Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_33.1520077376240480.0
KLLA0F12892g77577529580.0
AAL174C75676629120.0
YLL001W (DNM1)75777127720.0
CAGL0D05808g77678327230.0
Scas_690.2075577126350.0
YKR001C (VPS1)70477514740.0
CAGL0L02299g70076914320.0
Scas_668.2872277414190.0
Sklu_2326.469055213351e-175
ABL001W68554613331e-175
Kwal_26.792469154613271e-174
KLLA0B13277g68454612631e-164
ACR164C8682604503e-46
KLLA0D06721g8832614415e-45
Sklu_1555.28842604317e-44
Kwal_26.86138612604272e-43
YOR211C (MGM1)9022654264e-43
CAGL0L02783g8912614254e-43
Scas_605.178912614212e-42
KLLA0D03476g156093800.19
YOR165W (SEY1)77628760.61
AGR264C79128740.94
Sklu_2179.478234740.99
Kwal_27.9666147491731.4
KLLA0C16984g54861702.5
CAGL0M12859g94141693.7
YOR162C (YRR1)81050684.5
YDR180W (SCC2)1493162684.8
Scas_636.21622108685.4
Scas_707.829460665.9
Scas_565.51047124676.8
AER245C27134657.9
Kwal_23.30071170118678.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.15200
         (762 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.15200                                                        1563   0.0  
KLLA0F12892g complement(1187526..1189853) similar to sp|P54861 S...  1144   0.0  
AAL174C [13] [Homologous to ScYLL001W (DNM1) - SH] (35718..37988...  1126   0.0  
YLL001W (DNM1) [3418] chr12 (147889..150162) Dynamin-related pro...  1072   0.0  
CAGL0D05808g 552040..554370 highly similar to sp|P54861 Saccharo...  1053   0.0  
Scas_690.20                                                          1019   0.0  
YKR001C (VPS1) [3257] chr11 complement(440251..442365) Vacuolar ...   572   0.0  
CAGL0L02299g 264035..266137 highly similar to sp|P21576 Saccharo...   556   0.0  
Scas_668.28                                                           551   0.0  
Sklu_2326.4 YKR001C, Contig c2326 6273-8345                           518   e-175
ABL001W [591] [Homologous to ScYKR001C (VPS1) - SH] complement(3...   518   e-175
Kwal_26.7924                                                          515   e-174
KLLA0B13277g 1165743..1167797 highly similar to sp|P21576 Saccha...   491   e-164
ACR164C [1211] [Homologous to ScYOR211C (MGM1) - SH] (640832..64...   177   3e-46
KLLA0D06721g complement(578072..580723) similar to sp|P32266 Sac...   174   5e-45
Sklu_1555.2 YOR211C, Contig c1555 412-3066 reverse complement         170   7e-44
Kwal_26.8613                                                          169   2e-43
YOR211C (MGM1) [5004] chr15 complement(738924..741632) Periphera...   168   4e-43
CAGL0L02783g 322955..325630 highly similar to sp|P32266 Saccharo...   168   4e-43
Scas_605.17                                                           166   2e-42
KLLA0D03476g 296287..300969 similar to sp|P33302 Saccharomyces c...    35   0.19 
YOR165W (SEY1) [4964] chr15 (644566..646896) Protein involved in...    34   0.61 
AGR264C [4575] [Homologous to ScYOR165W - SH] (1236213..1238588)...    33   0.94 
Sklu_2179.4 YOR165W, Contig c2179 7628-9976 reverse complement         33   0.99 
Kwal_27.9666                                                           33   1.4  
KLLA0C16984g complement(1482004..1483650) similar to sp|P54791 S...    32   2.5  
CAGL0M12859g 1268191..1271016 highly similar to sp|P32565 Saccha...    31   3.7  
YOR162C (YRR1) [4961] chr15 complement(639560..641992) Transcrip...    31   4.5  
YDR180W (SCC2) [1023] chr4 (821288..825769) Cohesin, protein req...    31   4.8  
Scas_636.21                                                            31   5.4  
Scas_707.8                                                             30   5.9  
Scas_565.5                                                             30   6.8  
AER245C [2747] [Homologous to ScYDR361C (BCP1) - SH] (1091269..1...    30   7.9  
Kwal_23.3007                                                           30   8.0  

>Kwal_33.15200
          Length = 773

 Score = 1563 bits (4048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 762/762 (100%), Positives = 762/762 (100%)

Query: 1   MASLEDLIPTVNKLQDVMYDAGIDTLDLPVLAVIGSQSSGKSSILETLVGKDFLPRGTGI 60
           MASLEDLIPTVNKLQDVMYDAGIDTLDLPVLAVIGSQSSGKSSILETLVGKDFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYDAGIDTLDLPVLAVIGSQSSGKSSILETLVGKDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNIAPDSPLINDYDQETDTPQDHESVPEELTLEDHLRKNQGLEPQGKDEW 120
           VTRRPLVLQLNNIAPDSPLINDYDQETDTPQDHESVPEELTLEDHLRKNQGLEPQGKDEW
Sbjct: 61  VTRRPLVLQLNNIAPDSPLINDYDQETDTPQDHESVPEELTLEDHLRKNQGLEPQGKDEW 120

Query: 121 GEFLHLPGRRFYNFKDIRKEIENETARIAGKNKGISRIPINLKVFSPRVLNLTLVDLPGI 180
           GEFLHLPGRRFYNFKDIRKEIENETARIAGKNKGISRIPINLKVFSPRVLNLTLVDLPGI
Sbjct: 121 GEFLHLPGRRFYNFKDIRKEIENETARIAGKNKGISRIPINLKVFSPRVLNLTLVDLPGI 180

Query: 181 TKVPIGEQPADIEKQIKNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRT 240
           TKVPIGEQPADIEKQIKNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRT
Sbjct: 181 TKVPIGEQPADIEKQIKNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRT 240

Query: 241 IGVITKMDLMDSGTNALDILSGKLYPLRLGFVGIVNRSQQDIQANRTVEEALNNEEAFFS 300
           IGVITKMDLMDSGTNALDILSGKLYPLRLGFVGIVNRSQQDIQANRTVEEALNNEEAFFS
Sbjct: 241 IGVITKMDLMDSGTNALDILSGKLYPLRLGFVGIVNRSQQDIQANRTVEEALNNEEAFFS 300

Query: 301 RHPVYRTISTRCGTRYLAKLLNQILMNHIRDKLPDIKARLNTLMGQTEQELTTYGGLGII 360
           RHPVYRTISTRCGTRYLAKLLNQILMNHIRDKLPDIKARLNTLMGQTEQELTTYGGLGII
Sbjct: 301 RHPVYRTISTRCGTRYLAKLLNQILMNHIRDKLPDIKARLNTLMGQTEQELTTYGGLGII 360

Query: 361 TKENRAGLVLQLMNKFAARFISSIEGTSSDISTKELCGGARIYYIYNDIFGHSLESINPT 420
           TKENRAGLVLQLMNKFAARFISSIEGTSSDISTKELCGGARIYYIYNDIFGHSLESINPT
Sbjct: 361 TKENRAGLVLQLMNKFAARFISSIEGTSSDISTKELCGGARIYYIYNDIFGHSLESINPT 420

Query: 421 ANLSTADIRTAIRNSTGPRPSLFVPELAFDLLVKPQIYLLLEPSQRCVELVYEELMKICH 480
           ANLSTADIRTAIRNSTGPRPSLFVPELAFDLLVKPQIYLLLEPSQRCVELVYEELMKICH
Sbjct: 421 ANLSTADIRTAIRNSTGPRPSLFVPELAFDLLVKPQIYLLLEPSQRCVELVYEELMKICH 480

Query: 481 NCGSPELARYPKLQAKLIEVVSELLRERLGPTRSYVESLIDIHRAYINTNHPNFLSATEA 540
           NCGSPELARYPKLQAKLIEVVSELLRERLGPTRSYVESLIDIHRAYINTNHPNFLSATEA
Sbjct: 481 NCGSPELARYPKLQAKLIEVVSELLRERLGPTRSYVESLIDIHRAYINTNHPNFLSATEA 540

Query: 541 MSDIAEAKRANQELSVKKNLDLEEVKLSLTNDFAKKPNENHILNTSKKADSGNTAFNNDS 600
           MSDIAEAKRANQELSVKKNLDLEEVKLSLTNDFAKKPNENHILNTSKKADSGNTAFNNDS
Sbjct: 541 MSDIAEAKRANQELSVKKNLDLEEVKLSLTNDFAKKPNENHILNTSKKADSGNTAFNNDS 600

Query: 601 SSEDDEKAPGKQSKDSFLNYFFGKDQQIAGNYKGFSDNSQFSNFNRYEQTEHQKHLANFE 660
           SSEDDEKAPGKQSKDSFLNYFFGKDQQIAGNYKGFSDNSQFSNFNRYEQTEHQKHLANFE
Sbjct: 601 SSEDDEKAPGKQSKDSFLNYFFGKDQQIAGNYKGFSDNSQFSNFNRYEQTEHQKHLANFE 660

Query: 661 NLKISDPVVEERNDTPQLTEREQLECELIRRLIVSYFGIVREMIQDQIPKAVMCLLVNFS 720
           NLKISDPVVEERNDTPQLTEREQLECELIRRLIVSYFGIVREMIQDQIPKAVMCLLVNFS
Sbjct: 661 NLKISDPVVEERNDTPQLTEREQLECELIRRLIVSYFGIVREMIQDQIPKAVMCLLVNFS 720

Query: 721 KEIIQNRLVTKLYKESLFEDLLMEDQNLAQDRQKCVKLLDTY 762
           KEIIQNRLVTKLYKESLFEDLLMEDQNLAQDRQKCVKLLDTY
Sbjct: 721 KEIIQNRLVTKLYKESLFEDLLMEDQNLAQDRQKCVKLLDTY 762

>KLLA0F12892g complement(1187526..1189853) similar to sp|P54861
           Saccharomyces cerevisiae YLL001w DNM1 dynamin-related
           protein, start by similarity
          Length = 775

 Score = 1144 bits (2958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 569/775 (73%), Positives = 649/775 (83%), Gaps = 24/775 (3%)

Query: 1   MASLEDLIPTVNKLQDVMYDAGIDTLDLPVLAVIGSQSSGKSSILETLVGKDFLPRGTGI 60
           M+SLEDLIPTVNKLQDVMYDAGID+LDLPVLAVIGSQSSGKSSILETLVG+DFLPRGTGI
Sbjct: 1   MSSLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNIAPDSPLINDYDQETDTPQDH------ESVPEELTLEDHLRKNQGLEP 114
           VTRRPLVLQLNNI P+SPL+ +YD  + T  +           +E+TLEDHLRKN   +P
Sbjct: 61  VTRRPLVLQLNNIDPNSPLVYNYDNSSSTSLEQVNDEPDARTEKEMTLEDHLRKNSNYKP 120

Query: 115 QGKDEWGEFLHLPGRRFYNFKDIRKEIENETARIAGKNKGISRIPINLKVFSPRVLNLTL 174
           + K+EWGEFLH+PGRRFY+F +IR+EIENETARIAGK KGISRIPINLK++SP VLNLTL
Sbjct: 121 EIKNEWGEFLHIPGRRFYDFSEIRREIENETARIAGKEKGISRIPINLKIYSPHVLNLTL 180

Query: 175 VDLPGITKVPIGEQPADIEKQIKNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVD 234
           VDLPGITKVPIGEQP DIE+QI+NLILEYVAKPNCIILA+SPANVDLVNSESLKLAR++D
Sbjct: 181 VDLPGITKVPIGEQPPDIERQIENLILEYVAKPNCIILAISPANVDLVNSESLKLAREID 240

Query: 235 PHGKRTIGVITKMDLMDSGTNALDILSGKLYPLRLGFVGIVNRSQQDIQANRTVEEALNN 294
           PHGKRTIGVITK+DLMD GTNALDILSGKLYPL+LGFVG+VNRSQQDIQ N++VEEALN+
Sbjct: 241 PHGKRTIGVITKLDLMDQGTNALDILSGKLYPLKLGFVGVVNRSQQDIQQNKSVEEALNS 300

