Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_33.1519542842222760.0
KLLA0F12914g4304019521e-126
YLL002W (RTT109)4364008981e-117
CAGL0D05786g4234228201e-106
Scas_629.204404008031e-103
AAL173C4204217726e-99
YNR011C (PRP2)87626664.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.15195
         (422 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.15195                                                         881   0.0  
KLLA0F12914g complement(1190220..1191512) similar to sgd|S000392...   371   e-126
YLL002W (RTT109) [3417] chr12 (146290..147600) Protein involved ...   350   e-117
CAGL0D05786g 550165..551436 similar to tr|Q07794 Saccharomyces c...   320   e-106
Scas_629.20                                                           313   e-103
AAL173C [14] [Homologous to ScYLL002W (REM50) - SH] (38265..3952...   301   6e-99
YNR011C (PRP2) [4594] chr14 complement(644319..646949) Pre-mRNA ...    30   4.1  

>Kwal_33.15195
          Length = 428

 Score =  881 bits (2276), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/422 (100%), Positives = 422/422 (100%)

Query: 1   MLMSSLEVLLRDVLPQDVEVEVAHLQSPPRETYPVVLPHSQANGKQQVVKIQHFFGLCTD 60
           MLMSSLEVLLRDVLPQDVEVEVAHLQSPPRETYPVVLPHSQANGKQQVVKIQHFFGLCTD
Sbjct: 1   MLMSSLEVLLRDVLPQDVEVEVAHLQSPPRETYPVVLPHSQANGKQQVVKIQHFFGLCTD 60

Query: 61  NKLFYGLEVFVYVVVQHSKVVDKILFISKADTNGYCARRLSIKNITKALIEYVTSLDPLY 120
           NKLFYGLEVFVYVVVQHSKVVDKILFISKADTNGYCARRLSIKNITKALIEYVTSLDPLY
Sbjct: 61  NKLFYGLEVFVYVVVQHSKVVDKILFISKADTNGYCARRLSIKNITKALIEYVTSLDPLY 120

Query: 121 YLVKVIPMNRTRQNYANAITKSTTTKRALQIIRNRHTAGKTSTPDISNLYTQFEKCDPGW 180
           YLVKVIPMNRTRQNYANAITKSTTTKRALQIIRNRHTAGKTSTPDISNLYTQFEKCDPGW
Sbjct: 121 YLVKVIPMNRTRQNYANAITKSTTTKRALQIIRNRHTAGKTSTPDISNLYTQFEKCDPGW 180

Query: 181 TCKICLFTRSEPHYLFSESSKNPEKHILSGEQLLHWWLSVVDAVLFKNFTSDTKARLQIP 240
           TCKICLFTRSEPHYLFSESSKNPEKHILSGEQLLHWWLSVVDAVLFKNFTSDTKARLQIP
Sbjct: 181 TCKICLFTRSEPHYLFSESSKNPEKHILSGEQLLHWWLSVVDAVLFKNFTSDTKARLQIP 240

Query: 241 GEEKLCTEKYLNGKKFPQWRVGDIFNSEPNDLAIFKIPVFPDDPKGRFLEQLVDENRAKK 300
           GEEKLCTEKYLNGKKFPQWRVGDIFNSEPNDLAIFKIPVFPDDPKGRFLEQLVDENRAKK
Sbjct: 241 GEEKLCTEKYLNGKKFPQWRVGDIFNSEPNDLAIFKIPVFPDDPKGRFLEQLVDENRAKK 300

Query: 301 VQVTGFWTELQIQQEFRMGATVAVIGIDGRVANPCIMPRECEIILPKSIKAFNMIKTYIT 360
           VQVTGFWTELQIQQEFRMGATVAVIGIDGRVANPCIMPRECEIILPKSIKAFNMIKTYIT
Sbjct: 301 VQVTGFWTELQIQQEFRMGATVAVIGIDGRVANPCIMPRECEIILPKSIKAFNMIKTYIT 360

Query: 361 GEEYDTIDGAYEACANIRDFVALRLGRSLLKVQGTLKTSTSEHGGHVDHSRLPVNHLNTS 420
           GEEYDTIDGAYEACANIRDFVALRLGRSLLKVQGTLKTSTSEHGGHVDHSRLPVNHLNTS
Sbjct: 361 GEEYDTIDGAYEACANIRDFVALRLGRSLLKVQGTLKTSTSEHGGHVDHSRLPVNHLNTS 420

