Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_33.152981711707341e-100
YLR008C (PAM18)1681664553e-58
Sklu_1938.41641674283e-54
Scas_590.71581674266e-54
KLLA0E09438g1631674213e-53
CAGL0J00935g1531244022e-50
ADR345C1581673927e-49
AGR393W142731822e-17
YNL328C (MDJ2)146691795e-17
CAGL0D02552g143661771e-16
Scas_716.46144661761e-16
Sklu_2034.5142681726e-16
KLLA0E02024g146631603e-14
Kwal_55.22136145751586e-14
KLLA0F13860g13971820.004
KLLA0C02981g16222579.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.15298
         (170 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.15298                                                         287   e-100
YLR008C (PAM18) [3426] chr12 complement(165576..166082) Protein ...   179   3e-58
Sklu_1938.4 YLR008C, Contig c1938 6198-6692 reverse complement        169   3e-54
Scas_590.7                                                            168   6e-54
KLLA0E09438g 838259..838750 similar to sgd|S0003998 Saccharomyce...   166   3e-53
CAGL0J00935g complement(95878..96339) highly similar to tr|Q0791...   159   2e-50
ADR345C [2086] [Homologous to ScYLR008C - SH] (1315746..1316222)...   155   7e-49
AGR393W [4704] [Homologous to ScYNL328C (MDJ2) - SH] complement(...    75   2e-17
YNL328C (MDJ2) [4287] chr14 complement(22834..23274) Protein inv...    74   5e-17
CAGL0D02552g 261991..262422 similar to sp|P42834 Saccharomyces c...    73   1e-16
Scas_716.46                                                            72   1e-16
Sklu_2034.5 YNL328C, Contig c2034 7065-7493 reverse complement         71   6e-16
KLLA0E02024g complement(191062..191502) similar to sp|P42834 Sac...    66   3e-14
Kwal_55.22136                                                          65   6e-14
KLLA0F13860g 1284278..1284697 similar to sp|P42949 Saccharomyces...    36   0.004
KLLA0C02981g 268669..269157 similar to sp|P47138 Saccharomyces c...    27   9.7  

>Kwal_33.15298
          Length = 171

 Score =  287 bits (734), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 144/170 (84%), Positives = 144/170 (84%)

Query: 1   MAGIEAPQLPIPGQAGVDTNTSSQEPVWSXXXXXXXXXMVGKIANASNEKGGMDQAFDDA 60
           MAGIEAPQLPIPGQAGVDTNTSSQEPVWS         MVGKIANASNEKGGMDQAFDDA
Sbjct: 1   MAGIEAPQLPIPGQAGVDTNTSSQEPVWSGAGGAEGAEMVGKIANASNEKGGMDQAFDDA 60

Query: 61  LAFMGQHPVXXXXXXXXXXXXXXXXXKSVSRALGGGAATTQYAKGGFDPKMNVKEAMQIL 120
           LAFMGQHPV                 KSVSRALGGGAATTQYAKGGFDPKMNVKEAMQIL
Sbjct: 61  LAFMGQHPVLSGFGGFLGLYFAAGAFKSVSRALGGGAATTQYAKGGFDPKMNVKEAMQIL 120

Query: 121 NLNENSLNRKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGVR 170
           NLNENSLNRKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGVR
Sbjct: 121 NLNENSLNRKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGVR 170

>YLR008C (PAM18) [3426] chr12 complement(165576..166082) Protein
           containing a DnaJ domain, which are part of chaperone
           (protein folding) system that mediates interaction with
           heat shock proteins, has high similarity to C. albicans
           Orf6.3647p [507 bp, 168 aa]
          Length = 168

 Score =  179 bits (455), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 110/166 (66%), Gaps = 10/166 (6%)

Query: 4   IEAPQLPIPGQAGVDTNTSSQEPVWSXXXXXXXXXMVGKIANASNEKGGMDQAFDDALAF 63
           IEAPQLPIPGQ    TN S+   V            VG    +  +K GMD  FD AL +
Sbjct: 11  IEAPQLPIPGQ----TNGSANVTVDGAGVN------VGIQNGSQGQKTGMDLYFDQALNY 60

Query: 64  MGQHPVXXXXXXXXXXXXXXXXXKSVSRALGGGAATTQYAKGGFDPKMNVKEAMQILNLN 123
           MG+HPV                 KS+S+ L GG +TT + KGGFDPKMN KEA+QILNL 
Sbjct: 61  MGEHPVITGFGAFLTLYFTAGAYKSISKGLNGGKSTTAFLKGGFDPKMNSKEALQILNLT 120