Query: 295 EEAFFSRHPVYRTISTRCGTRYLAKLLNQILMNHIRDKLPDIKARLNTLMGQTEQELTTY 354
           EE FF++HPVYRTISTRCGTRYLAKLLNQ+LMNHIRDKLPDIKARLNTL+GQTEQEL TY
Sbjct: 301 EEQFFAKHPVYRTISTRCGTRYLAKLLNQVLMNHIRDKLPDIKARLNTLIGQTEQELATY 360

Query: 355 GGLGIITKENRAGLVLQLMNKFAARFISSIEGTSSDISTKELCGGARIYYIYNDIFGHSL 414
           G   +ITKENRAGLVLQLMNKFA +FISSI+GTSS+ISTKELCGGARIYYIYN +FG SL
Sbjct: 361 GDDKVITKENRAGLVLQLMNKFATKFISSIDGTSSEISTKELCGGARIYYIYNTLFGKSL 420

Query: 415 ESINPTANLSTADIRTAIRNSTGPRPSLFVPELAFDLLVKPQIYLLLEPSQRCVELVYEE 474
             INPT+NLS  DIRTAIRNSTGPRPSLFVPELAFDLLVKPQI LLL+PSQRCVELVYEE
Sbjct: 421 NFINPTSNLSMTDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIRLLLDPSQRCVELVYEE 480

Query: 475 LMKICHNCGSPELARYPKLQAKLIEVVSELLRERLGPTRSYVESLIDIHRAYINTNHPNF 534
           LMKICHNCGSPELARYPKLQ+KL+EVVSELLRERLGPTRSYVESLIDIH+AYINTNHPNF
Sbjct: 481 LMKICHNCGSPELARYPKLQSKLVEVVSELLRERLGPTRSYVESLIDIHKAYINTNHPNF 540

Query: 535 LSATEAMSDIAEAKRANQELSVKKNLDLEEVKLSLTNDFA----KKPNENHILNTSKKAD 590
            SATEAM++I EA++  ++    +     E +L L    A    KK +         K D
Sbjct: 541 PSATEAMAEIVEARKNKKQTERLQKQREYEKQLLLEQQQAEREMKKSDSVDETEQDLKLD 600

Query: 591 SGNTAFNNDSSSEDDEKAPGKQSKDSFLNYFFGKDQQIAGNYKGFSDNSQFSNFNRYEQT 650
           S +TA +   S E+++    KQSKDSFLNYFFGK+Q+        S N++ S+   Y  +
Sbjct: 601 SDSTATSEHDSEEENDM---KQSKDSFLNYFFGKEQK--------SSNTKLSSRIDYNGS 649

Query: 651 EHQKHLANFENLKISDPVVEERNDT---PQLTEREQLECELIRRLIVSYFGIVREMIQDQ 707
           ++   + N +     D   +    +    + TERE+LECELIRRLIVSYF IVREMI+DQ
Sbjct: 650 DNSYDIENLQIQDFKDKSADAHTKSEAATEFTEREELECELIRRLIVSYFSIVREMIEDQ 709

Query: 708 IPKAVMCLLVNFSKEIIQNRLVTKLYKESLFEDLLMEDQNLAQDRQKCVKLLDTY 762
           +PKAVMCLLVN+SKE +QNRLVTKLYKESLF++LLMEDQ LAQDR+KCV LL+TY
Sbjct: 710 VPKAVMCLLVNYSKESVQNRLVTKLYKESLFDELLMEDQTLAQDREKCVNLLETY 764

>AAL174C [13] [Homologous to ScYLL001W (DNM1) - SH] (35718..37988)
           [2271 bp, 756 aa]
          Length = 756

 Score = 1126 bits (2912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/766 (75%), Positives = 644/766 (84%), Gaps = 25/766 (3%)

Query: 1   MASLEDLIPTVNKLQDVMYDAGIDTLDLPVLAVIGSQSSGKSSILETLVGKDFLPRGTGI 60
           MASLEDLIPTVNKLQDVMYDAGID+LDLPVLAVIGSQSSGKSSILETLVG+DFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNIAPDSPLINDYDQETDTPQDHESVPEELTLEDHLRKNQGLEPQGKDEW 120
           VTRRPLVLQLNNI  DSPLI  Y  E   P          TLE+ LR   G     +D W
Sbjct: 61  VTRRPLVLQLNNIKADSPLITAYTAEEAEP----------TLENRLRGQSG----ARDTW 106

Query: 121 GEFLHLPGRRFYNFKDIRKEIENETARIAGKNKGISRIPINLKVFSPRVLNLTLVDLPGI 180
           GEFLHLPGRRFY+F +IR EIENETARIAGKNKGISRIPINLK++SP VLNLTL+DLPGI
Sbjct: 107 GEFLHLPGRRFYDFTEIRGEIENETARIAGKNKGISRIPINLKIYSPHVLNLTLIDLPGI 166

Query: 181 TKVPIGEQPADIEKQIKNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRT 240
           TKVPIGEQP DIE+QI+NLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRT
Sbjct: 167 TKVPIGEQPPDIERQIRNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRT 226

Query: 241 IGVITKMDLMDSGTNALDILSGKLYPLRLGFVGIVNRSQQDIQANRTVEEALNNEEAFFS 300
           IGV+TK+DLMDSGTNA DIL+GKLYPLRLGFVG+VNRSQQDIQ N++VE+AL  EE FFS
Sbjct: 227 IGVVTKLDLMDSGTNAWDILAGKLYPLRLGFVGVVNRSQQDIQENKSVEDALAREEEFFS 286

Query: 301 RHPVYRTISTRCGTRYLAKLLNQILMNHIRDKLPDIKARLNTLMGQTEQELTTYGGLGII 360
           +HP YRTIS++CGTR+LAK LNQIL+NHIR+KLPDIKARLNTL+GQTEQEL +YGG  II
Sbjct: 287 KHPAYRTISSKCGTRFLAKKLNQILLNHIREKLPDIKARLNTLIGQTEQELASYGGSNII 346

Query: 361 TKENRAGLVLQLMNKFAARFISSIEGTSSDISTKELCGGARIYYIYNDIFGHSLESINPT 420
           + E+RAGLVLQ+MNKFA  F+SSIEGTSSDISTKELCGGARIYYIYN+IFG+SL+SINPT
Sbjct: 347 SPESRAGLVLQMMNKFATNFVSSIEGTSSDISTKELCGGARIYYIYNNIFGNSLKSINPT 406

Query: 421 ANLSTADIRTAIRNSTGPRPSLFVPELAFDLLVKPQIYLLLEPSQRCVELVYEELMKICH 480
           ANLS  DIRTAIRNSTGPRPSLFVPELAFDLLVKPQI LLL+PSQRCVELVYEELMKICH
Sbjct: 407 ANLSITDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIKLLLDPSQRCVELVYEELMKICH 466

Query: 481 NCGSPELARYPKLQAKLIEVVSELLRERLGPTRSYVESLIDIHRAYINTNHPNFLSATEA 540
           NCGSP LARYP+LQAKLIEVVS+LLRERLGPTRSYVESLIDIHRA+INTNHPNFLSATEA
Sbjct: 467 NCGSPALARYPRLQAKLIEVVSDLLRERLGPTRSYVESLIDIHRAFINTNHPNFLSATEA 526

Query: 541 MSDIAEAKRANQELSVKKNLDLEEVKLSLTNDFAKKPNENHILNTSKKADSGNTAFNNDS 600
           M+DIAEA+R  Q+ + K++ DL++ K     + A    E    N S K DS +T  ++DS
Sbjct: 527 MADIAEARRQKQQ-NAKRSADLKK-KRQQELEKAAAVGEPTNGNPSPKVDSDSTITSSDS 584

Query: 601 SSEDDEKAPGKQSKDSFLNYFFGKDQQIAGN---YKGFSDNSQFSNFNRYEQTEHQKHLA 657
             E DE+ P KQ+KDSFLNYFFGKDQQ          FSD  + +  + ++Q   +    
Sbjct: 585 EGE-DERDP-KQNKDSFLNYFFGKDQQRKDGDDIAPSFSDKQERTMDSFFQQ---EADFM 639

Query: 658 NFENLKISDPVVEE-RNDTPQLTEREQLECELIRRLIVSYFGIVREMIQDQIPKAVMCLL 716
             E LKI D V      + P+LTERE+LECELIRRLI+SYFGIVREM++DQIPKAVMC L
Sbjct: 640 AMETLKIQDTVAAPVEAEHPELTEREELECELIRRLIISYFGIVREMVEDQIPKAVMCFL 699

Query: 717 VNFSKEIIQNRLVTKLYKESLFEDLLMEDQNLAQDRQKCVKLLDTY 762
           VNF KE +QNRLV+KLYKESLFE+LLMED+ LAQDR KC+KLL+ Y
Sbjct: 700 VNFCKEEVQNRLVSKLYKESLFEELLMEDETLAQDRAKCIKLLEGY 745

>YLL001W (DNM1) [3418] chr12 (147889..150162) Dynamin-related
           protein that controls morphology and cortical
           localization of mitochondria [2274 bp, 757 aa]
          Length = 757

 Score = 1072 bits (2772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/771 (70%), Positives = 626/771 (81%), Gaps = 34/771 (4%)

Query: 1   MASLEDLIPTVNKLQDVMYDAGIDTLDLPVLAVIGSQSSGKSSILETLVGKDFLPRGTGI 60
           MASLEDLIPTVNKLQDVMYD+GIDTLDLP+LAV+GSQSSGKSSILETLVG+DFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNIAPDSPLINDYDQETDTPQDHESVPEELTLEDHLRKNQGLEPQGKDEW 120
           VTRRPLVLQLNNI+P+SPLI + D   + P D  +            + +G E    DEW
Sbjct: 61  VTRRPLVLQLNNISPNSPLIEEDDNSVN-PHDEVTKISGFEAGTKPLEYRGKERNHADEW 119

Query: 121 GEFLHLPGRRFYNFKDIRKEIENETARIAGKNKGISRIPINLKVFSPRVLNLTLVDLPGI 180
           GEFLH+PG+RFY+F DI++EIENETARIAGK+KGIS+IPINLKVFSP VLNLTLVDLPGI
Sbjct: 120 GEFLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGI 179

Query: 181 TKVPIGEQPADIEKQIKNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRT 240
           TKVPIGEQP DIEKQIKNLIL+Y+A PNC+ILAVSPANVDLVNSESLKLAR+VDP GKRT
Sbjct: 180 TKVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRT 239

Query: 241 IGVITKMDLMDSGTNALDILSGKLYPLRLGFVGIVNRSQQDIQANRTVEEALNNEEAFFS 300
           IGVITK+DLMDSGTNALDILSGK+YPL+LGFVG+VNRSQQDIQ N+TVEE+L+ EE +F 
Sbjct: 240 IGVITKLDLMDSGTNALDILSGKMYPLKLGFVGVVNRSQQDIQLNKTVEESLDKEEDYFR 299

Query: 301 RHPVYRTISTRCGTRYLAKLLNQILMNHIRDKLPDIKARLNTLMGQTEQELTTYGGLGII 360
           +HPVYRTIST+CGTRYLAKLLNQ L++HIRDKLPDIK +LNTL+ QTEQEL  YGG+G  
Sbjct: 300 KHPVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTLISQTEQELARYGGVGAT 359

Query: 361 TKENRAGLVLQLMNKFAARFISSIEGTSSDISTKELCGGARIYYIYNDIFGHSLESINPT 420
           T E+RA LVLQLMNKF+  FISSI+GTSSDI+TKELCGGARIYYIYN++FG+SL+SI+PT
Sbjct: 360 TNESRASLVLQLMNKFSTNFISSIDGTSSDINTKELCGGARIYYIYNNVFGNSLKSIDPT 419

Query: 421 ANLSTADIRTAIRNSTGPRPSLFVPELAFDLLVKPQIYLLLEPSQRCVELVYEELMKICH 480
           +NLS  D+RTAIRNSTGPRP+LFVPELAFDLLVKPQI LLLEPSQRCVELVYEELMKICH
Sbjct: 420 SNLSVLDVRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQRCVELVYEELMKICH 479

Query: 481 NCGSPELARYPKLQAKLIEVVSELLRERLGPTRSYVESLIDIHRAYINTNHPNFLSATEA 540
            CGS ELARYPKL++ LIEV+SELLRERL PTRSYVESLIDIHRAYINTNHPNFLSATEA
Sbjct: 480 KCGSAELARYPKLKSMLIEVISELLRERLQPTRSYVESLIDIHRAYINTNHPNFLSATEA 539

Query: 541 MSDIAEAKRANQELSVKKNLDLEEVKLSLTNDFAKKPNENHILNTSKKADSGNTAFNNDS 600
           M DI + +R       K+N +L + KLS          EN   N      S ++  + DS
Sbjct: 540 MDDIMKTRR-------KRNQELLKSKLS--------QQENGQTNGINGTSSISSNIDQDS 584

Query: 601 ---SSEDDE--KAPGKQSKDSFLNYFFGKDQQIAGNYKGFSDNSQFSNFNRYEQTEHQKH 655
              S  DD+   A  KQ+KD FLNYFFGKD+      KG      F   ++        +
Sbjct: 585 AKNSDYDDDGIDAESKQTKDKFLNYFFGKDK------KG---QPVFDASDKKRSIAGDGN 635

Query: 656 LANFENLKISD----PVVEERNDTPQLTEREQLECELIRRLIVSYFGIVREMIQDQIPKA 711
           + +F NL+ISD     + +  N  P LTERE+LECELI+RLIVSYF I+REMI+DQ+PKA
Sbjct: 636 IEDFRNLQISDFSLGDIDDLENAEPPLTEREELECELIKRLIVSYFDIIREMIEDQVPKA 695

Query: 712 VMCLLVNFSKEIIQNRLVTKLYKESLFEDLLMEDQNLAQDRQKCVKLLDTY 762
           VMCLLVN+ K+ +QNRLVTKLYKE+LFE+LL+EDQ LAQDR+ CVK L  Y
Sbjct: 696 VMCLLVNYCKDSVQNRLVTKLYKETLFEELLVEDQTLAQDRELCVKSLGVY 746

>CAGL0D05808g 552040..554370 highly similar to sp|P54861
           Saccharomyces cerevisiae YLL001w DNM1 dynamin-related
           protein, start by similarity
          Length = 776

 Score = 1053 bits (2723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/783 (68%), Positives = 626/783 (79%), Gaps = 39/783 (4%)

Query: 1   MASLEDLIPTVNKLQDVMYDAGIDTLDLPVLAVIGSQSSGKSSILETLVGKDFLPRGTGI 60
           MASLEDLIPTVNKLQDVMYD+GIDTLDLP+LAV+GSQSSGKSSILETLVG+DFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNIAPDSPLI----------NDYDQETDTPQDHESVPEELTLEDHLRKNQ 110
           VTRRPLVLQLNNI+  SPLI          N+  +   +    ++  E  T    L  N 
Sbjct: 61  VTRRPLVLQLNNISASSPLIKENPDLIMSLNNASRSQSSLNGFQNNNESTT---SLNDNN 117

Query: 111 GLEPQ---------GKDEWGEFLHLPGRRFYNFKDIRKEIENETARIAGKNKGISRIPIN 161
           G              +DEWGEFLH+PGRRFY+F +IR+EIE+ETARIAGKNKGIS+IPIN
Sbjct: 118 GASSAIGGSNATEIRRDEWGEFLHIPGRRFYDFSEIRREIESETARIAGKNKGISKIPIN 177

Query: 162 LKVFSPRVLNLTLVDLPGITKVPIGEQPADIEKQIKNLILEYVAKPNCIILAVSPANVDL 221
           LK++SP VLNLTLVDLPGITKVPIGEQP DIEKQIKNLIL+YVA PNCIILAVSPANVDL
Sbjct: 178 LKIYSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCIILAVSPANVDL 237

Query: 222 VNSESLKLARDVDPHGKRTIGVITKMDLMDSGTNALDILSGKLYPLRLGFVGIVNRSQQD 281
           VNSESLKLAR+VDPHG RTIGVITK+DLMDSGTNALDILSGKLYPL+LGFVG+VNRSQQD
Sbjct: 238 VNSESLKLAREVDPHGIRTIGVITKLDLMDSGTNALDILSGKLYPLKLGFVGVVNRSQQD 297

Query: 282 IQANRTVEEALNNEEAFFSRHPVYRTISTRCGTRYLAKLLNQILMNHIRDKLPDIKARLN 341
           IQ N+TVEEALN EE +F+RHPVYRT+S RCGTRYLAKLLNQ L++HI++KLPDIK RLN
Sbjct: 298 IQMNKTVEEALNKEEEYFNRHPVYRTMSHRCGTRYLAKLLNQTLISHIKEKLPDIKTRLN 357

Query: 342 TLMGQTEQELTTYGGLGIITKENRAGLVLQLMNKFAARFISSIEGTSSDISTKELCGGAR 401
           TL+ QTEQEL+ YG  G ITKENRAGLVLQLMNKFA  FISSI+GTSS+ISTKEL GGAR
Sbjct: 358 TLISQTEQELSQYGDTGDITKENRAGLVLQLMNKFATAFISSIDGTSSEISTKELSGGAR 417

Query: 402 IYYIYNDIFGHSLESINPTANLSTADIRTAIRNSTGPRPSLFVPELAFDLLVKPQIYLLL 461
           IYYIYN+IFG++L+SI+PT NL+  DIRTAIRNSTGPRP+LFVPELAFDLLVKPQI LLL
Sbjct: 418 IYYIYNNIFGNTLKSIDPTTNLTILDIRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLL 477

Query: 462 EPSQRCVELVYEELMKICHNCGSPELARYPKLQAKLIEVVSELLRERLGPTRSYVESLID 521
           EPSQ+CVELVYEEL+KICH CG+PEL+RYPKL++KLIEVVS+LLRERL PTRSYVESLID
Sbjct: 478 EPSQQCVELVYEELVKICHKCGTPELSRYPKLKSKLIEVVSDLLRERLFPTRSYVESLID 537

Query: 522 IHRAYINTNHPNFLSATEAMSDIAEAKRANQELSVKKNLDLEEVKLSLTNDFAKKPNENH 581
           IHRAYINTNHPNFL+AT+AMSDI ++++ NQE    + + LE+ K         +  EN 
Sbjct: 538 IHRAYINTNHPNFLTATDAMSDIIQSRKRNQENQRAQKM-LEKEK-------QNEIQENG 589

Query: 582 ILNTSKKADSGNTAFNNDSSSEDDEKAPGKQSKDSFLNYFFGKDQQIAGNYKGFSDNSQF 641
             + + K+D   +       +E D      +SKD+FLNYFFGKD++        + + +F
Sbjct: 590 TASQNSKSDIEPSI----DGTELDSSKDATKSKDTFLNYFFGKDKK--SQLSLSNRDGRF 643

Query: 642 SNFNRY-EQTEHQKHLANF-ENLKISDPVVEERNDTPQLTEREQLECELIRRLIVSYFGI 699
           S  N Y +    Q    NF  NL   D   E  N  P+LTERE LECELIRRLIVSYF I
Sbjct: 644 SELNGYKDDFSSQFQQLNFNSNLNSDDDAFENANH-PKLTEREDLECELIRRLIVSYFDI 702

Query: 700 VREMIQDQIPKAVMCLLVNFSKEIIQNRLVTKLYKESLFEDLLMEDQNLAQDRQKCVKLL 759
           VREMI+DQIPKA+MCLLVNF K+ +QNRLVT+LY+ES+FE+LL+EDQ L QDR+  +K L
Sbjct: 703 VREMIEDQIPKAIMCLLVNFCKDSVQNRLVTELYRESMFEELLVEDQTLMQDRENALKSL 762

Query: 760 DTY 762
           + Y
Sbjct: 763 EVY 765

>Scas_690.20
          Length = 755

 Score = 1019 bits (2635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/771 (67%), Positives = 606/771 (78%), Gaps = 36/771 (4%)

Query: 1   MASLEDLIPTVNKLQDVMYDAGIDTLDLPVLAVIGSQSSGKSSILETLVGKDFLPRGTGI 60
           MASLEDLIPTVNKLQDVMY +GIDTLDLP+LAV+GSQSSGKSSI+ETLVG+DFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYASGIDTLDLPILAVVGSQSSGKSSIIETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNIAPDSPLINDYDQETDTPQDHES-------VPEELT-LEDHLRKNQGL 112
           VTRRPLVLQLNN+  DS   N+       P    S       + + L+ +ED +      
Sbjct: 61  VTRRPLVLQLNNLPKDSSQANENIGSDANPDPFSSGSTKNNQLEDSLSFVEDGINGQTNN 120

Query: 113 EPQGKDEWGEFLHLPGRRFYNFKDIRKEIENETARIAGKNKGISRIPINLKVFSPRVLNL 172
             + + EWGEFLH+PGRRFY+F +IR+EIENETAR+AGKNKGIS++PINLK+FSP VLNL
Sbjct: 121 NQKHRSEWGEFLHIPGRRFYDFNEIRREIENETARLAGKNKGISKLPINLKIFSPHVLNL 180

Query: 173 TLVDLPGITKVPIGEQPADIEKQIKNLILEYVAKPNCIILAVSPANVDLVNSESLKLARD 232
           TLVDLPGITKVPIGEQP DIEKQIKNLIL+YVA PNC+ILAVSPANVDLVNSESLKLAR+
Sbjct: 181 TLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCLILAVSPANVDLVNSESLKLARE 240

Query: 233 VDPHGKRTIGVITKMDLMDSGTNALDILSGKLYPLRLGFVGIVNRSQQDIQANRTVEEAL 292
           VDP GKRTIGVITK+DLMDSGTNALDILSGKLYPL+ GFVGIVNRSQQDIQ N++V+EAL
Sbjct: 241 VDPLGKRTIGVITKLDLMDSGTNALDILSGKLYPLKFGFVGIVNRSQQDIQLNKSVQEAL 300

Query: 293 NNEEAFFSRHPVYRTISTRCGTRYLAKLLNQILMNHIRDKLPDIKARLNTLMGQTEQELT 352
           NNEE +F RHP+YRTIS +CGTRYLAKLLN+ILMNHI+DKLPDIK +LNTL+ QTEQEL 
Sbjct: 301 NNEEEYFKRHPIYRTISNKCGTRYLAKLLNKILMNHIKDKLPDIKTKLNTLVTQTEQELY 360

Query: 353 TYGGLGIITKENRAGLVLQLMNKFAARFISSIEGTSSDISTKELCGGARIYYIYNDIFGH 412
           +YGG  + TKENRA L+LQLMNKFA  FISSIEG SSDI+TKELCGGARIYYIYN++FG 
Sbjct: 361 SYGGSALSTKENRANLILQLMNKFATSFISSIEGNSSDINTKELCGGARIYYIYNNVFGK 420

Query: 413 SLESINPTANLSTADIRTAIRNSTGPRPSLFVPELAFDLLVKPQIYLLLEPSQRCVELVY 472
           SL+SI+PT NL+T DIRTAIRNSTGPRP+LFVPE AFDLLV+PQ+ LLLEPSQRCVELVY
Sbjct: 421 SLKSIDPTTNLTTMDIRTAIRNSTGPRPTLFVPEFAFDLLVRPQVSLLLEPSQRCVELVY 480

Query: 473 EELMKICHNCGSPELARYPKLQAKLIEVVSELLRERLGPTRSYVESLIDIHRAYINTNHP 532
           EELMKICH CGSPEL RYP+L++ LIEVV +LL+ERL PTR YVESLIDIH+AYINTNHP
Sbjct: 481 EELMKICHGCGSPELVRYPRLKSMLIEVVVDLLKERLAPTRQYVESLIDIHKAYINTNHP 540