Query: 421 LI 422
           LI
Sbjct: 421 LI 422

>KLLA0F12914g complement(1190220..1191512) similar to sgd|S0003925
           Saccharomyces cerevisiae YLL002w REM50 drug resistance,
           start by similarity
          Length = 430

 Score =  371 bits (952), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 190/401 (47%), Positives = 257/401 (64%), Gaps = 13/401 (3%)

Query: 5   SLEVLLRDVLPQDVEVEVAHLQSPPRETYPVVLPHSQA---NGKQ-QVVKIQHFFGLCTD 60
           SLE  ++D LP   E E+ +LQS PRET P+  P  +A   NGK  + +K QHF  LC +
Sbjct: 2   SLECYIKDALPFGHEFEIINLQSIPRETSPITFPKREAEDVNGKTVKTIKTQHFVALCFE 61

Query: 61  NKLFYGLEVFVYVVVQHSK--VVDKILFISKADTNGYCARRLSIKNITKALIEYVTSLDP 118
            K+ + LE+ VY  +  +    V+++LF+SKADTNGYC  RL I  ITK++I Y+ ++ P
Sbjct: 62  EKVVFALEIVVYFSLNSANNGPVERLLFVSKADTNGYCDLRLDIGQITKSIIAYILAISP 121

Query: 119 LYYLVKVIPMNRTRQNYANAITKSTTTKRALQIIRNR--HTAGKTS---TPDISNLYTQF 173
            +YL  V P+ R   + A  I +ST+ +RAL+I+ NR   + G TS    PD  +LY  F
Sbjct: 122 GHYLRAVKPLIRKALSGAKIIKRSTSVQRALEILSNRPLDSKGITSRVKIPD-QDLYVSF 180

Query: 174 EKCDPGWTCKICLFTRSEPHYLFSESSKNPEKHILSGEQLLHWWLSVVDAVLFKNFTSDT 233
                    K+ LFTR+EP YLFS SSKNP KH+LSG++LL WWL +VD ++ ++F + T
Sbjct: 181 P-VPTEIVTKVSLFTRAEPQYLFSNSSKNPRKHVLSGDKLLKWWLKIVDQIVVEDFDNKT 239

Query: 234 KARLQIPGEEKLCTEKYLNGKKFPQWRVGDIFNSEPNDLAIFKIPVFPDDPKGRFLEQLV 293
           KA LQIPGEEK     YL    +  W VGDIF+  P D+A+++IP+FPDDPKGRFL+ L+
Sbjct: 240 KATLQIPGEEKRVISNYLRNTAYQNWTVGDIFSESPQDIALYRIPLFPDDPKGRFLDHLI 299

Query: 294 DENRAKKVQVTGFWTELQIQQEFRMGATVAVIGIDGRVANPCIMPRECEIILPKSIKAFN 353
            + R  KV V  FWTELQ +QEFR+G+TV+VIG+ G+    C  P   +II+P S K F 
Sbjct: 300 SDGRISKVNVLTFWTELQARQEFRLGSTVSVIGVSGKYIGRCNEPERTDIIIPTSKKNFK 359

Query: 354 MIKTYITGEEYDTIDGAYEACANIRDFVALRLGRSLLKVQG 394
            +K YITGEEYDT +GA EA  NIRD   +     ++KV G
Sbjct: 360 NLKNYITGEEYDTEEGAEEAYMNIRDIFDMHYSTKMIKVIG 400

>YLL002W (RTT109) [3417] chr12 (146290..147600) Protein involved in
           resistance to mutagens such as diepoxybutane and
           mitomycin C [1311 bp, 436 aa]
          Length = 436

 Score =  350 bits (898), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 180/400 (45%), Positives = 254/400 (63%), Gaps = 11/400 (2%)

Query: 5   SLEVLLRDVLPQDVEVEVAHLQSPPRETYPVVLPHSQANG-KQQVVKIQHFFGLCTDNKL 63
           SL   L  VLP   + E   LQS P ET+ VV P+       +  +K QHFF L    K+
Sbjct: 2   SLNDFLSSVLPVSEQFEYLSLQSIPLETHAVVTPNKDDKRVPKSTIKTQHFFSLFHQGKV 61

Query: 64  FYGLEVFVYVVVQHSKVVDKILFISKADTNGYCARRLSIKNITKALIEYVTSLDPLYYLV 123
           F+ LEV+VYV +      ++++F+SKADTNGYC  R+S+++ITK ++E++ S+DP YYL 
Sbjct: 62  FFSLEVYVYVTLWDEADAERLIFVSKADTNGYCNTRVSVRDITKIILEFILSIDPNYYLQ 121

