVVLFLE 498
           ADI+LES DE + H+VQKVVLFLE
Sbjct: 481 ADIQLESADEPISHIVQKVVLFLE 504

>CAGL0B03839g 380291..381814 highly similar to sp|P08536
           Saccharomyces cerevisiae YJR010w MET3, start by
           similarity
          Length = 507

 Score =  792 bits (2046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/501 (74%), Positives = 429/501 (85%), Gaps = 4/501 (0%)

Query: 1   MPAPHGGILQDLIARDAQIKNQLLEEAAKAKITWDLTARQICDLELIQNGGFSPLSGFLN 60
           MPAPHGG+LQDL+ARDA  ++ LL E+ +    W LTARQICD+ELI NGGFSPL+GFL 
Sbjct: 1   MPAPHGGVLQDLVARDASKRDSLLSESQQLS-QWTLTARQICDIELILNGGFSPLTGFLA 59

Query: 61  QKDYESVVHNSRLSNDLVWTIPITLDVDAEFAKQLKPETRVTLLQDNEIPVAILTVTDVY 120
           Q+DY  VVHNSRLS+  +WT+PITLDV  +FA  +KP  R+ LLQD  IPVAILTV D+Y
Sbjct: 60  QEDYNGVVHNSRLSDGTLWTMPITLDVPEQFANSVKPNQRIALLQDGTIPVAILTVKDIY 119

Query: 121 KPDKDVEAKKVFRGDPEHPAVKYLKETAGEYYVGGEIQAIQYPVHYDYPGLRKTPAQLRL 180
           KPDK VEA+KVFRGDPEHPA+ YL  TAG+YY+GG + AIQ P HYDYPGLRKTPAQLRL
Sbjct: 120 KPDKSVEAEKVFRGDPEHPAINYLFNTAGDYYIGGALDAIQLPQHYDYPGLRKTPAQLRL 179

Query: 181 EFESKQWDRIVAFQTRNPMHRAHRELTVRAAREHNAKVLIHPVVGLTKPGDIDHHTRVRV 240
           EF+S+QWDR+VAFQTRNPMHRAHRELTVRAARE NAKVLIHPVVGLTKPGDIDHHTRVRV
Sbjct: 180 EFQSRQWDRVVAFQTRNPMHRAHRELTVRAARETNAKVLIHPVVGLTKPGDIDHHTRVRV 239

Query: 241 YQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGKNSAG 300
           YQEIIKRYPNG+A LSLLPLAMRMGGDREAVWHAIIRKNYGA+HFIVGRDHAGPG NS G
Sbjct: 240 YQEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGSNSKG 299

Query: 301 VDFYGAYDAQELVETYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDLSTTKTLNISGTEL 360
           VDFYG YDAQELVE+YK+ELDI+VVPFRMVTYLPDEDRYAPID+ID S T+TLNISGTEL
Sbjct: 300 VDFYGPYDAQELVESYKNELDIDVVPFRMVTYLPDEDRYAPIDEIDTSKTRTLNISGTEL 359

Query: 361 RNRLRSGGAIPEWFSYPEVVKILRESNPPRPQQGFAIVLSSALSNNK-QLATALLSTFLQ 419
           R RLR GG IPEWFSYPEVVKILRESNPPRP+QGFA+V +  +  ++ QL+ ALLSTFLQ
Sbjct: 360 RKRLRDGGEIPEWFSYPEVVKILRESNPPRPKQGFALVFNDDIKVDRDQLSIALLSTFLQ 419

Query: 420 FGGGRHYKVLEHSDESSVLELVPDFIRSGAGLIIPSEY--KNASATTNAYQVGTSDGADI 477
           FGGGRHYK+ +H+D+   LEL+ DF+++G+GLIIPS +   N   + N Y +G +  ADI
Sbjct: 420 FGGGRHYKIYDHNDKPEFLELISDFVQAGSGLIIPSTWSASNKVNSANVYTIGHAKDADI 479

Query: 478 KLESNDESVLHVVQKVVLFLE 498
           KL S +E++ H+VQKVVLFLE
Sbjct: 480 KLASTEETIFHIVQKVVLFLE 500

>AGR322W [4633] [Homologous to ScYJR010W (MET3) - SH]
           complement(1332643..1334145) [1503 bp, 500 aa]
          Length = 500

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/498 (66%), Positives = 408/498 (81%), Gaps = 5/498 (1%)