Query: 533 NFLSATEAMSDIAEAKRANQELSVKKNLDLEEVKLSLTNDFAKKPNENHILNTSKKADSG 592
           +FL ATEA SDI    ++NQE   K+N + E +             EN    +S   ++G
Sbjct: 541 SFLKATEAYSDIM---KSNQERKDKENKNTEVI----------TEKENGSDRSSSSEETG 587

Query: 593 NTAFNNDSSSEDDEKAPGKQSKDSFLNYFFGKDQQ-IAGNYKGFSDNSQFSNFNRYEQTE 651
                N+ S E DE      SK  F + FF  ++Q  +GN    S ++   N        
Sbjct: 588 YIDGKNNISKEADE------SKALFFDNFFATEKQDSSGNLANTSHDTLVIN-------- 633

Query: 652 HQKHLANFENLKISDPVVEERNDTPQLTEREQLECELIRRLIVSYFGIVREMIQDQIPKA 711
              + +   NL I++      +  P L+EREQLECELIRRLI+SYFGI+REMI+DQIPKA
Sbjct: 634 EDLNGSLLGNLHITENSQTTYDLEPHLSEREQLECELIRRLIISYFGIIREMIEDQIPKA 693

Query: 712 VMCLLVNFSKEIIQNRLVTKLYKESLFEDLLMEDQNLAQDRQKCVKLLDTY 762
           +M  LVN+ KE +QNRLVTKLYKES+ E+LL+EDQ +AQDR  C +LL+TY
Sbjct: 694 IMFFLVNYCKESVQNRLVTKLYKESMLEELLVEDQTIAQDRANCERLLETY 744

>YKR001C (VPS1) [3257] chr11 complement(440251..442365) Vacuolar
           sorting protein, member of the dynamin family of GTPases
           [2115 bp, 704 aa]
          Length = 704

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/775 (41%), Positives = 457/775 (58%), Gaps = 104/775 (13%)

Query: 5   EDLIPTVNKLQDVMYDAGIDT---LDLPVLAVIGSQSSGKSSILETLVGKDFLPRGTGIV 61
           E LI T+NKLQD +   G  +   +DLP + V+GSQSSGKSS+LE +VG+DFLPRGTGIV
Sbjct: 3   EHLISTINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNNIAPDSPL---------------INDYDQETDTPQDHESVPEELTLEDHL 106
           TRRPLVLQL N  P                   IND D++ D    H+            
Sbjct: 63  TRRPLVLQLINRRPKKSEHAKVNQTANELIDLNINDDDKKKDESGKHQ------------ 110

Query: 107 RKNQGLEPQGKDEWGEFLHLPGRRFYNFKDIRKEIENETARIAGKNKGISRIPINLKVFS 166
             N+G     K+EWGEFLHLPG++FYNF +IRKEI  ET ++ G N GIS +PINL+++S
Sbjct: 111 --NEGQSEDNKEEWGEFLHLPGKKFYNFDEIRKEIVKETDKVTGANSGISSVPINLRIYS 168

Query: 167 PRVLNLTLVDLPGITKVPIGEQPADIEKQIKNLILEYVAKPNCIILAVSPANVDLVNSES 226
           P VL LTLVDLPG+TKVP+G+QP DIE+QIK+++L+Y++KPN IIL+V+ AN DL NS+ 
Sbjct: 169 PHVLTLTLVDLPGLTKVPVGDQPPDIERQIKDMLLKYISKPNAIILSVNAANTDLANSDG 228

Query: 227 LKLARDVDPHGKRTIGVITKMDLMDSGTNALDILSGKLYPLRLGFVGIVNRSQQDIQANR 286
           LKLAR+VDP G RTIGV+TK+DLMD GT+ +DIL+G++ PLR G++ ++NR Q+DI+  +
Sbjct: 229 LKLAREVDPEGTRTIGVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKDIEHKK 288

Query: 287 TVEEALNNEEAFFSRHPVYRTISTRCGTRYLAKLLNQILMNHIRDKLPDIKARLNTLMGQ 346
           T+ EAL NE  FF  HP Y + +  CGT YLAK LN IL++HIR  LP+IKA++   + +
Sbjct: 289 TIREALENERKFFENHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPEIKAKIEATLKK 348

Query: 347 TEQELTTYGGLGIITKENRAGLVLQLMNKFAARFISSIEGTSSDISTKELCGGARIYYIY 406
            + EL     LG  T ++ + +VL ++  F+  +   ++G + ++S++EL GGARI Y++
Sbjct: 349 YQNELIN---LGPETMDSASSVVLSMITDFSNEYAGILDGEAKELSSQELSGGARISYVF 405

Query: 407 NDIFGHSLESINPTANLSTADIRTAIRNSTGPRPSLFVPELAFDLLVKPQIYLLLEPSQR 466
           ++ F + ++S++P   +  +DIRT + NS+G  PSLFV   AF++LVK QI    EPS R
Sbjct: 406 HETFKNGVDSLDPFDQIKDSDIRTIMYNSSGSAPSLFVGTEAFEVLVKQQIRRFEEPSLR 465

Query: 467 CVELVYEELMKICHNCGS-PELARYPKLQAKLIEVVSELLRERLGPTRSYVESLIDIHRA 525
            V LV++EL+++     S P+ +RYP L+  +     + L++   PT  +V  +I   + 
Sbjct: 466 LVTLVFDELVRMLKQIISQPKYSRYPALREAISNQFIQFLKDATIPTNEFVVDIIKAEQT 525

Query: 526 YINTNHPNFLSATEAMSDIAEAKRANQELSVKKNLDLEEVKLSLTNDFAKKPNENHILNT 585
           YINT HP+ L  ++AM  + E     Q                     A  P     L T
Sbjct: 526 YINTAHPDLLKGSQAMVMVEEKLHPRQ--------------------VAVDPKTGKPLPT 565

Query: 586 SKKADSGNTAFNNDSSSEDDEKAPGKQSKDSFLNYFFGKDQQIAGNYKGFSDNSQFSNFN 645
                         SSS    KAP  + K  F   FF                       
Sbjct: 566 ------------QPSSS----KAPVMEEKSGFFGGFFS---------------------- 587

Query: 646 RYEQTEHQKHLANFENLKISDPVVEERNDTPQLTEREQLECELIRRLIVSYFGIVREMIQ 705
               T+++K LA  E+     PV++    T Q+TERE +E E+I+ LI SYF IV+  I 
Sbjct: 588 ----TKNKKKLAALES---PPPVLKA---TGQMTERETMETEVIKLLISSYFSIVKRTIA 637

Query: 706 DQIPKAVMCLLVNFSKEIIQNRLVTKLYKESLFEDLLMEDQNLAQDRQKCVKLLD 760
           D IPKA+M  L+  SK  IQ  L+ KLY +   E+L  E+    Q R++C K+++
Sbjct: 638 DIIPKALMLKLIVKSKTDIQKVLLEKLYGKQDIEELTKENDITIQRRKECKKMVE 692

>CAGL0L02299g 264035..266137 highly similar to sp|P21576
           Saccharomyces cerevisiae YKR001c VPS1, start by
           similarity
          Length = 700

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/769 (40%), Positives = 462/769 (60%), Gaps = 96/769 (12%)

Query: 5   EDLIPTVNKLQDVMYDAGIDT---LDLPVLAVIGSQSSGKSSILETLVGKDFLPRGTGIV 61
           E LI T+NKLQD +   G  +   +DLP + V+GSQSSGKSS+LE +VG+DFLPRGTGIV
Sbjct: 3   EHLIATINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNNIAPDSPLINDYDQETDTP-QDHESVPEELTLEDHLRKNQGLEPQGK--- 117
           TRRPLVLQL         IN   +++D   Q       +L ++DH +K    +P GK   
Sbjct: 63  TRRPLVLQL---------INRRSKKSDKEVQKASDQLLDLNMDDHSKKE---DPAGKKGQ 110

Query: 118 -----DEWGEFLHLPGRRFYNFKDIRKEIENETARIAGKNKGISRIPINLKVFSPRVLNL 172
                +EWGEFLHLP ++FYNF +IR EI  ET ++ G N GIS IPINL+++SP VL L
Sbjct: 111 SEDNAEEWGEFLHLPDKKFYNFDEIRNEIVRETDKLTGTNLGISPIPINLRIYSPHVLTL 170

Query: 173 TLVDLPGITKVPIGEQPADIEKQIKNLILEYVAKPNCIILAVSPANVDLVNSESLKLARD 232
           TLVDLPG+TKVP+G+QP DIEKQIK+++L+Y++KPN IIL+V+ AN DL NS+ LKLAR+
Sbjct: 171 TLVDLPGLTKVPVGDQPPDIEKQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKLARE 230

Query: 233 VDPHGKRTIGVITKMDLMDSGTNALDILSGKLYPLRLGFVGIVNRSQQDIQANRTVEEAL 292
           VDP G RTIGV+TK+DLMD GT+ +DIL+G++ PLR G++ ++NR Q+DI+  +T+  AL
Sbjct: 231 VDPEGTRTIGVLTKVDLMDKGTDVIDILAGRVIPLRYGYIPVINRGQKDIEHKKTIRAAL 290

Query: 293 NNEEAFFSRHPVYRTISTRCGTRYLAKLLNQILMNHIRDKLPDIKARLNTLMGQTEQELT 352
            +E+ FF  HP Y + +  CGT YLAK LN IL++HIR  LPDIK ++ + + +   EL 
Sbjct: 291 QDEKKFFEEHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPDIKNKIESTLKKYVNELE 350

Query: 353 TYGGLGIITKENRAGLVLQLMNKFAARFISSIEGTSSDISTKELCGGARIYYIYNDIFGH 412
           +   LG  T ++ + +VL ++  F+  +   ++G + +++++EL GGARI +++++IF +
Sbjct: 351 S---LGPETMDSASSIVLSMITDFSNEYTGILDGEAKELTSQELSGGARISFVFHEIFKN 407

Query: 413 SLESINPTANLSTADIRTAIRNSTGPRPSLFVPELAFDLLVKPQIYLLLEPSQRCVELVY 472
            ++S++P   +  +DIRT + NS+G  PSLFV   AF++LVK QI    EPS R V LV+
Sbjct: 408 GVDSLDPFDQIKDSDIRTIMYNSSGSAPSLFVGTEAFEVLVKQQIRRFEEPSLRLVTLVF 467

Query: 473 EELMKICHNCGS-PELARYPKLQAKLIEVVSELLRERLGPTRSYVESLIDIHRAYINTNH 531
           +EL+++     S P+ ARYP L+  +     + L+E + PT  +V+ +I   + YINT H
Sbjct: 468 DELVRMLKQIISQPKYARYPALREAISTQFIDYLKEAIVPTNEFVQDIIKSEQTYINTAH 527

Query: 532 PNFLSATEAMSDIAEAKRANQELSVKKNLDLEEVKLSLTNDFAKKPNENHILNTSKKADS 591
           P+ L  ++AMS + E                   KL             H   T+    +
Sbjct: 528 PDLLKGSQAMSMVEE-------------------KL-------------HPRPTAVDPKT 555

Query: 592 GNTAFNNDSSSEDDEKAPGKQSKDSFLNYFFGKDQQIAGNYKGFSDNSQFSNFNRYEQTE 651
           G    N   +    +  P  + K  F   FF                           T+
Sbjct: 556 GKPLPNQPPA----KPMPAVEEKSGFFGGFFS--------------------------TK 585

Query: 652 HQKHLANFENLKISDPVVEERNDTPQLTEREQLECELIRRLIVSYFGIVREMIQDQIPKA 711
           ++K LA  E+     PV++    T Q+TERE +E E+I+ LI SYF IV+  I D +PKA
Sbjct: 586 NKKKLAALES---PPPVLKA---TGQMTERETMETEVIKLLINSYFNIVKRTIADLVPKA 639

Query: 712 VMCLLVNFSKEIIQNRLVTKLYKESLFEDLLMEDQNLAQDRQKCVKLLD 760
           +M  L+  SK  +Q  L+ KLY     ++L  E+    Q R++C ++++
Sbjct: 640 LMLKLIVKSKNDMQKVLLQKLYGNQDIDELTKENDITIQRRKECQRMIE 688