Query: 124 ENSLNRKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGV 169
           EN+L +KKLKEVHR+IMLANHPDKGGSP+LATKINEAKDFLEKRG+
Sbjct: 121 ENTLTKKKLKEVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGI 166

>Sklu_1938.4 YLR008C, Contig c1938 6198-6692 reverse complement
          Length = 164

 Score =  169 bits (428), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 103/167 (61%), Gaps = 10/167 (5%)

Query: 4   IEAPQLPIPGQAGVDTNTSSQEPVWSXXXXXXXXXMVGKIANASNEKGGMDQAFDDALAF 63
            + PQLPIPG      N+  QEPV                  A ++  GMD  FD AL  
Sbjct: 7   FDVPQLPIPGA----DNSRLQEPVALSNATPITTN------PAPSQPSGMDLYFDQALDV 56

Query: 64  MGQHPVXXXXXXXXXXXXXXXXXKSVSRALGGGAATTQYAKGGFDPKMNVKEAMQILNLN 123
           MGQHPV                 +SVS  LGG     ++ KGGFDPKMN  EA+QILNLN
Sbjct: 57  MGQHPVLTGIGGFFTLYFLAGAYRSVSTKLGGNTGAAKFLKGGFDPKMNAGEALQILNLN 116

Query: 124 ENSLNRKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGVR 170
           E++L +KKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRG+R
Sbjct: 117 ESTLTKKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGIR 163

>Scas_590.7
          Length = 158

 Score =  168 bits (426), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 88/167 (52%), Positives = 104/167 (62%), Gaps = 20/167 (11%)

Query: 4   IEAPQLPIPGQAGVDTNTSSQEPVWSXXXXXXXXXMVGKIANASNEKGGMDQAFDDALAF 63
           +E PQL IPG+A       S  P  +             I+  ++ K GMD  FD+A+ +
Sbjct: 11  LEVPQLAIPGEA-------SGSPTMT-------------ISQPTSTKNGMDLYFDEAMQY 50

Query: 64  MGQHPVXXXXXXXXXXXXXXXXXKSVSRALGGGAATTQYAKGGFDPKMNVKEAMQILNLN 123
           MG+HPV                 KS+S  L GG AT  + KGGFD KMN KEA+QILNL 
Sbjct: 51  MGRHPVMTGVAAFLTLYAAAGTYKSISTKLNGGKATATFLKGGFDAKMNQKEALQILNLT 110

Query: 124 ENSLNRKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGVR 170
           EN LN KKLKEVHR+IMLANHPDKGGSPYLATKINEAKDFLEK+ V+
Sbjct: 111 ENKLNMKKLKEVHRKIMLANHPDKGGSPYLATKINEAKDFLEKKSVK 157

>KLLA0E09438g 838259..838750 similar to sgd|S0003998 Saccharomyces
           cerevisiae YLR008c, start by similarity
          Length = 163

 Score =  166 bits (421), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 90/167 (53%), Positives = 106/167 (63%), Gaps = 10/167 (5%)

Query: 4   IEAPQLPIPGQAGVDTNTSSQEPVWSXXXXXXXXXMVGKIANASNEKGGMDQAFDDALAF 63
           IE PQLPIPG+   ++N   ++ V               +     +K GMD  FD AL +
Sbjct: 6   IEVPQLPIPGED--NSNRVPEQVVIGHPAAG--------VPPIPQQKSGMDLYFDQALDY 55

Query: 64  MGQHPVXXXXXXXXXXXXXXXXXKSVSRALGGGAATTQYAKGGFDPKMNVKEAMQILNLN 123
           MG HPV                 KSVS+ LGG +   +Y KGGFDPKMN KEA+ ILNLN
Sbjct: 56  MGDHPVLTGVGGFFALYFAAGAYKSVSKRLGGSSQGVKYLKGGFDPKMNAKEALAILNLN 115

Query: 124 ENSLNRKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGVR 170
           E +L++KKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEK+ VR
Sbjct: 116 ETNLSKKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKKVVR 162

>CAGL0J00935g complement(95878..96339) highly similar to tr|Q07914
           Saccharomyces cerevisiae YLR008c, start by similarity
          Length = 153

 Score =  159 bits (402), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 79/124 (63%), Positives = 88/124 (70%)

Query: 46  ASNEKGGMDQAFDDALAFMGQHPVXXXXXXXXXXXXXXXXXKSVSRALGGGAATTQYAKG 105
           A   K GMD  FD+AL +MG+HPV                 K V   L GG A TQ+ KG
Sbjct: 27  APGSKQGMDLYFDNALQYMGEHPVLAGVGGFLALYVGAGVYKGVQTRLNGGKAATQFLKG 86

