Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_33.152991961947531e-103
Sklu_1938.51961946912e-93
YLR009W (RLP24)1991366809e-92
KLLA0E09416g1981366801e-91
CAGL0J00957g1971366722e-90
ADR346W1971366643e-89
Scas_533.41961366626e-89
Sklu_1642.21491051606e-14
YGR148C (RPL24B)155571591e-13
YGL031C (RPL24A)155571572e-13
Kwal_14.22991551041554e-13
CAGL0A01562g1551041536e-13
AFR477C1551051484e-12
KLLA0E10857g155571476e-12
Scas_648.9155901423e-11
Scas_4.166521311e-10
KLLA0C11055g54864661.2
CAGL0L12584g29489614.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.15299
         (194 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.15299                                                         294   e-103
Sklu_1938.5 YLR009W, Contig c1938 7059-7649                           270   2e-93
YLR009W (RLP24) [3427] chr12 (166536..167135) Possible ribosomal...   266   9e-92
KLLA0E09416g complement(836948..837544) similar to sgd|S0003999 ...   266   1e-91
CAGL0J00957g 96608..97201 highly similar to tr|Q07915 Saccharomy...   263   2e-90
ADR346W [2087] [Homologous to ScYLR009W (RLP24) - SH] complement...   260   3e-89
Scas_533.4                                                            259   6e-89
Sklu_1642.2 YGR148C, Contig c1642 2421-2870 reverse complement         66   6e-14
YGR148C (RPL24B) [2103] chr7 complement(787315..787782) Ribosoma...    66   1e-13
YGL031C (RPL24A) [1943] chr7 complement(437470..437937) Ribosoma...    65   2e-13
Kwal_14.2299                                                           64   4e-13
CAGL0A01562g 152953..153420 highly similar to sp|P24000 Saccharo...    64   6e-13
AFR477C [3669] [Homologous to ScYGL031C (RPL24A) - SH; ScYGR148C...    62   4e-12
KLLA0E10857g 957487..957954 gi|730554|sp|P38665|RL24_KLULA Kluyv...    61   6e-12
Scas_648.9                                                             59   3e-11
Scas_4.1                                                               55   1e-10
KLLA0C11055g complement(950647..952293) similar to sp|P38775 Sac...    30   1.2  
CAGL0L12584g complement(1351867..1352751) similar to tr|Q03080 S...    28   4.4  

>Kwal_33.15299
          Length = 196

 Score =  294 bits (753), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 152/194 (78%)

Query: 1   MRVYSCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLRWTKAFRKAAG 60
           MRVYSCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLRWTKAFRKAAG
Sbjct: 1   MRVYSCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLRWTKAFRKAAG 60

Query: 61  KELAVDSTLAFAQRRNVPVRYNRELVATTLRAMARVEEIRQRRERAFYKNRMRGNKEREF 120
           KELAVDSTLAFAQRRNVPVRYNRELVATTLRAMARVEEIRQRRERAFYKNRMRGNKEREF
Sbjct: 61  KELAVDSTLAFAQRRNVPVRYNRELVATTLRAMARVEEIRQRRERAFYKNRMRGNKEREF 120

Query: 121 LRDKQLVERNPELLKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQ 180
           LRDKQLVERNPELLKV                                          KQ
Sbjct: 121 LRDKQLVERNPELLKVRDVELDRAEARAAAREAESEEEMDVDSEAESESEQESEAEREKQ 180

Query: 181 AVVLTTKRKNTKKL 194
           AVVLTTKRKNTKKL
Sbjct: 181 AVVLTTKRKNTKKL 194

>Sklu_1938.5 YLR009W, Contig c1938 7059-7649
          Length = 196

 Score =  270 bits (691), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 135/194 (69%), Positives = 143/194 (73%)

Query: 1   MRVYSCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLRWTKAFRKAAG 60
           MR+YSCHFCSSP YP HGIMFVRNDAKEFRFCRSKCHK FKQRRNPRKL+WTKAFRKAAG
Sbjct: 1   MRIYSCHFCSSPVYPSHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60

Query: 61  KELAVDSTLAFAQRRNVPVRYNRELVATTLRAMARVEEIRQRRERAFYKNRMRGNKEREF 120
           KELAVDSTL FAQRRNVPVRYNRELVATTL+AM+R+EEIRQRRERAFYKNRMRGNKEREF
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQRRERAFYKNRMRGNKEREF 120

Query: 121 LRDKQLVERNPELLKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQ 180
           LRDK LVE NPELLKV                                          KQ
Sbjct: 121 LRDKSLVESNPELLKVREVEIANKLASKEAEEQDEEMDVDSEEEIDVESEEESEEEQEKQ 180

Query: 181 AVVLTTKRKNTKKL 194
            V+L  KRKN+KK+
Sbjct: 181 KVLLKNKRKNSKKI 194

>YLR009W (RLP24) [3427] chr12 (166536..167135) Possible ribosomal
           protein with similarity to ribosomal protein L24 [600
           bp, 199 aa]
          Length = 199

 Score =  266 bits (680), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 122/136 (89%), Positives = 132/136 (97%)

Query: 1   MRVYSCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLRWTKAFRKAAG 60
           MR+Y CHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHK FKQRRNPRKL+WTKAFRKAAG
Sbjct: 1   MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60

Query: 61  KELAVDSTLAFAQRRNVPVRYNRELVATTLRAMARVEEIRQRRERAFYKNRMRGNKEREF 120
           KELAVDSTL FAQRRNVPVRYNRELVATTL+AMAR+EEIRQ+RERAFYKNRMRGNKE++F
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMARIEEIRQKRERAFYKNRMRGNKEKDF 120

Query: 121 LRDKQLVERNPELLKV 136
           LRDK+LVE NPELL++
Sbjct: 121 LRDKKLVESNPELLRI 136

>KLLA0E09416g complement(836948..837544) similar to sgd|S0003999
           Saccharomyces cerevisiae YLR009w, start by similarity
          Length = 198

 Score =  266 bits (680), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 123/136 (90%), Positives = 131/136 (96%)

Query: 1   MRVYSCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLRWTKAFRKAAG 60
           MRVY+CHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHK FKQRRNPRKLRWTKAFRKAAG
Sbjct: 1   MRVYACHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLRWTKAFRKAAG 60

Query: 61  KELAVDSTLAFAQRRNVPVRYNRELVATTLRAMARVEEIRQRRERAFYKNRMRGNKEREF 120
           KELAVDSTL FAQRRNVPVRYNRELVATTL+AM+R+EEIRQRRERAFYKNRM+GN ER+F
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQRRERAFYKNRMKGNNERDF 120

Query: 121 LRDKQLVERNPELLKV 136
           LRDK LVE NPELL++
Sbjct: 121 LRDKALVESNPELLRL 136

>CAGL0J00957g 96608..97201 highly similar to tr|Q07915 Saccharomyces
           cerevisiae YLR009w, start by similarity
          Length = 197

 Score =  263 bits (672), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 131/136 (96%)

Query: 1   MRVYSCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLRWTKAFRKAAG 60
           MR+Y CHFCSSP YPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKL+WTKAFRKAAG
Sbjct: 1   MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLKWTKAFRKAAG 60

Query: 61  KELAVDSTLAFAQRRNVPVRYNRELVATTLRAMARVEEIRQRRERAFYKNRMRGNKEREF 120
           KELAVDSTL FAQRRNVPVRYNRELVATTL+AM+R+EEIRQ+RERAFYKNRM+GN ER+F
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQKRERAFYKNRMKGNSERDF 120

Query: 121 LRDKQLVERNPELLKV 136
           LRDK+LVE NPELL++
Sbjct: 121 LRDKKLVETNPELLRL 136

>ADR346W [2087] [Homologous to ScYLR009W (RLP24) - SH]
           complement(1316666..1317259) [594 bp, 197 aa]
          Length = 197

 Score =  260 bits (664), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 119/136 (87%), Positives = 129/136 (94%)

Query: 1   MRVYSCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLRWTKAFRKAAG 60
           MR+YSCHFCSSP YPGHGIMFVRNDAKEFRFCRSKCHK FKQRRNPRKL+WTKAFRKAAG
Sbjct: 1   MRIYSCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60

Query: 61  KELAVDSTLAFAQRRNVPVRYNRELVATTLRAMARVEEIRQRRERAFYKNRMRGNKEREF 120
           KELAVDSTL FAQRRNVPVRYNRELV TTL+AM R+EEIRQ+RERAFYKNRM+GN E++F
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVETTLKAMTRIEEIRQKRERAFYKNRMKGNTEKDF 120

Query: 121 LRDKQLVERNPELLKV 136
           LRDK+LVE NPELLK+
Sbjct: 121 LRDKKLVESNPELLKM 136

>Scas_533.4
          Length = 196

 Score =  259 bits (662), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 119/136 (87%), Positives = 131/136 (96%)