>Scas_668.28
          Length = 722

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/774 (41%), Positives = 469/774 (60%), Gaps = 84/774 (10%)

Query: 5   EDLIPTVNKLQDVMYDAGIDT---LDLPVLAVIGSQSSGKSSILETLVGKDFLPRGTGIV 61
           E LI T+NKLQD +   G  +   +DLP + V+GSQSSGKSS+LE +VG+DFLPRGTGIV
Sbjct: 3   EHLISTINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNN--------IAPDSPLINDYDQETDTPQDHESV-PEELTLEDHLRKNQ-G 111
           TRRPLVLQL N         AP +   ND  ++       +    +E    D  +K + G
Sbjct: 63  TRRPLVLQLINRRSKKEKEAAPQANTKNDVSKQLLDLDLQDDADKKEAPASDKTKKGEKG 122

Query: 112 LEPQGKD---EWGEFLHLPGRRFYNFKDIRKEIENETARIAGKNKGISRIPINLKVFSPR 168
              Q +D   EWGEFLHLPG++F+NF +IR+EI  ET ++ G N GIS IPINL+++SP 
Sbjct: 123 ATSQSEDNAEEWGEFLHLPGKKFFNFDEIRQEIVRETEKVTGTNVGISSIPINLRIYSPY 182

Query: 169 VLNLTLVDLPGITKVPIGEQPADIEKQIKNLILEYVAKPNCIILAVSPANVDLVNSESLK 228
           VL LTLVDLPG+TKVP+G+QP DIEKQIKN++L+Y++KPN IIL+V+ AN DL NS+ LK
Sbjct: 183 VLTLTLVDLPGLTKVPVGDQPPDIEKQIKNMLLKYISKPNAIILSVNAANTDLANSDGLK 242

Query: 229 LARDVDPHGKRTIGVITKMDLMDSGTNALDILSGKLYPLRLGFVGIVNRSQQDIQANRTV 288
           LAR+VDP G RTIGV+TK+DLMD GT+ +DIL+G++ PLR G++ ++NR Q+DI+  +T+
Sbjct: 243 LAREVDPEGTRTIGVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKDIEGKKTI 302

Query: 289 EEALNNEEAFFSRHPVYRTISTRCGTRYLAKLLNQILMNHIRDKLPDIKARLNTLMGQTE 348
             AL +E+ FF  HP Y + +  CGT YLAK LN IL++HIR  LPDIKA++   + + +
Sbjct: 303 RSALEDEKRFFEEHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPDIKAKIENTLKKYQ 362

Query: 349 QELTTYGGLGIITKENRAGLVLQLMNKFAARFISSIEGTSSDISTKELCGGARIYYIYND 408
            EL +   LG  T ++   +VL ++  F+  +   ++G + +++++EL GGARI +++++
Sbjct: 363 NELIS---LGPETMDSSNSIVLSMITDFSNEYSGILDGEAKELTSQELSGGARISFVFHE 419

Query: 409 IFGHSLESINPTANLSTADIRTAIRNSTGPRPSLFVPELAFDLLVKPQIYLLLEPSQRCV 468
           +F + ++S++P   +  +DIRT + NS+G  PSLFV   AF++LVK QI    EPS R V
Sbjct: 420 VFKNGVDSLDPFDQIKDSDIRTIMYNSSGSAPSLFVGTQAFEVLVKQQIKRFEEPSLRLV 479

Query: 469 ELVYEELMKICHN-CGSPELARYPKLQAKLIEVVSELLRERLGPTRSYVESLIDIHRAYI 527
            LV++EL++I       P+ ARYP L+  +     + L+E + PT  +V  +ID  + YI
Sbjct: 480 NLVFDELVRILKQIITQPKYARYPALREAISNEFIDFLKESMIPTNKFVTDIIDAEQTYI 539

Query: 528 NTNHPNFLSATEAMSDIAEAKRANQELSVKKNLDLEEVK-LSLTNDFAKKPNENHILNTS 586
           NT HP+ L  + AM+ + E     ++++    LD +  K L       + P+ + +++  
Sbjct: 540 NTAHPDLLKGSRAMAMVEERLHPPRQIA----LDPKTGKPLPQQQQQQQNPSNDVLVSED 595

Query: 587 KKADSGNTAFNNDSSSEDDEKAPGKQSKDSFLNYFFGKDQQIAGNYKGFSDNSQFSNFNR 646
           K                               N FFG          GF     F+  N+
Sbjct: 596 K-------------------------------NGFFG----------GF-----FTTKNK 609

Query: 647 YEQTEHQKHLANFENLKISDPVVEERNDTPQLTEREQLECELIRRLIVSYFGIVREMIQD 706
                  K LA  E+     PV++    T Q+TERE  E E+I+ LI SYFGIV+  + D
Sbjct: 610 -------KKLAALES---PPPVLKA---TGQMTERETTETEVIKLLIESYFGIVKRTVAD 656

Query: 707 QIPKAVMCLLVNFSKEIIQNRLVTKLYKESLFEDLLMEDQNLAQDRQKCVKLLD 760
            IPKA+M  L+  S+  IQ  L+ KLY     +DL  E++   Q R++C +++D
Sbjct: 657 IIPKALMLKLIVKSRTDIQKVLLEKLYSSGQLKDLTKENELTIQRRKECNRMVD 710

>Sklu_2326.4 YKR001C, Contig c2326 6273-8345
          Length = 690

 Score =  518 bits (1335), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 262/552 (47%), Positives = 378/552 (68%), Gaps = 18/552 (3%)

Query: 5   EDLIPTVNKLQDVMYDAGIDT---LDLPVLAVIGSQSSGKSSILETLVGKDFLPRGTGIV 61
           E LI T+NKLQD +   G  +   +DLP + V+GSQSSGKSS+LE +VG+DFLPRGTGIV
Sbjct: 3   EALIATINKLQDALAPLGGGSQSPVDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNNIAPDSPLINDYDQETDTPQDHESVPEELTLEDHLRKNQGLEPQGKDEWG 121
           TRRPLVLQL         IN   ++  T Q  ++   +L + D  +K Q  +    +EWG
Sbjct: 63  TRRPLVLQL---------INKRTKKDSTLQSAKNELLDLNVADDQKKGQSED--NAEEWG 111

Query: 122 EFLHLPGRRFYNFKDIRKEIENETARIAGKNKGISRIPINLKVFSPRVLNLTLVDLPGIT 181
           EFLH+PG++FYNF  IR+EI  ET +  GKN GIS IPINL+++SP VL LTLVDLPG+T
Sbjct: 112 EFLHIPGKKFYNFDQIRQEIVIETEKTTGKNAGISPIPINLRIYSPHVLTLTLVDLPGLT 171

Query: 182 KVPIGEQPADIEKQIKNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRTI 241
           KVP+G+QPADIEKQIK+++L+Y++KPN IIL+V+ AN DL NS+ LKLAR+VDP G RTI
Sbjct: 172 KVPVGDQPADIEKQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKLAREVDPEGTRTI 231

Query: 242 GVITKMDLMDSGTNALDILSGKLYPLRLGFVGIVNRSQQDIQANRTVEEALNNEEAFFSR 301
           GV+TK+DLMD GT+ +DIL+G++ PLR G++ ++NR Q+DI+A++T+  AL +E+ FF  
Sbjct: 232 GVLTKVDLMDHGTDVIDILAGRVIPLRYGYIPVINRGQKDIEAHKTIRAALEDEKKFFEN 291

Query: 302 HPVYRTISTRCGTRYLAKLLNQILMNHIRDKLPDIKARLNTLMGQTEQELTTYGGLGIIT 361
           HP Y + +  CGT YLAK LN IL++HIR  LP+IK ++   + + + EL +   LG  T
Sbjct: 292 HPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPEIKNKIEVTLKKYQAELLS---LGPET 348

Query: 362 KENRAGLVLQLMNKFAARFISSIEGTSSDISTKELCGGARIYYIYNDIFGHSLESINPTA 421
            ++   +VL ++  F+  +   ++G + ++S++EL GGARI +++++IF + + +++P  
Sbjct: 349 MDSPNSIVLSMITDFSKEYTGILDGEARELSSQELSGGARISFVFHEIFKNGVNALDPFD 408

Query: 422 NLSTADIRTAIRNSTGPRPSLFVPELAFDLLVKPQIYLLLEPSQRCVELVYEELMKICHN 481
            +  +DIRT + NS+G  PSLFV   AF++LVK QI    EPS R V LV++EL++I   
Sbjct: 409 QIKDSDIRTIMYNSSGSAPSLFVGTQAFEVLVKQQIRRFEEPSLRLVSLVFDELVRILKQ 468

Query: 482 CGS-PELARYPKLQAKLIEVVSELLRERLGPTRSYVESLIDIHRAYINTNHPNFLSATEA 540
             S P+ +RYP L+  L     + L+E + PT  +V  +I   + YINT HP+ L  ++A
Sbjct: 469 IISHPKYSRYPGLREALSNYFVQFLKEAIIPTNEFVLDVIRSEQTYINTAHPDLLKGSQA 528

Query: 541 MSDIAEAKRANQ 552
           M+ + E     Q
Sbjct: 529 MATVEEKLHPRQ 540

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (62%)

Query: 675 TPQLTEREQLECELIRRLIVSYFGIVREMIQDQIPKAVMCLLVNFSKEIIQNRLVTKLYK 734
           T Q+TERE +E E+I+ LI SYFGIV+  + D IPKA+M  L+  SK  IQ  L+ KLY 
Sbjct: 593 TGQMTERETMETEVIKLLIDSYFGIVKRTVADIIPKAIMLKLIVKSKNDIQKILLEKLYG 652

Query: 735 ESLFEDLLMEDQNLAQDRQKCVKLLD 760
                +L  E+    Q R++C K+++
Sbjct: 653 NQDIAELTKENDITIQRRKECHKMVE 678

>ABL001W [591] [Homologous to ScYKR001C (VPS1) - SH]
           complement(395835..397892) [2058 bp, 685 aa]
          Length = 685

 Score =  518 bits (1333), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 261/546 (47%), Positives = 371/546 (67%), Gaps = 19/546 (3%)

Query: 5   EDLIPTVNKLQDVMYDAGIDT---LDLPVLAVIGSQSSGKSSILETLVGKDFLPRGTGIV 61
           E LI T+NKLQD +   G  +   +DLP + V+GSQSSGKSS+LE +VG+DFLPRG+GIV
Sbjct: 3   EHLIATINKLQDALAPLGGGSQSPVDLPQITVVGSQSSGKSSVLENIVGRDFLPRGSGIV 62

Query: 62  TRRPLVLQLNNIAPDSPLINDYDQETDTPQDHESVPEELTLEDHLRKNQGLEPQGKDEWG 121
           TRRPLVLQL         IN   ++ D    H  +   L L+    +  G      +EWG
Sbjct: 63  TRRPLVLQL---------INRRGKKGDKRNAHGDL---LELDVAADQKTGQSEDNAEEWG 110

Query: 122 EFLHLPGRRFYNFKDIRKEIENETARIAGKNKGISRIPINLKVFSPRVLNLTLVDLPGIT 181
           EFLH PG++FYNF  IR+EI NET ++ GKN GIS IPINL+++SP VL LTLVDLPG+T
Sbjct: 111 EFLHAPGKKFYNFDQIRQEIVNETEKLTGKNAGISPIPINLRIYSPHVLTLTLVDLPGLT 170

Query: 182 KVPIGEQPADIEKQIKNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRTI 241
           KVP+G+QP DIE QIKN+I++Y++KPN IILAV+ AN DL NS+ LKLAR+VDP G RTI
Sbjct: 171 KVPVGDQPVDIESQIKNMIMQYISKPNAIILAVNAANADLANSDGLKLAREVDPEGTRTI 230