Query: 124 KVIPMNRTRQNYA-NAITKSTTTKRALQIIRNR-HTAGKTSTPDIS------NLYTQFEK 175
           KV P  R+ +  +   I+ ++T  R L+I+  R   +G T   +I       +LY  F  
Sbjct: 122 KVKPAIRSYKKISPELISAASTPARTLRILARRLKQSGSTVLKEIESPRFQQDLYLSF-T 180

Query: 176 CDPGWTCKICLFTRSEPHYLFSESSKNPEKHILSGEQLLHWWLSVVDAVLFKNFTSDTKA 235
           C      KICLFTR    YLF +SSKN +KHIL+GE+L+ WW  ++D +L + F +DT+A
Sbjct: 181 CPREILTKICLFTRPASQYLFPDSSKNSKKHILNGEELMKWWGFILDRLLIECFQNDTQA 240

Query: 236 RLQIPGEEKLCTEKYLNGKKFPQWRVGDIFNSEPNDLAIFKIPVFPDDPKGRFLEQLVDE 295
           +L+IPGE+      YL G K+P W+VGDIF S+ N LA++ IP+FPDDPK RF+ QL +E
Sbjct: 241 KLRIPGEDPARVRSYLRGMKYPLWQVGDIFTSKENSLAVYNIPLFPDDPKARFIHQLAEE 300

Query: 296 NRAKKVQVTGFWTELQIQQEFRMGATVAVIGIDG-RVANPCIMPRECEIILPKSIKAFNM 354
           +R  KV ++ FW ELQ +QEF++  T +V+GI G  +A P + P   ++I+PKS K F  
Sbjct: 301 DRLLKVSLSSFWIELQERQEFKLSVTSSVMGISGYSLATPSLFPSSADVIVPKSRKQFRA 360

Query: 355 IKTYITGEEYDTIDGAYEACANIRDFVALRLGRSLLKVQG 394
           IK YITGEEYDT +GA EA  NIRDF+ LR+  +L  + G
Sbjct: 361 IKKYITGEEYDTEEGAIEAFTNIRDFLLLRMATNLQSLTG 400

>CAGL0D05786g 550165..551436 similar to tr|Q07794 Saccharomyces
           cerevisiae YLL002w REM50 drug resistance, start by
           similarity
          Length = 423

 Score =  320 bits (820), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 179/422 (42%), Positives = 253/422 (59%), Gaps = 21/422 (4%)

Query: 6   LEVLLRDVLPQDVEVEVAHLQSPPRETYPVVLPHSQANGKQQVVKIQHFFGLCTDNKLFY 65
           L+ +L++VLPQD   E+ HLQSPP E+ P+V   S+ N +   +K +H F L    ++FY
Sbjct: 2   LQAILKEVLPQDSSFEILHLQSPPSESAPLVNNTSKQN-RATTIKTEHLFCLAYKGRIFY 60

Query: 66  GLEVFVYVVVQHSKVVDK---ILFISKADTNGYCARRLSIKNITKALIEYVTSLDPLYYL 122
           GLE++VY+   H   V+K   ++F+SKADTNGYC  R++IK +T  LI YV S++P YYL
Sbjct: 61  GLELYVYITCNHDNEVEKTERLVFVSKADTNGYCDIRVNIKLVTLQLIRYVLSINPDYYL 120

Query: 123 VKVIPMNR--TRQNYANAITKSTTTKRALQIIRNRHTAGKTSTPDISN-LYTQFEKCDPG 179
            +VIP  R   +    N ITK+T +++AL+I+ +R        P+I N  YT+F      
Sbjct: 121 HRVIPKERDYKKSGRTNLITKATNSRKALKILADRLQNHNLIEPEIFNAFYTKFHSGKEL 180

Query: 180 WTCKICLFTRSEPHYLFSESSKNPEKHILSGEQLLHWWLSVVDAVLFKNFT-SDTKARLQ 238
            T KI LFTR    YLF  SSKNP KH L G+ LL WW S++D +L  +F  + TKA+++
Sbjct: 181 VT-KIALFTRPADQYLFPNSSKNPNKHNLDGDGLLKWWASLLDNLLVSDFNLNKTKAKIR 239