Query: 1   MPAPHGGILQDLIARDAQIKNQLLEEAAKAKITWDLTARQICDLELIQNGGFSPLSGFLN 60
           M +PHGGILQDL+ARDA+ K++LL EA +    W+LTARQ+CD+ELI NGGFSPL+GFL 
Sbjct: 1   MLSPHGGILQDLVARDAEKKDRLLHEA-QGLPQWNLTARQLCDIELILNGGFSPLTGFLG 59

Query: 61  QKDYESVVHNSRLSNDLVWTIPITLDVDAEFAKQLKPETRVTLLQDNEIPVAILTVTDVY 120
           ++DYESVV NSRL++ L+WTIPITLDVD EFAK +    R+ LLQD++I VAI+TV+D+Y
Sbjct: 60  KEDYESVVQNSRLTSGLLWTIPITLDVDEEFAKSVNLGERIALLQDDDIFVAIITVSDIY 119

Query: 121 KPDKDVEAKKVFRGDPEHPAVKYLKETAGEYYVGGEIQAIQYPVHYDYPGLRKTPAQLRL 180
            PDK VEA KVFRGD EHPA++YL ETAG+ Y+GGE++AIQ P HYDY  LRK+PA LR 
Sbjct: 120 TPDKKVEADKVFRGDEEHPAIQYLNETAGDIYLGGELEAIQLPAHYDYLNLRKSPAALRA 179

Query: 181 EFESKQWDRIVAFQTRNPMHRAHRELTVRAAREHNAKVLIHPVVGLTKPGDIDHHTRVRV 240
           +F ++QWDR+VAFQTRNPMHRAHRELT+RAA+EHNAKVL+HPVVGLTKPGDID+HTR++V
Sbjct: 180 DFATQQWDRVVAFQTRNPMHRAHRELTIRAAKEHNAKVLLHPVVGLTKPGDIDYHTRIKV 239

Query: 241 YQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGKNSAG 300
           Y+EI+KRYP G+AQL+LLPLAMRM GDREAVWHAIIRKNYGATHFIVGRDHAGPG NS G
Sbjct: 240 YKEIVKRYPEGIAQLALLPLAMRMAGDREAVWHAIIRKNYGATHFIVGRDHAGPGTNSKG 299

Query: 301 VDFYGAYDAQELVETYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDLSTTKTLNISGTEL 360
            DFYG YDAQ LVE+YK+EL IEVVPF+++TYLPD+D Y P+D+ID  + KTL ISGTEL
Sbjct: 300 DDFYGPYDAQVLVESYKNELGIEVVPFKLITYLPDKDIYLPVDEID-GSVKTLTISGTEL 358

Query: 361 RNRLRSGGAIPEWFSYPEVVKILRESNPPRPQQGFAIVLSSALSNNKQLATALLSTFLQF 420
           R RLR G  IP+WF+YPE+V+ILR+ NPPR +QGF IV++    N K++A ALLSTFLQ 
Sbjct: 359 RKRLREGTDIPDWFTYPEIVEILRQYNPPRYRQGFVIVVNH--ENPKRIANALLSTFLQV 416

Query: 421 GGGRHYKVLEHSDESSVLELVPDFIRSGAGLIIPSEYKNASATTNAYQVGTSDGADIKLE 480
           GGGR YK+ +H  +  +LEL+PDF++SG GLI+ S   ++    N Y++ T   A IK+ 
Sbjct: 417 GGGRQYKIFDHQGQPQLLELIPDFVKSGTGLIVTSPLPSSVDAHNIYELNTYPSAHIKV- 475

Query: 481 SNDESVLHVVQKVVLFLE 498
           S  E V  +VQK V FLE
Sbjct: 476 SATEPVTEIVQKTVFFLE 493

>KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces
           cerevisiae YLR409c singleton, start by similarity
          Length = 942

 Score = 33.1 bits (74), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 3/42 (7%)

Query: 231 DIDHHTRVRVYQEIIKRYPNGMAQLSLL---PLAMRMGGDRE 269
           D+DH +RV+V + I K    G+A+ S L   P+ +  GGD +
Sbjct: 279 DLDHRSRVQVLKGIHKEVNGGVARASFLNGQPIVVTCGGDNQ 320

>CAGL0L05830g 649514..650164 no similarity, hypothetical start
          Length = 216