Query: 242 GVITKMDLMDSGTNALDILSGKLYPLRLGFVGIVNRSQQDIQANRTVEEALNNEEAFFSR 301
           GV+TK+DLMD GT+ +DILSG++ PLR G+V ++NR Q+DI++ +T+ EALN+E+ FF  
Sbjct: 231 GVLTKIDLMDEGTDVVDILSGRIIPLRYGYVPVINRGQKDIESRKTIREALNDEKRFFEN 290

Query: 302 HPVYRTISTRCGTRYLAKLLNQILMNHIRDKLPDIKARLNTLMGQTEQELTTYGGLGIIT 361
           HP Y + +  CGT YLAK LN IL++HIR  LP+IK ++   + + + EL     LG  T
Sbjct: 291 HPSYSSNANYCGTPYLAKKLNSILLHHIRQTLPEIKNKIELSLKKYQAELL---ALGPET 347

Query: 362 KENRAGLVLQLMNKFAARFISSIEGTSSDISTKELCGGARIYYIYNDIFGHSLESINPTA 421
            ++   +VL ++  F+  +   ++G + ++S++EL GGARI +++++IF   + +++P  
Sbjct: 348 LDSPNSIVLSMITDFSKEYTGILDGEAKELSSQELSGGARISFVFHEIFKGGVYALDPFD 407

Query: 422 NLSTADIRTAIRNSTGPRPSLFVPELAFDLLVKPQIYLLLEPSQRCVELVYEELMKICHN 481
            +  +DIRT + NS+G  PSLFV   AF++LVK QI    +PS R V L+++EL++I   
Sbjct: 408 QIKDSDIRTIMYNSSGAAPSLFVGTEAFEVLVKQQIQRFEDPSLRLVALIFDELVRILRE 467

Query: 482 CGS-PELARYPKLQAKLIEVVSELLRERLGPTRSYVESLIDIHRAYINTNHPNFLSATEA 540
             S P+ ARYP L+  +     + L+ER+ P   +V  +I   + YINT HP+ L  ++A
Sbjct: 468 IISQPKYARYPGLREAISNYFIQYLKERIIPANDFVVDIIKSEQTYINTAHPDLLKGSQA 527

Query: 541 MSDIAE 546
           M+ + E
Sbjct: 528 MAMVEE 533

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 50/81 (61%)

Query: 675 TPQLTEREQLECELIRRLIVSYFGIVREMIQDQIPKAVMCLLVNFSKEIIQNRLVTKLYK 734
           T Q+TERE LE E+I+ LI SYF IV+  + D IPKAVM  L+  SK  IQ  L+ KLY 
Sbjct: 588 TGQMTERETLETEVIKLLIESYFSIVKRTVADLIPKAVMLKLIVKSKNDIQKILLEKLYG 647

Query: 735 ESLFEDLLMEDQNLAQDRQKC 755
               E+L  E+    Q R++C
Sbjct: 648 NQDIEELTKENDITIQRRKEC 668

>Kwal_26.7924
          Length = 691

 Score =  515 bits (1327), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 259/546 (47%), Positives = 373/546 (68%), Gaps = 19/546 (3%)

Query: 5   EDLIPTVNKLQDVMYDAGIDT---LDLPVLAVIGSQSSGKSSILETLVGKDFLPRGTGIV 61
           E LI T+NKLQD +   G  +   +DLP + V+G+QSSGKSS+LE +VG+DFLPRGTGIV
Sbjct: 3   EALISTINKLQDALAPLGGGSQSPIDLPQITVVGTQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNNIAPDSPLINDYDQETDTPQDHESVPEELTLEDHLRKNQGLEPQGKDEWG 121
           TRRPLVLQL         +N    + +T Q  ++  + L L +  +K  G      DEWG
Sbjct: 63  TRRPLVLQL---------VNKRSSKGNTSQSSKN--DLLELGNQEQKG-GQSEDNVDEWG 110

Query: 122 EFLHLPGRRFYNFKDIRKEIENETARIAGKNKGISRIPINLKVFSPRVLNLTLVDLPGIT 181
           EFLHLPG++F+NF +IR+EI NET +  GKN GIS +PINLK+ SP VL LTLVDLPG+T
Sbjct: 111 EFLHLPGKKFFNFDEIRQEIVNETEKTTGKNAGISPVPINLKICSPHVLTLTLVDLPGLT 170

Query: 182 KVPIGEQPADIEKQIKNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRTI 241
           KVP+G+QPADIEKQIK+++L Y++KPN IIL+V+ AN DL NS+ LKLAR+VDP G RTI
Sbjct: 171 KVPVGDQPADIEKQIKDMLLRYISKPNAIILSVNAANTDLANSDGLKLAREVDPEGTRTI 230

Query: 242 GVITKMDLMDSGTNALDILSGKLYPLRLGFVGIVNRSQQDIQANRTVEEALNNEEAFFSR 301
           GV+TK+DLMD GT+ +DIL+G++ PLR G++ ++NR Q+DI+  +T+  AL +E  +F  
Sbjct: 231 GVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKDIEVKKTIRAALEDERRYFEN 290

Query: 302 HPVYRTISTRCGTRYLAKLLNQILMNHIRDKLPDIKARLNTLMGQTEQELTTYGGLGIIT 361
           HP Y + +  CGT YLAK LN IL++HIR  LPDIK ++   + + + EL +   LG  T
Sbjct: 291 HPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPDIKNKIELTLKKYQAELMS---LGPET 347

Query: 362 KENRAGLVLQLMNKFAARFISSIEGTSSDISTKELCGGARIYYIYNDIFGHSLESINPTA 421
            ++   ++L ++  F+  +   ++G + ++S++EL GGARI +++++I+ + + +++P  
Sbjct: 348 MDSPNSIILSMITDFSKEYTGILDGEAKELSSQELSGGARISFVFHEIYKNGVRALDPFD 407

Query: 422 NLSTADIRTAIRNSTGPRPSLFVPELAFDLLVKPQIYLLLEPSQRCVELVYEELMKICHN 481
            +  +DIRT + NS+G  PSLFV   AF++LVK QI    EPS R V LV++EL++I   
Sbjct: 408 QIKDSDIRTIMYNSSGSAPSLFVGTQAFEVLVKQQINRFEEPSLRLVSLVFDELVRILKQ 467

Query: 482 CGS-PELARYPKLQAKLIEVVSELLRERLGPTRSYVESLIDIHRAYINTNHPNFLSATEA 540
             S P+  RYP L+  +     + L+E + PT S+V  +I   + YINT HP+ L  ++A
Sbjct: 468 IISQPKYGRYPGLREAMSNYFIQFLKEAIIPTNSFVTDIIQAEQTYINTAHPDLLKGSQA 527

Query: 541 MSDIAE 546
           M+ I E
Sbjct: 528 MAMIEE 533

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 63/108 (58%), Gaps = 6/108 (5%)

Query: 651 EHQKHLANFENLKISDPVVEERNDTPQLTEREQLECELIRRLIVSYFGIVREMIQDQIPK 710
           +++K LA  E+     PV++    T Q+TERE +E E+I+ LI SYF IV+  + D IPK
Sbjct: 576 KNKKKLAALES---PPPVLKA---TGQMTERETMETEVIKLLIESYFNIVKRTVADVIPK 629

Query: 711 AVMCLLVNFSKEIIQNRLVTKLYKESLFEDLLMEDQNLAQDRQKCVKL 758
           AVM  L+  SK  IQ  L+ KLY      +L  E+    Q R++C K+
Sbjct: 630 AVMLKLIVKSKNDIQKILLEKLYGNQDIAELTKENDITIQRRKECHKM 677

>KLLA0B13277g 1165743..1167797 highly similar to sp|P21576
           Saccharomyces cerevisiae YKR001c VPS1 member of the
           dynamin family of GTPases, start by similarity
          Length = 684

 Score =  491 bits (1263), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 251/546 (45%), Positives = 363/546 (66%), Gaps = 21/546 (3%)

Query: 5   EDLIPTVNKLQDVMYDAGIDT---LDLPVLAVIGSQSSGKSSILETLVGKDFLPRGTGIV 61
           E LI T+NKLQD +   G  +   +DLP + V+GSQSSGKSS+LE +VG+DFLPRGTGIV
Sbjct: 3   ERLIATINKLQDALAPLGGGSQTPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNNIAPDSPLINDYDQETDTPQDHESVPEELTLEDHLRKNQGLEPQGKDEWG 121
           TRRPL+LQL N                  ++ +   EEL   D+   N G      +EWG
Sbjct: 63  TRRPLILQLIN--------------RRVKKETKHATEELLDLDNSAANGGQNEDNAEEWG 108

Query: 122 EFLHLPGRRFYNFKDIRKEIENETARIAGKNKGISRIPINLKVFSPRVLNLTLVDLPGIT 181
           EF HLPG++ +NF +IRKEI  ET +  GKN GIS +PI L+V+SP VL LTLVDLPG+T
Sbjct: 109 EFGHLPGKKLFNFNEIRKEIVLETDKSTGKNAGISAVPITLRVYSPHVLTLTLVDLPGLT 168

Query: 182 KVPIGEQPADIEKQIKNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRTI 241
           KVP+G+QPADIE+QIK++IL Y+ KPN IILAV+PAN DL NS+ LKLAR+VDP G RTI
Sbjct: 169 KVPVGDQPADIERQIKDMILTYIKKPNAIILAVNPANADLANSDGLKLAREVDPDGSRTI 228

Query: 242 GVITKMDLMDSGTNALDILSGKLYPLRLGFVGIVNRSQQDIQANRTVEEALNNEEAFFSR 301
           GV+TK+DLMD GT+ +DIL+G++ PL+ G++ ++NR Q+DI+ N+T+  AL +E+ FF  
Sbjct: 229 GVLTKVDLMDEGTDVIDILAGRVIPLKFGYIPVINRGQKDIEKNKTIRSALEDEKRFFEN 288

Query: 302 HPVYRTISTRCGTRYLAKLLNQILMNHIRDKLPDIKARLNTLMGQTEQELTTYGGLGIIT 361
           HP Y   +  CGT YL K LN IL++HIR  LPDIK ++   + + + EL +    G  +
Sbjct: 289 HPSYSARALYCGTPYLTKKLNSILLHHIRQTLPDIKHKIEVTLKKYQTELLSL---GPES 345

Query: 362 KENRAGLVLQLMNKFAARFISSIEGTSSDISTKELCGGARIYYIYNDIFGHSLESINPTA 421
             + + +VL ++  F+  +   ++G + ++++KEL GGAR+ +++++IF + + +++P  
Sbjct: 346 LSSSSSIVLSMITDFSKEYTGILDGEARELTSKELSGGARVSFVFHEIFKNGVYALDPFD 405

Query: 422 NLSTADIRTAIRNSTGPRPSLFVPELAFDLLVKPQIYLLLEPSQRCVELVYEELMKICHN 481
            +  +DIRT + N +G  PSLFV   AF++LVK QI    +PS R V LV++EL++I   
Sbjct: 406 QIKDSDIRTIMYNCSGSAPSLFVGTEAFEVLVKKQISRFEQPSLRLVNLVFDELVRILKQ 465

Query: 482 -CGSPELARYPKLQAKLIEVVSELLRERLGPTRSYVESLIDIHRAYINTNHPNFLSATEA 540
               P+ +RYP L+  +     + L+E + PT  +V  +I   + YINT HP+ L  ++A
Sbjct: 466 IINQPKYSRYPSLRDAISNNFVQFLKEAVIPTNDFVVDIIKSEQTYINTAHPDLLKGSQA 525

Query: 541 MSDIAE 546
           M+ + E
Sbjct: 526 MAMVEE 531

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 54/86 (62%)

Query: 675 TPQLTEREQLECELIRRLIVSYFGIVREMIQDQIPKAVMCLLVNFSKEIIQNRLVTKLYK 734
           T Q+TERE+LE E+I+ LI SYF IV+  + D IPKAVM  L+  SK  IQ  L+ KLY 
Sbjct: 587 TGQMTEREKLETEVIKLLIDSYFSIVKRSVADFIPKAVMLKLIVKSKNDIQKILLEKLYS 646

Query: 735 ESLFEDLLMEDQNLAQDRQKCVKLLD 760
               ++L  E     Q R++C K+++
Sbjct: 647 SENLDELTKESDLTTQRRKECQKMVN 672