Query: 1   MRVYSCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLRWTKAFRKAAG 60
           MR+Y CHFCSSP YPGHGIMFVRNDAKEFRFCRSKCHK+FKQRRNPRKL+WTKAFRKAAG
Sbjct: 1   MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKSFKQRRNPRKLKWTKAFRKAAG 60

Query: 61  KELAVDSTLAFAQRRNVPVRYNRELVATTLRAMARVEEIRQRRERAFYKNRMRGNKEREF 120
           KELAVDSTL FAQRRNVPVRYNREL+ATTL+AM+R+EEIR +RERAFYKNRMRGNKER+F
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELMATTLKAMSRIEEIRVKRERAFYKNRMRGNKERDF 120

Query: 121 LRDKQLVERNPELLKV 136
           LRDK+LVE NPELL++
Sbjct: 121 LRDKKLVEANPELLRM 136

>Sklu_1642.2 YGR148C, Contig c1642 2421-2870 reverse complement
          Length = 149

 Score = 66.2 bits (160), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 57/105 (54%), Gaps = 11/105 (10%)

Query: 1   MRVYSCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLRWTKAFRKAAG 60
           M+V    F  +  YPG G +FVR D+K FRF  SK    FKQR+NPRK+ WT  +R+   
Sbjct: 1   MKVEVDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRKIAWTVLYRRHHK 60

Query: 61  KELAVDSTLAFAQRRN-VPVRYNRELVATTLRAMARVEEIRQRRE 104
           K +    T   A++R+   V+  R +V  +L      E I+QRR 
Sbjct: 61  KGI----TEEVAKKRSRKTVKAQRAIVGASL------EFIKQRRS 95

>YGR148C (RPL24B) [2103] chr7 complement(787315..787782) Ribosomal
          protein L24B (yeast L30; rp29; YL21; rat L24), nearly
          identical to Rpl24Ap [468 bp, 155 aa]
          Length = 155

 Score = 65.9 bits (159), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 36/57 (63%)

Query: 1  MRVYSCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLRWTKAFRK 57
          M+V    F  +  YPG G +FVR D+K FRF  SK    FKQR+NPR++ WT  FRK
Sbjct: 1  MKVEVDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRIAWTVLFRK 57

>YGL031C (RPL24A) [1943] chr7 complement(437470..437937) Ribosomal
          protein L24A (yeast L30; rp29; YL21; rat L24), nearly
          identical to Rpl24Bp [468 bp, 155 aa]
          Length = 155

 Score = 65.1 bits (157), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 36/57 (63%)

Query: 1  MRVYSCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLRWTKAFRK 57
          M+V    F  +  YPG G +FVR D+K FRF  SK    FKQR+NPR++ WT  FRK
Sbjct: 1  MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRIAWTVLFRK 57

>Kwal_14.2299
          Length = 155

 Score = 64.3 bits (155), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 57/104 (54%), Gaps = 11/104 (10%)

Query: 1   MRVYSCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLRWTKAFRKAAG 60
           M+V    F  +  YPG G +FVR D+K FRF  SK    FKQR+NPR++ WT  +R+   
Sbjct: 1   MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSSSLFKQRKNPRRIAWTVLYRRHHK 60

Query: 61  KELAVDSTLAFAQRRN-VPVRYNRELVATTLRAMARVEEIRQRR 103
           K +    T   A++R+   V+  R +V  +L      E I++RR
Sbjct: 61  KGI----TEEVAKKRSRKTVKSQRAIVGASL------EFIKERR 94

>CAGL0A01562g 152953..153420 highly similar to sp|P24000
           Saccharomyces cerevisiae YGR148c RPL30B or sp|P04449
           Saccharomyces cerevisiae YGL031c RPL30A, start by
           similarity
          Length = 155

 Score = 63.5 bits (153), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 57/104 (54%), Gaps = 11/104 (10%)

Query: 1   MRVYSCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLRWTKAFRKAAG 60
           M+V    F  +  YPG G +FVR D+K FRF  SK    FKQR+NPR++ WT  +R+   
Sbjct: 1   MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRVAWTVLYRRHHK 60

Query: 61  KELAVDSTLAFAQRRN-VPVRYNRELVATTLRAMARVEEIRQRR 103
           K +    T   A++R+   V+  R +V  +L      E I++RR
Sbjct: 61  KGI----TEEVAKKRSRKTVKAQRAIVGASL------ELIKERR 94

>AFR477C [3669] [Homologous to ScYGL031C (RPL24A) - SH; ScYGR148C
           (RPL24B) - SH] (1296295..1296762) [468 bp, 155 aa]
          Length = 155