Query: 106 GFDPKMNVKEAMQILNLNENSLNRKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLE 165
           GFDPKMN KEA+QILNL EN+L  KKLKEVHR+IMLANHPDKGGSPYLATKINEAKDFLE
Sbjct: 87  GFDPKMNAKEALQILNLKENNLTTKKLKEVHRKIMLANHPDKGGSPYLATKINEAKDFLE 146

Query: 166 KRGV 169
           K+G+
Sbjct: 147 KKGI 150

>ADR345C [2086] [Homologous to ScYLR008C - SH] (1315746..1316222)
           [477 bp, 158 aa]
          Length = 158

 Score =  155 bits (392), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 102/167 (61%), Gaps = 15/167 (8%)

Query: 4   IEAPQLPIPGQAGVDTNTSSQEPVWSXXXXXXXXXMVGKIANASNEKGGMDQAFDDALAF 63
           IE PQLPIPG+       +S  P                 A    +K GMD  FD  + F
Sbjct: 6   IEIPQLPIPGE------DNSAHPAQQIRLEQ---------AAVPQQKRGMDLYFDKVVDF 50

Query: 64  MGQHPVXXXXXXXXXXXXXXXXXKSVSRALGGGAATTQYAKGGFDPKMNVKEAMQILNLN 123
           +G+HPV                 ++VS  + GG   T++ KGGFDPKMN KEA+ ILNL 
Sbjct: 51  VGEHPVVGGIGGFVALYAAAGLWRAVSIRMNGGKEATKFLKGGFDPKMNTKEALAILNLT 110

Query: 124 ENSLNRKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGVR 170
           E++L +K++K+VHR+IMLANHPDKGGSPYLATKINEAKDFLEKRG+R
Sbjct: 111 ESTLTKKRVKDVHRKIMLANHPDKGGSPYLATKINEAKDFLEKRGIR 157

>AGR393W [4704] [Homologous to ScYNL328C (MDJ2) - SH]
           complement(1451330..1451758) [429 bp, 142 aa]
          Length = 142

 Score = 74.7 bits (182), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/73 (54%), Positives = 49/73 (67%), Gaps = 4/73 (5%)

Query: 97  AATTQYAKGGFDPKMNVKEAMQILNLNENS---LNRKKLKEVHRRIMLANHPDKGGSPYL 153
           A   QY  GGF  +MN  EAM IL +  +    L+R  LK+ HRR ML NHPDKGGSPY+
Sbjct: 66  AQLEQYP-GGFYKRMNEVEAMLILQITGDEIKLLDRNMLKKKHRRAMLLNHPDKGGSPYV 124

Query: 154 ATKINEAKDFLEK 166
           A KINEA+D +E+
Sbjct: 125 AMKINEARDVMEQ 137

>YNL328C (MDJ2) [4287] chr14 complement(22834..23274) Protein
           involved in import and folding of mitochondrial
           proteins, has similarity to E. coli DnaJ and other
           DnaJ-like proteins, function partially overlaps that of
           Mdj1p [441 bp, 146 aa]
          Length = 146

 Score = 73.6 bits (179), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 37/69 (53%), Positives = 51/69 (73%), Gaps = 4/69 (5%)

Query: 101 QYAKGGFDPKMNVKEAMQILNLNE---NSLNRKKLKEVHRRIMLANHPDKGGSPYLATKI 157
           QY +GGF P+M   EA+ IL+++    N L+ K LK+ HR+ M+ NHPD+GGSPY+A KI
Sbjct: 72  QY-QGGFAPRMTEPEALLILDISAREINHLDEKLLKKKHRKAMVRNHPDRGGSPYMAAKI 130

Query: 158 NEAKDFLEK 166
           NEAK+ LE+
Sbjct: 131 NEAKEVLER 139

>CAGL0D02552g 261991..262422 similar to sp|P42834 Saccharomyces
           cerevisiae YNL328c MDJ2 heat shock protein - chaperone,
           start by similarity
          Length = 143

 Score = 72.8 bits (177), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 38/66 (57%), Positives = 46/66 (69%), Gaps = 3/66 (4%)

Query: 104 KGGFDPKMNVKEAMQILNLNEN---SLNRKKLKEVHRRIMLANHPDKGGSPYLATKINEA 160
           +GGF   M+  EA+ ILN+ +    SLN   LK+ HR  ML NHPDKGGSPYL+ KINEA
Sbjct: 72  EGGFYHPMSESEALMILNITQKEIMSLNAPLLKKKHRLAMLKNHPDKGGSPYLSAKINEA 131

Query: 161 KDFLEK 166
           K+ LEK
Sbjct: 132 KELLEK 137

>Scas_716.46
          Length = 144

 Score = 72.4 bits (176), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 46/66 (69%), Gaps = 3/66 (4%)