>ACR164C [1211] [Homologous to ScYOR211C (MGM1) - SH]
           (640832..643438) [2607 bp, 868 aa]
          Length = 868

 Score =  177 bits (450), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 103/260 (39%), Positives = 149/260 (57%), Gaps = 47/260 (18%)

Query: 20  DAGIDTLDLPVLAVIGSQSSGKSSILETLVGKDFLPRGTGIVTRRPLVLQLNNIAPDSPL 79
           D     + LP + V+GSQSSGKSS+LE++VG+DFLP+G+ +VTRRP+ L L N       
Sbjct: 200 DTNTPGVTLPSIVVVGSQSSGKSSVLESIVGRDFLPKGSNMVTRRPIELTLVNT------ 253

Query: 80  INDYDQETDTPQDHESVPEELTLEDHLRKNQGLEPQGKDEWGEFLHLPGRRFYNFKDIR- 138
                                             P G +   +F   P  R YN KD R 
Sbjct: 254 ----------------------------------PSGSETTADF---PTHRIYNLKDFRE 276

Query: 139 -KEIENETARIAGKNKGISRIPINLKVFSPRVLNLTLVDLPGITKVPIGEQPADIEKQIK 197
            K I  E       ++ IS  PI L + SPRV +L+LVDLPG  +V   +QP +++ +I+
Sbjct: 277 VKRILMELNLTVPTHEAISEDPIQLTIKSPRVPDLSLVDLPGYIQVEAADQPMELKSKIR 336

Query: 198 NLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRTIGVITKMDLMDSGTNAL 257
           N+  +Y+A+PN IILA+S A+VDL NS +L+ ++  DP G RTIGVITK+DL++  + A 
Sbjct: 337 NVCQKYLAEPN-IILAISAADVDLANSAALRASKLADPQGLRTIGVITKLDLVEP-SAAR 394

Query: 258 DILSGKLYPLRLGFVGIVNR 277
           D+L  K YPL++G+VG++ +
Sbjct: 395 DLLMNKKYPLKMGYVGVITK 414

>KLLA0D06721g complement(578072..580723) similar to sp|P32266
           Saccharomyces cerevisiae YOR211c MGM1 dynamin-like
           protein, hypothetical start
          Length = 883

 Score =  174 bits (441), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 104/261 (39%), Positives = 147/261 (56%), Gaps = 47/261 (18%)

Query: 20  DAGIDTLDLPVLAVIGSQSSGKSSILETLVGKDFLPRGTGIVTRRPLVLQLNNIAPDSPL 79
           D+    L LP + VIGSQSSGKSS+LE++VGKDFLP+GT +VTRRP+ L L N       
Sbjct: 213 DSTSANLALPSIVVIGSQSSGKSSVLESIVGKDFLPKGTNMVTRRPIELTLVN------- 265

Query: 80  INDYDQETDTPQDHESVPEELTLEDHLRKNQGLEPQGKDEWGEFLHLPGRRFYNFKDIR- 138
                    TP   E   +                            P  R YN KD + 
Sbjct: 266 ---------TPTSQEVTAD---------------------------FPTMRIYNLKDFKE 289

Query: 139 -KEIENETARIAGKNKGISRIPINLKVFSPRVLNLTLVDLPGITKVPIGEQPADIEKQIK 197
            K I  E        + +S  PI L + S RV +L+LVDLPG  +V   +QP +++ +I+
Sbjct: 290 VKRILTEMNMAVPSTEAVSDDPIQLTIKSSRVPDLSLVDLPGYIQVEAVDQPIELKSKIR 349

Query: 198 NLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRTIGVITKMDLMDSGTNAL 257
            L  +Y+ +PN IILA+S A+VDL NS +L+ ++  DP G RTIGV+TK+DL+D+ T A 
Sbjct: 350 QLCDKYLEEPN-IILAISAADVDLANSAALRASKVADPQGLRTIGVVTKLDLVDAKT-AR 407

Query: 258 DILSGKLYPLRLGFVGIVNRS 278
            IL+ + YPL++G+VG++ +S
Sbjct: 408 AILNNRKYPLKMGYVGVITKS 428

>Sklu_1555.2 YOR211C, Contig c1555 412-3066 reverse complement
          Length = 884

 Score =  170 bits (431), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 101/260 (38%), Positives = 150/260 (57%), Gaps = 47/260 (18%)

Query: 20  DAGIDTLDLPVLAVIGSQSSGKSSILETLVGKDFLPRGTGIVTRRPLVLQLNNIAPDSPL 79
           D+    L LP + VIGSQSSGKSS+LE++VGK+FLP+G+ +VTRRP+ L L N       
Sbjct: 215 DSSSANLTLPSIVVIGSQSSGKSSVLESIVGKEFLPKGSNMVTRRPIELTLVN------- 267

Query: 80  INDYDQETDTPQDHESVPEELTLEDHLRKNQGLEPQGKDEWGEFLHLPGRRFYNFKDIR- 138
                    TP  +E   +                            P  R YN +D + 
Sbjct: 268 ---------TPNSNEITAD---------------------------FPALRVYNLQDFKE 291

Query: 139 -KEIENETARIAGKNKGISRIPINLKVFSPRVLNLTLVDLPGITKVPIGEQPADIEKQIK 197
            K I  E       ++ +S  PI L + + RV +L+LVDLPG  +V   +QP +++ +I+
Sbjct: 292 VKRILMELNMAVPTSEAVSEEPIQLTIKASRVPDLSLVDLPGYIQVEAADQPLELKSKIR 351

Query: 198 NLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRTIGVITKMDLMDSGTNAL 257
            L  +Y+A+PN IILA+S A+VDL NS +L+ ++ VDP G+RTIGVITK+DL++    A 
Sbjct: 352 LLCEKYLAEPN-IILAISAADVDLANSAALRASKVVDPLGERTIGVITKLDLVEPA-KAR 409

Query: 258 DILSGKLYPLRLGFVGIVNR 277
           +IL+ K YPL++G+VG++ +
Sbjct: 410 EILNNKKYPLKMGYVGVITK 429

>Kwal_26.8613
          Length = 861

 Score =  169 bits (427), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 99/260 (38%), Positives = 146/260 (56%), Gaps = 47/260 (18%)

Query: 20  DAGIDTLDLPVLAVIGSQSSGKSSILETLVGKDFLPRGTGIVTRRPLVLQLNNIAPDSPL 79
           D+   +L LP + VIGSQSSGKSS+LE++VGK+FLP+G+ +VTRRP+ L L N +  +  
Sbjct: 201 DSSSASLTLPSIVVIGSQSSGKSSVLESIVGKEFLPKGSNMVTRRPIELTLVNTSGSNET 260

Query: 80  INDYDQETDTPQDHESVPEELTLEDHLRKNQGLEPQGKDEWGEFLHLPGRRFYNFKDIR- 138
             D+                                           P  R YN KD   
Sbjct: 261 TADF-------------------------------------------PSLRAYNIKDFNE 277

Query: 139 -KEIENETARIAGKNKGISRIPINLKVFSPRVLNLTLVDLPGITKVPIGEQPADIEKQIK 197
            K I  E       ++ +S  PI L + S RV +L+LVDLPG  +V   +QP +++ +I+
Sbjct: 278 VKRILMELNMAVPSSEAVSADPIQLTIKSSRVPDLSLVDLPGYIQVEAADQPYELKSKIR 337

Query: 198 NLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRTIGVITKMDLMDSGTNAL 257
            +   Y+A+PN IILA+S A+VDL NS +L+ ++  DP G RTIGVITK+DL++    A 
Sbjct: 338 QVCETYLAEPN-IILAISAADVDLANSSALRASKVADPKGLRTIGVITKLDLVEPA-RAK 395

Query: 258 DILSGKLYPLRLGFVGIVNR 277
           +IL+ K YPL++G+VG++ +
Sbjct: 396 EILNSKKYPLKMGYVGVITK 415

>YOR211C (MGM1) [5004] chr15 complement(738924..741632) Peripheral
           membrane protein that mediates mitochondrial
           inheritance, member of dynamin family of GTPases [2709
           bp, 902 aa]
          Length = 902

 Score =  168 bits (426), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 100/265 (37%), Positives = 146/265 (55%), Gaps = 47/265 (17%)

Query: 20  DAGIDTLDLPVLAVIGSQSSGKSSILETLVGKDFLPRGTGIVTRRPLVLQLNNIAPDSPL 79
           D+    L LP + VIGSQSSGKSS+LE++VG++FLP+G+ +VTRRP+ L L N    + +
Sbjct: 223 DSSSAHLTLPSIVVIGSQSSGKSSVLESIVGREFLPKGSNMVTRRPIELTLVNTPNSNNV 282

Query: 80  INDYDQETDTPQDHESVPEELTLEDHLRKNQGLEPQGKDEWGEFLHLPGRRFYNFKDIR- 138
             D+                                           P  R YN KD + 
Sbjct: 283 TADF-------------------------------------------PSMRLYNIKDFKE 299

Query: 139 -KEIENETARIAGKNKGISRIPINLKVFSPRVLNLTLVDLPGITKVPIGEQPADIEKQIK 197
            K +  E       ++ +S  PI L + S RV +L+LVDLPG  +V   +QP +++ +I+
Sbjct: 300 VKRMLMELNMAVPTSEAVSEEPIQLTIKSSRVPDLSLVDLPGYIQVEAADQPIELKTKIR 359

Query: 198 NLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRTIGVITKMDLMDSGTNAL 257
           +L  +Y+  PN IILA+S A+VDL NS +LK ++  DP G RTIGVITK+DL+D    A 
Sbjct: 360 DLCEKYLTAPN-IILAISAADVDLANSSALKASKAADPKGLRTIGVITKLDLVDP-EKAR 417

Query: 258 DILSGKLYPLRLGFVGIVNRSQQDI 282
            IL+ K YPL +G+VG++ ++   I
Sbjct: 418 SILNNKKYPLSMGYVGVITKTPSSI 442

>CAGL0L02783g 322955..325630 highly similar to sp|P32266
           Saccharomyces cerevisiae YOR211c MGM1 dynamin-like
           protein, hypothetical start
          Length = 891

 Score =  168 bits (425), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 101/261 (38%), Positives = 146/261 (55%), Gaps = 47/261 (18%)

Query: 20  DAGIDTLDLPVLAVIGSQSSGKSSILETLVGKDFLPRGTGIVTRRPLVLQLNNIAPDSPL 79
           D+    L LP + VIGSQSSGKSS+LE++VG++FLP+G+ +VTRRP+ L L N       
Sbjct: 213 DSASANLTLPSIVVIGSQSSGKSSVLESIVGREFLPKGSNMVTRRPIELTLVN------- 265

Query: 80  INDYDQETDTPQDHESVPEELTLEDHLRKNQGLEPQGKDEWGEFLHLPGRRFYNFKDIR- 138
                    TP   E+  +                            P  R YN KD R 
Sbjct: 266 ---------TPNVQETTAD---------------------------FPSLRVYNMKDFRE 289

Query: 139 -KEIENETARIAGKNKGISRIPINLKVFSPRVLNLTLVDLPGITKVPIGEQPADIEKQIK 197
            K +  E       ++ +S  PI L + S  V +L+LVDLPG  +V   +QP +++ +I+
Sbjct: 290 VKRMLTELNLAVPASEAVSEEPIQLTIKSAHVPDLSLVDLPGYIQVEAADQPMELKSKIR 349

Query: 198 NLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRTIGVITKMDLMDSGTNAL 257
            L  +Y+A+PN IILA+S A+VDL NS +L+ ++  DP G RTIGVITK+DL+ S   A 
Sbjct: 350 MLCDKYLAEPN-IILAISAADVDLANSSALRASKVADPQGLRTIGVITKLDLV-SAEEAR 407

Query: 258 DILSGKLYPLRLGFVGIVNRS 278
            IL+ + YPL +G+VG++ +S
Sbjct: 408 KILTNRKYPLTMGYVGVITKS 428

>Scas_605.17
          Length = 891

 Score =  166 bits (421), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 101/261 (38%), Positives = 147/261 (56%), Gaps = 47/261 (18%)