 Score = 61.6 bits (148), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 56/105 (53%), Gaps = 11/105 (10%)

Query: 1   MRVYSCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLRWTKAFRKAAG 60
           M+V    F  +  YPG G +FVR D+K FRF  SK    F QR+NPR++ WT  +R+   
Sbjct: 1   MKVEIDSFSGAKIYPGRGTLFVRGDSKVFRFHSSKSASLFHQRKNPRRIAWTVLYRRHHK 60

Query: 61  KELAVDSTLAFAQRRN-VPVRYNRELVATTLRAMARVEEIRQRRE 104
           K +    T   A++R+   V+  R +V  +L      E I++RR 
Sbjct: 61  KGI----TEEVAKKRSRKTVKAQRAVVGASL------ELIKERRS 95

>KLLA0E10857g 957487..957954 gi|730554|sp|P38665|RL24_KLULA
          Kluyveromyces lactis 60S RIBOSOMAL PROTEIN L24 (L30),
          start by similarity
          Length = 155

 Score = 61.2 bits (147), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 35/57 (61%)

Query: 1  MRVYSCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLRWTKAFRK 57
          M+V    F  +  YPG G +FVR D+K FRF  SK    F QR+NPR++ WT  +R+
Sbjct: 1  MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQSSKSASLFHQRKNPRRIAWTVLYRR 57

>Scas_648.9
          Length = 155

 Score = 59.3 bits (142), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 48/90 (53%), Gaps = 3/90 (3%)

Query: 1  MRVYSCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLRWTKAFRKAAG 60
          M+V    F  +  YPG G +F+R D+K FRF  SK    F QR+NPR++ WT  +R+   
Sbjct: 1  MKVEIDSFSGNKIYPGRGTLFIRGDSKIFRFQNSKSASLFHQRKNPRRVAWTVLYRRHHK 60

Query: 61 KELAVDSTLAFAQRRNVPVRYNRELVATTL 90
          K +  + +    +R    V+  R +V  +L
Sbjct: 61 KGITEEVS---KKRTRKAVKAQRPIVGASL 87

>Scas_4.1
          Length = 66

 Score = 55.1 bits (131), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 32/52 (61%)

Query: 1  MRVYSCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLRWT 52
          M+V    F  +  YPG G +F+R D+K FRF  SK    F QR+NPR++ WT
Sbjct: 3  MKVEIDSFSGNKIYPGRGTLFIRGDSKIFRFQNSKSASLFHQRKNPRRVAWT 54

>KLLA0C11055g complement(950647..952293) similar to sp|P38775
           Saccharomyces cerevisiae YHR045w hypothetical protein
           singleton, start by similarity
          Length = 548

 Score = 30.0 bits (66), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 2/64 (3%)

Query: 49  LRWTKAFRKAAGKELAVDSTLAFAQRRNVPVRYNRELVATTLRAMARVEEIRQRRERAFY 108
           + W    +      + V ST+ F    +V +   R+L   +L A + VE +R+  E A Y
Sbjct: 2   VDWITFSKYLVAILVIVASTVWFIN--SVIIDSKRDLHTISLNAQSNVESVRKEHETAIY 59

Query: 109 KNRM 112
           +N +
Sbjct: 60  RNLL 63

>CAGL0L12584g complement(1351867..1352751) similar to tr|Q03080
           Saccharomyces cerevisiae YPL039w, hypothetical start
          Length = 294

 Score = 28.1 bits (61), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 41/89 (46%), Gaps = 11/89 (12%)

Query: 20  MFVRNDAKEFRFCRSKCHKNFKQRRNPRKLRWTKAFRK--AAGKELA---------VDST 68
           + +R   ++++  R K  K+ ++ R+PR ++ T    +  A   +LA         + ST
Sbjct: 153 ILIRRSREQYKAIRYKQMKDARRERDPRIIQLTNDMNEDTATMSDLALHNFLEPFDITST 212

Query: 69  LAFAQRRNVPVRYNRELVATTLRAMARVE 97
             F +R N+       L A+ +  M+R +
Sbjct: 213 FTFTKRNNIGTSAPASLGASMMLNMSRTD 241

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.135    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,511,866
Number of extensions: 149440
Number of successful extensions: 509
Number of sequences better than 10.0: 22
Number of HSP's gapped: 509
Number of HSP's successfully gapped: 23
Length of query: 194
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 98
Effective length of database: 13,272,781
Effective search space: 1300732538
Effective search space used: 1300732538
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 59 (27.3 bits)