Query: 239 IPGEEKLCTEKYLNGKKFPQWRVGDIFNSEPNDLAIFKIPVFPDDPKGRFLEQLVDENRA 298
           IPGE+K    +Y N  K   W  GDIF+   +D  I  IP+FPDDPK RF++QL +ENR 
Sbjct: 240 IPGEDKYRFRRYTNALKCGIWTHGDIFSDNDSDSVIKCIPMFPDDPKSRFMKQLFEENRI 299

Query: 299 KKVQVTGFWTELQIQQEFRMGATVAVIGIDGRVANPCIMPRECEIILPKSIKAFNMIKTY 358
           +   +  FWTELQ +QEF++   V+V+GI G            ++   +S + F+ IK Y
Sbjct: 300 QTTSLDTFWTELQERQEFKLSVVVSVMGISGIYEIDTNYKPSTDVYRCRSKRQFHCIKNY 359

Query: 359 ITGEEYDTIDGAYEACANIRDFVALRLGRSLLKVQGTLKTSTSEHGGHVDHSRLPVNHLN 418
           ITGEEYDT +GA E+  N+ D+++ R G SLL V            G+ D+S+   N   
Sbjct: 360 ITGEEYDTEEGALESYQNVNDYLS-REGTSLLTVT-----------GNADYSKFKQNRTT 407

Query: 419 TS 420
           TS
Sbjct: 408 TS 409

>Scas_629.20
          Length = 440

 Score =  313 bits (803), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 162/400 (40%), Positives = 242/400 (60%), Gaps = 10/400 (2%)

Query: 5   SLEVLLRDVLPQDVEVEVAHLQSPPRETYPVV--LPHSQANGKQQVVKIQHFFGLCTDNK 62
           +L+ LL  VLP+  + E+ HLQ  P +T+ +V  +P +Q       VKIQHFF L  + K
Sbjct: 8   TLDELLASVLPRGHDFELLHLQDEPAQTHDIVTPMPTTQERADTLTVKIQHFFTLFHNKK 67

Query: 63  LFYGLEVFVYVVVQHSKVVDKILFISKADTNGYCARRLSIKNITKALIEYVTSLDPLYYL 122
             + LE++VY+ +  S    K++F+SKADT+GYC  +L + +ITK  ++Y+ S+DPL+YL
Sbjct: 68  AVFALEIYVYLTLS-SLHNTKLIFVSKADTSGYCDIKLRMGDITKVFLQYLISVDPLHYL 126

Query: 123 VKVIPMNRTRQNYANAITKSTTTKRALQIIRNRHTAGKTSTPDISNLYTQFEKC--DPGW 180
            KV P+ R   +  + I K T+ +R+L+I+  R         +    Y        D  W
Sbjct: 127 RKVKPLRRVNDHDESLIRKGTSVERSLRILAVRVDLSPHPCQNTDKFYITRNDVGGDTNW 186

Query: 181 TCKICLFTRSEPHYLFSESSKNPEKHILSGEQLLHWWLSVVDAVLFKNFT-SDTKARLQI 239
             KICLFTR    YLF  SSKN +KH L+G+QLL WW+ ++D ++  +F  ++  ARL++
Sbjct: 187 VTKICLFTRPADDYLFIGSSKNAKKHKLNGDQLLKWWMKIIDGLVCTDFDPNNVSARLRV 246

Query: 240 PGEEK-LCTEKYLNGK--KFPQWRVGDIFNSEPNDLAIFKIPVFPDDPKGRFLEQLVDEN 296
           PGE+    +  YLNG   +   W+VGDIF    NDLA+F +P+FPDDPK RF+  LV EN
Sbjct: 247 PGEDTGRVSRTYLNGDLTQSNNWQVGDIFGGTGNDLAVFHVPLFPDDPKSRFIRHLVQEN 306

Query: 297 RAKKVQVTGFWTELQIQQEFRMGATVAVIGIDGRVAN-PCIMPRECEIILPKSIKAFNMI 355
           R  K  +  +W ELQ +QEF++   V+VIG++G     P  +P + EI +  S + F  I
Sbjct: 307 RIMKTNLKTYWMELQERQEFKLSVIVSVIGVEGHTKKIPDYLPNDREIFICSSRRQFRYI 366

Query: 356 KTYITGEEYDTIDGAYEACANIRDFVALRLGRSLLKVQGT 395
           ++Y+ GEEYD  +G  E+  N+RD++ LR  + LLK+ GT
Sbjct: 367 RSYVAGEEYDNEEGTLESYVNVRDYLELRYSKKLLKLSGT 406