Query: 20  DAGIDTLDLPVLAVIGSQSSGKSSILETLVGKDFLPRGTGIVTRRPLVLQLNNIAPDSPL 79
           D+    L LP + VIGSQSSGKSS+LE++VGK+FLP+G+ +VTRRP+ L L N       
Sbjct: 214 DSTSANLTLPSIVVIGSQSSGKSSVLESIVGKEFLPKGSNMVTRRPIELTLVN------- 266

Query: 80  INDYDQETDTPQDHESVPEELTLEDHLRKNQGLEPQGKDEWGEFLHLPGRRFYNFKDIR- 138
                    TP  +E+  +                            P  R YN KD + 
Sbjct: 267 ---------TPGVNETTAD---------------------------FPSLRTYNLKDFKE 290

Query: 139 -KEIENETARIAGKNKGISRIPINLKVFSPRVLNLTLVDLPGITKVPIGEQPADIEKQIK 197
            K I  E        + +S  PI L + S  + +L+LVDLPG  +V   +QP +++ +I+
Sbjct: 291 VKRILMELNMAVPTTEAVSEEPIQLTIKSSSIPDLSLVDLPGYIQVEAADQPTELKTKIR 350

Query: 198 NLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRTIGVITKMDLMDSGTNAL 257
            L  +Y+ +PN IILA+S A+VDL NS +L+ A+  DP G RTIGVITK+DL+ S   A 
Sbjct: 351 QLCDKYLNEPN-IILAISAADVDLANSSALRAAKMADPQGLRTIGVITKLDLI-SPEAAR 408

Query: 258 DILSGKLYPLRLGFVGIVNRS 278
           +IL+ + YPL++G+VG++ +S
Sbjct: 409 NILNNRKYPLKMGYVGVITKS 429

>KLLA0D03476g 296287..300969 similar to sp|P33302 Saccharomyces
            cerevisiae YOR153w PDR5 pleiotropic drug resistance
            protein, start by similarity
          Length = 1560

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 46/93 (49%), Gaps = 9/93 (9%)

Query: 32   AVIGSQSSGKSSILETLVGKDFLPRGTGIVTRRPLVLQLNNIAPDSPL--INDYDQETDT 89
            A++GS  +GK+++L+ L  +      TG++T   LV   N    D+       Y Q+ D 
Sbjct: 927  ALMGSSGAGKTTLLDALADRI----STGVITGDVLV---NGRPTDASFQRSTGYCQQQDL 979

Query: 90   PQDHESVPEELTLEDHLRKNQGLEPQGKDEWGE 122
                ++V E LT   +LR+   +  + KDE+ E
Sbjct: 980  HGRTQTVREALTFSAYLRQPYNVSKKEKDEYVE 1012

>YOR165W (SEY1) [4964] chr15 (644566..646896) Protein involved in
          vesicle formation and protein secretion [2331 bp, 776
          aa]
          Length = 776

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 26 LDLPVLAVIGSQSSGKSSILETLVGKDF 53
          LD  V++V GSQSSGKS++L  L   +F
Sbjct: 35 LDYHVISVFGSQSSGKSTLLNVLFNTNF 62

>AGR264C [4575] [Homologous to ScYOR165W - SH] (1236213..1238588)
          [2376 bp, 791 aa]
          Length = 791

 Score = 33.1 bits (74), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%)

Query: 26 LDLPVLAVIGSQSSGKSSILETLVGKDF 53
          LD  V++V GSQSSGKS++L  L    F
Sbjct: 41 LDYHVISVFGSQSSGKSTLLNALFNTKF 68

>Sklu_2179.4 YOR165W, Contig c2179 7628-9976 reverse complement
          Length = 782

 Score = 33.1 bits (74), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 3/34 (8%)

Query: 20 DAGIDTLDLPVLAVIGSQSSGKSSILETLVGKDF 53
          D G+D     V++V GSQSSGKS++L  L    F
Sbjct: 34 DVGVD---YHVISVFGSQSSGKSTLLNALFNTQF 64

>Kwal_27.9666
          Length = 1474

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 43/91 (47%), Gaps = 9/91 (9%)

Query: 32  AVIGSQSSGKSSILETLVGKDFLPRGTGIVTRRPLVLQLNNIAPDSPLIND--YDQETDT 89
           A++G+  +GK+++L+ L  +      TG+VT   L+   N    D+       Y Q+ D 
Sbjct: 860 ALMGASGAGKTTLLDCLASR----VTTGVVTGDILI---NGNKRDASFARSIGYCQQQDL 912

Query: 90  PQDHESVPEELTLEDHLRKNQGLEPQGKDEW 120
                +V E L    HLR+ Q +    KD++
Sbjct: 913 HLQTATVRESLRFAAHLRQPQSVPSSEKDKY 943

>KLLA0C16984g complement(1482004..1483650) similar to sp|P54791
           Saccharomyces cerevisiae YPR162c ORC4 origin recognition
           complex, 56 KD subunit singleton, start by similarity
          Length = 548

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 78  PLINDYDQETDTPQDHESVPEELTLEDHLRKNQGLEPQGKDEWGEFLHLPGRRFYNFKDI 137
           P I+DYDQ     ++   V +  T+ D LR NQ L+   K++  E   +  + + NFKDI
Sbjct: 314 PSISDYDQFKHVFKELLEVDDS-TIPDQLRWNQFLDETLKNDDSEISRILRQNYENFKDI 372

Query: 138 R 138
           +
Sbjct: 373 Q 373

>CAGL0M12859g 1268191..1271016 highly similar to sp|P32565
           Saccharomyces cerevisiae YIL075c SEN3, start by
           similarity
          Length = 941

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 25/41 (60%)

Query: 470 LVYEELMKICHNCGSPELARYPKLQAKLIEVVSELLRERLG 510
           +V+E++M  C      +LA    L+A  ++VV  +L+ERLG
Sbjct: 132 IVFEKMMTKCTQANEYKLALGIALEAFRLDVVKSILQERLG 172

>YOR162C (YRR1) [4961] chr15 complement(639560..641992)
           Transcription factor involved in drug-induced
           transcriptional regulation, including activation of
           multidrug transporter gene SNQ2, has a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain [2433 bp, 810 aa]
          Length = 810

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 3/50 (6%)

Query: 315 RYLAKLLNQILMNHIRDKLPDIKARLNTLMGQTEQELTTYGGLGIITKEN 364
           RYL      +L  + RDK PD+KA    ++   E+EL   G LG  T EN
Sbjct: 467 RYLKLTRPMLLTLYDRDKFPDLKAYSKRIINFVEEEL---GPLGHYTGEN 513

>YDR180W (SCC2) [1023] chr4 (821288..825769) Cohesin, protein
           required for mitotic sister chromatid cohesion [4482 bp,
           1493 aa]
          Length = 1493

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 74/162 (45%), Gaps = 13/162 (8%)

Query: 533 NFLSATEAMSDIAEAKRANQELSVKKNLDLEEVKLSLTNDFAKKPNENHILNTSKKADSG 592
           NFL   E +S +A++      LS  K L+ + + +   ++   +P   H L  S  +++G
Sbjct: 105 NFL---EGLSPLAQSV-----LSTHKGLN-DSINIEKKSEIVSRPEAKHKLE-SVTSNAG 154

Query: 593 NTAFNNDSSSEDDEKAPGKQSKDSFLNYFFGKDQQIAGNYKGFSDNS-QFSNFNRYEQTE 651
           N +FN++SS++  + + G     + L   +  D +   +  GF  NS +  N   + Q  
Sbjct: 155 NLSFNDNSSNKKTKTSTGVTMTQANLAEQYLNDLKNILDIVGFDQNSAEIGNIEYWLQLP 214

Query: 652 HQKHLANFENLKISDPVVEERNDTPQLTEREQLECELIRRLI 693
           ++K +     L      ++   D PQL+    +E   + RL+
Sbjct: 215 NKKFVLTTNCLTKLQMTIKNITDNPQLS--NSIEITWLLRLL 254

>Scas_636.21
          Length = 622

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 43/108 (39%), Gaps = 14/108 (12%)

Query: 389 SDISTKELCGGARIYYIYNDIFGHSLESINPTANLSTADIRTAIRNSTGPRPSLFVPELA 448
           S+IS   LC    I       + H L+S NP  NLS      A    T P   L +P+L 
Sbjct: 467 SEISNNYLCVETPIQVAKWVPWDHILKSTNPNGNLS----YDASATLTLPGHELPLPKLG 522

Query: 449 FDLLVKPQIYLLLEPSQRCVELVYEELMKICHNCGS-------PELAR 489
              L   ++  L++ S+ CV L           CGS       PEL R
Sbjct: 523 ISAL---KLKSLIKSSRECVNLAVARECNTVILCGSDVSSNERPELLR 567

>Scas_707.8
          Length = 294

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 9/60 (15%)

Query: 33 VIGSQSSGKSSILETLVGKDFLPRGTGIVTRRPLVLQLNNIAPDSPLINDYDQETDTPQD 92
          V+G+  +GKS++L+ L GK     G  +V         N + P SPL    D +  T +D
Sbjct: 38 VVGANGAGKSTLLKLLAGKHLCLNGKILV---------NGLDPFSPLSMYQDNDKTTAED 88

>Scas_565.5
          Length = 1047

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 54/124 (43%), Gaps = 27/124 (21%)

Query: 456  QIYLLLEPSQRCVELVYEELMKICHNCGSPELARYPKLQAKLIEVVSELLRERLGPTRSY 515
            ++YL L    +  E +Y EL +   + G             +  + +   R++  P + Y
Sbjct: 928  EVYLYLGSRHKREEYLYGELWEAYKDAGI------------ITHIGAAFSRDQ--PQKIY 973

Query: 516  V-----ESLIDIHRAYINTNHPNFLSA--------TEAMSDIAEAKRANQELSVKKNLDL 562
            +     ESL+D+ +A+I+ N   +L          T+A+ DI +A    + + V     +
Sbjct: 974  IQDRIKESLVDLKKAFIDNNGSFYLCGPTWPVPDITKALQDILQADADERGVKVDLEAAI 1033

Query: 563  EEVK 566
            EE+K
Sbjct: 1034 EELK 1037

>AER245C [2747] [Homologous to ScYDR361C (BCP1) - SH]
           (1091269..1092084) [816 bp, 271 aa]
          Length = 271

 Score = 29.6 bits (65), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%)

Query: 595 AFNNDSSSEDDEKAPGKQSKDSFLNYFFGKDQQI 628
           +F+ DS SED+   P K+ K S L+YF  +D+ +
Sbjct: 195 SFDMDSDSEDESAKPRKRVKGSELDYFHEEDRHM 228

>Kwal_23.3007
          Length = 1170

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 54/118 (45%), Gaps = 12/118 (10%)

Query: 293  NNEEAFFSRHPVYRTISTRCGTRYLAKLLNQILMNHIRDKLPDIKA-RLNTLMGQTEQEL 351
            NNE +FF  H   RT+      + + ++ N++  N+++ K+ D  A   + L+G+    L
Sbjct: 1019 NNESSFFKTHHKKRTLDPTWNEKCVVQINNRV-NNYLKIKMMDWDAGNKDDLIGEAIFPL 1077

Query: 352  TTY-----GGLGI--ITKENRAGLVLQLMNKFAARFISSI---EGTSSDISTKELCGG 399
                    G + I  +  E + G +L L   F  R+  S+   E    D+++K L  G
Sbjct: 1078 ANVDPEAPGDIDIPLVGPEGKDGGILHLNFSFNPRYTLSVRKREKKVGDLASKGLSSG 1135

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.135    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,394,625
Number of extensions: 1185637
Number of successful extensions: 5325
Number of sequences better than 10.0: 105
Number of HSP's gapped: 5445
Number of HSP's successfully gapped: 119
Length of query: 762
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 653
Effective length of database: 12,822,747
Effective search space: 8373253791
Effective search space used: 8373253791
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)