Query: 104 KGGFDPKMNVKEAMQILNLNEN---SLNRKKLKEVHRRIMLANHPDKGGSPYLATKINEA 160
           +GGF P M   EA+ IL+++      L+ K LK  HR  M+ NHPDKGGSPYLATKINEA
Sbjct: 72  QGGFYPTMTESEAILILDISSKDIKKLDEKLLKRKHRGAMILNHPDKGGSPYLATKINEA 131

Query: 161 KDFLEK 166
           ++ LE+
Sbjct: 132 REVLER 137

>Sklu_2034.5 YNL328C, Contig c2034 7065-7493 reverse complement
          Length = 142

 Score = 70.9 bits (172), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 38/68 (55%), Positives = 45/68 (66%), Gaps = 4/68 (5%)

Query: 105 GGFDPKMNVKEAMQILNLNENS---LNRKKLKEVHRRIMLANHPDKGGSPYLATKINEAK 161
           GGF  +M   EA+ IL ++      LN   LK  HRR ML NHPDKGGSPYLA KINEA+
Sbjct: 70  GGFYSRMTETEALLILGISSEEIEHLNATMLKRKHRRAMLQNHPDKGGSPYLAMKINEAR 129

Query: 162 DFLEKRGV 169
           + LE RG+
Sbjct: 130 ETLE-RGI 136

>KLLA0E02024g complement(191062..191502) similar to sp|P42834
           Saccharomyces cerevisiae YNL328c MDJ2 heat shock protein
           - chaperone singleton, start by similarity
          Length = 146

 Score = 66.2 bits (160), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 46/63 (73%), Gaps = 3/63 (4%)

Query: 105 GGFDPKMNVKEAMQILNLNEN---SLNRKKLKEVHRRIMLANHPDKGGSPYLATKINEAK 161
           GGF  KM+  EA+ IL ++     +L+ + L++ HRR M+ NHPDKGGSP++A+KIN+A+
Sbjct: 73  GGFYDKMSETEALLILGISAREIEALDERLLRQKHRRAMIMNHPDKGGSPFIASKINQAR 132

Query: 162 DFL 164
           D L
Sbjct: 133 DLL 135

>Kwal_55.22136
          Length = 145

 Score = 65.5 bits (158), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 47/75 (62%), Gaps = 4/75 (5%)

Query: 94  GGGAATTQYAKGGFDPKMNVKEAMQILNLNEN---SLNRKKLKEVHRRIMLANHPDKGGS 150
           G  A   QY  GGF  KM   EA+ IL ++ +   +L+   LK  HR+ ++ NHPD+GGS
Sbjct: 65  GLKARLNQYG-GGFSSKMTDSEALLILGISGSEVAALDENLLKRKHRQAIVHNHPDRGGS 123

Query: 151 PYLATKINEAKDFLE 165
           PYLA KINEA+D L 
Sbjct: 124 PYLALKINEARDILS 138

>KLLA0F13860g 1284278..1284697 similar to sp|P42949 Saccharomyces
           cerevisiae YJL104w singleton, start by similarity
          Length = 139

 Score = 36.2 bits (82), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 7/71 (9%)

Query: 95  GGAATTQYAKGGFDPKMNVKEAMQILNL-NENSLNRKKLKEVHRRIMLANHPDKGGSPYL 153
           G  A+ +Y  GG    + + E+ +ILN+ NE  +N  K+ E  + +   N  +KGGS YL
Sbjct: 42  GRGASAEY--GG----ITLDESSKILNIENEQDMNLDKINERFKYLFEINDKEKGGSFYL 95

Query: 154 ATKINEAKDFL 164
            +KI  A + L
Sbjct: 96  QSKIYRAAERL 106

>KLLA0C02981g 268669..269157 similar to sp|P47138 Saccharomyces
           cerevisiae YJR097w singleton, start by similarity
          Length = 162

 Score = 26.6 bits (57), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 9/22 (40%), Positives = 14/22 (63%)

Query: 131 KLKEVHRRIMLANHPDKGGSPY 152
           ++K  +R ++L  HPDK G  Y
Sbjct: 19  EIKRAYRAMLLETHPDKSGLNY 40

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.130    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,504,126
Number of extensions: 143263
Number of successful extensions: 378
Number of sequences better than 10.0: 20
Number of HSP's gapped: 360
Number of HSP's successfully gapped: 20
Length of query: 170
Length of database: 16,596,109
Length adjustment: 94
Effective length of query: 76
Effective length of database: 13,342,017
Effective search space: 1013993292
Effective search space used: 1013993292
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 58 (26.9 bits)