>AAL173C [14] [Homologous to ScYLL002W (REM50) - SH] (38265..39527)
           [1263 bp, 420 aa]
          Length = 420

 Score =  301 bits (772), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 168/421 (39%), Positives = 242/421 (57%), Gaps = 11/421 (2%)

Query: 5   SLEVLLRDVLPQDVEVEVAHLQSPPRETYPVVLPHSQANG-KQQVVKIQHFFGLCTDNKL 63
            L+ LL + LP   + +V HLQSP  E  P+    ++A+G     +  QHFF L  ++K+
Sbjct: 2   GLKELLAEALPAGHDFDVLHLQSPATERPPL----TEASGCSPTTIAAQHFFTLSNNSKV 57

Query: 64  FYGLEVFVYVVVQHSKVVDKILFISKADTNGYCARRLSIKNITKALIEYVTSLDPLYYLV 123
           FY L+V VY+ ++ +   D++LF+SKADTNGYC  R+ ++  T+AL++++ S+DP +YL 
Sbjct: 58  FYALQVVVYICIEGTSG-DRMLFVSKADTNGYCDVRVDVRRATRALLQFLLSIDPSHYLQ 116

Query: 124 KVIPMNRTRQNYANAITKSTTTKRALQIIRNRHTAGKTSTPDISNL--YTQFEKCDPGWT 181
           +V  M          IT +T    AL+I+  R+  G       ++   YT F  C P +T
Sbjct: 117 RVRRMRIDPAACKGLITPATNAVDALRILAQRYRTGNLDVRAAADRARYTSF-PCPPQYT 175

Query: 182 CKICLFTRSEPHYLFSESSKNPEKHILSGEQLLHWWLSVVDAVLFKNFTSDTKARLQIPG 241
            ++ LFTR+EPHYLFSES++NP KH+L G++LL WWL+ VD +L   F   T A L IPG
Sbjct: 176 TRLALFTRAEPHYLFSESAQNPAKHVLPGDRLLRWWLASVDDLLVTLFDPATDAALLIPG 235

Query: 242 EEKLCTEKYLNGKKFPQWRVGDIFNSEPNDLAIFKIPVFPDDPKGRFLEQLVDENRAKKV 301
           E+   T  YL   +FP+WRVG +F     D A+ +IP FPDDPKGRFL+ L  E R   +
Sbjct: 236 EDSAVTAHYLRPVRFPRWRVGHVFGGSAEDPALTRIPRFPDDPKGRFLDDLAHEGRNPSL 295

Query: 302 QVTGFWTELQIQQEFRMGATVAVIGIDGRVANPCIMPRECEIILPKSIKAFNMIKTYITG 361
           +   FWTEL  +QEFR+G  V V+G  G    PC  P   +++ P S   +  +K Y+T 
Sbjct: 296 R--AFWTELVARQEFRLGVVVGVVGAAGLYTGPCARPAPEDLLCPASPADYVHVKHYVTA 353

Query: 362 EEYDTIDGAYEACANIRDFVALRLGRSLLKVQGTLKTSTSEHGGHVDHSRLPVNHLNTSL 421
           EEY T  GA EA  N+ D + LR G ++ +V+G   T+           R  VN L    
Sbjct: 354 EEYATAAGASEAHRNLVDCLLLRYGVAMPRVRGAHSTTPRPAPTQDATKRPAVNDLTARC 413

Query: 422 I 422
           +
Sbjct: 414 V 414

>YNR011C (PRP2) [4594] chr14 complement(644319..646949) Pre-mRNA
           splicing factor and RNA-dependent ATPase of DEAH box
           family, required for first catalytic event of pre-mRNA
           splicing [2631 bp, 876 aa]
          Length = 876

 Score = 30.0 bits (66), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 20/26 (76%)

Query: 188 TRSEPHYLFSESSKNPEKHILSGEQL 213
           +R +P+ +FS +++ PEK+ L GEQL
Sbjct: 54  SRYDPNKVFSNTNQGPEKNNLKGEQL 79

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.136    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,733,064
Number of extensions: 588300
Number of successful extensions: 1350
Number of sequences better than 10.0: 13
Number of HSP's gapped: 1344
Number of HSP's successfully gapped: 13
Length of query: 422
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 318
Effective length of database: 12,995,837
Effective search space: 4132676166
Effective search space used: 4132676166
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)