 Score = 32.0 bits (71), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 45/101 (44%), Gaps = 23/101 (22%)

Query: 276 IRKNYGATHFIVGRDHAGPGKNSAGVDFYGAYDAQELVETYKHELDIEVVPFRMVTYLPD 335
           +++N    H+++      P  NS    FY  Y+    VE    +LD +   FR       
Sbjct: 59  MKQNSEIVHYLL------PFLNSLIKSFYSFYEHINDVE----QLDFQFSQFRKSM---- 104

Query: 336 EDRYAPIDQIDLSTTKTLNISGTELRNRLRSGGAIPEWFSY 376
              ++P+ +   +TT+T ++ GTE+ N+        EW+ Y
Sbjct: 105 --TFSPVCKFSHNTTQTKDLVGTEVVNK-------NEWYEY 136

>Kwal_26.9189
          Length = 1726

 Score = 30.0 bits (66), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 24/46 (52%)

Query: 19  IKNQLLEEAAKAKITWDLTARQICDLELIQNGGFSPLSGFLNQKDY 64
           I NQL+EE      T     + I D   I + G   ++GF+++KDY
Sbjct: 240 ITNQLVEEDLVRNCTVQCAVKSIEDHGAILDLGIEGITGFISKKDY 285

>KLLA0E03553g 329904..331487 highly similar to sp|P10614
           Saccharomyces cerevisiae YHR007c ERG11 cytochrome P450
           lanosterol 14a-demethylase, start by similarity
          Length = 527

 Score = 29.6 bits (65), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 9/69 (13%)

Query: 385 ESNPPRPQQGFAIVLSSALSNNK------QLATALLSTFLQFGGGRHYKVLEHSDESSVL 438
           E NP R     A   SS  SN K       ++  + S +L FGGGRH  + EH     + 
Sbjct: 426 EFNPNRWDNDAA---SSYASNEKVDYGFGSISKGVSSPYLPFGGGRHRCIGEHFAYMQLG 482

Query: 439 ELVPDFIRS 447
            ++ ++IR+
Sbjct: 483 TILSNYIRT 491

>CAGL0H01727g complement(165968..167569) similar to sp|P32474
           Saccharomyces cerevisiae YDR518w EUG1 protein disulfide
           isomerase, start by similarity
          Length = 533

 Score = 29.3 bits (64), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 56/138 (40%), Gaps = 17/138 (12%)

Query: 321 DIEVVPFR--MVTYLPDEDRYAPIDQIDLSTTKTLNISGTELRNRLRSGGAIPEWFSYPE 378
           DIE   F+  M T LP    Y    Q     T   N  G + R +L   G  P  F   E
Sbjct: 235 DIEAADFKNYMATKLPIAYFYYSTPQELNDFTGLFNELGEKYRGKLNFVGMNPHKFQ--E 292

Query: 379 VVKILRESNPPRPQQGFAIVLSSALSNNKQLATALLSTFLQFGGGRHYKVLEHSDESSVL 438
            +K+L        +Q F + +   ++NN      L  T  QF      KV++  +   + 
Sbjct: 293 HLKLLNL------KQRFPLFVIHNVNNN------LKYTLDQFTDESD-KVMKKLESEDIK 339

Query: 439 ELVPDFIRSGAGLIIPSE 456
           +LV DF+   A  II SE
Sbjct: 340 KLVEDFVEGKAQPIIKSE 357

>YKL079W (SMY1) [3182] chr11 (286248..288218) Protein of the kinesin
           family, can interact with or substitute for Myo2p [1971
           bp, 656 aa]
          Length = 656

 Score = 29.3 bits (64), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 22/49 (44%), Gaps = 10/49 (20%)

Query: 187 WDRIVAFQTRNPMHRAHRE----------LTVRAAREHNAKVLIHPVVG 225
           ++  V F+T NP+H   +E              A +E   K L+HP++ 
Sbjct: 52  YENTVLFRTNNPLHETTKETHSTFQFDKVFDANATQEDVQKFLVHPIIN 100

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.136    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,755,251
Number of extensions: 735172
Number of successful extensions: 1869
Number of sequences better than 10.0: 16
Number of HSP's gapped: 1902
Number of HSP's successfully gapped: 16
Length of query: 498
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 392
Effective length of database: 12,926,601
Effective search space: 5067227592
Effective search space used: 5067227592
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)