Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_33.1462971970929410.0
KLLA0E23056g8182307086e-82
Scas_697.176942305931e-66
YHR131C8402425861e-64
YNL144C7402355539e-61
AFR049W7172485151e-55
CAGL0G06182g6812254902e-52
Scas_654.225802454262e-44
CAGL0J05830g6072422711e-24
KLLA0A08206g230190910.004
Scas_681.2952834712.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.14629
         (709 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.14629                                                        1137   0.0  
KLLA0E23056g complement(2044323..2046779) weakly similar to sp|P...   277   6e-82
Scas_697.17                                                           233   1e-66
YHR131C (YHR131C) [2417] chr8 complement(365342..367864) Protein...   230   1e-64
YNL144C (YNL144C) [4452] chr14 complement(352820..355042) Protei...   217   9e-61
AFR049W [3241] [Homologous to ScYNL144C - SH; ScYHR131C - SH] co...   202   1e-55
CAGL0G06182g 589050..591095 similar to sp|P38835 Saccharomyces c...   193   2e-52
Scas_654.22                                                           168   2e-44
CAGL0J05830g complement(552107..553930) some similarities with s...   108   1e-24
KLLA0A08206g 730940..731632 no similarity, hypothetical start          40   0.004
Scas_681.29                                                            32   2.0  

>Kwal_33.14629
          Length = 719

 Score = 1137 bits (2941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/709 (79%), Positives = 567/709 (79%)

Query: 1   MSAVVQLRKSKYNKHNDINKXXXXXXXXXXXXXXXXXLGADTGEKAQKYPPAKMLPRSES 60
           MSAVVQLRKSKYNKHNDINK                 LGADTGEKAQKYPPAKMLPRSES
Sbjct: 1   MSAVVQLRKSKYNKHNDINKTKSACSSTSLSSTEGNSLGADTGEKAQKYPPAKMLPRSES 60

Query: 61  GKLSKESKMHQEDLFSWIDPLPAKPPSYKSSDPSRRVTFPVYETLDDGSLPGYSPAVEAI 120
           GKLSKESKMHQEDLFSWIDPLPAKPPSYKSSDPSRRVTFPVYETLDDGSLPGYSPAVEAI
Sbjct: 61  GKLSKESKMHQEDLFSWIDPLPAKPPSYKSSDPSRRVTFPVYETLDDGSLPGYSPAVEAI 120

Query: 121 TVVSMKLEWLDPYTCSPSRSWKNFVMEINSTQLNFYLIDPALTRGIKNYCNGKSHFGGEH 180
           TVVSMKLEWLDPYTCSPSRSWKNFVMEINSTQLNFYLIDPALTRGIKNYCNGKSHFGGEH
Sbjct: 121 TVVSMKLEWLDPYTCSPSRSWKNFVMEINSTQLNFYLIDPALTRGIKNYCNGKSHFGGEH 180

Query: 181 LDPSLEYEXXXXXXXXXXXKNTYQFNKADQECXXXXXXXXXXXYLTDNKLFRSYSLQFAK 240
           LDPSLEYE           KNTYQFNKADQEC           YLTDNKLFRSYSLQFAK
Sbjct: 181 LDPSLEYESHHSIFSSLSSKNTYQFNKADQECISKKISNNKSKYLTDNKLFRSYSLQFAK 240

Query: 241 YGIPTDYNRKTFVLRVRCETEQFMLSFSHVDDMIMWNMYLSIGIGVSLDLDFRELPTYRT 300
           YGIPTDYNRKTFVLRVRCETEQFMLSFSHVDDMIMWNMYLSIGIGVSLDLDFRELPTYRT
Sbjct: 241 YGIPTDYNRKTFVLRVRCETEQFMLSFSHVDDMIMWNMYLSIGIGVSLDLDFRELPTYRT 300

Query: 301 VPXXXXXXXXXXNNGLMVSGDSQNRTLXXXXXXXXXXXXXXNLELNLTQRKRPGXXXXXX 360
           VP          NNGLMVSGDSQNRTL              NLELNLTQRKRPG      
Sbjct: 301 VPRRRRRRRRKRNNGLMVSGDSQNRTLAGRRRSSGASGSRSNLELNLTQRKRPGSLGSTD 360

Query: 361 XXXXXXXXXXXXXXIKSKLKSFFGSENKVFTPTYRGSHTRTLSVAALNSVTEDDEEDHSA 420
                         IKSKLKSFFGSENKVFTPTYRGSHTRTLSVAALNSVTEDDEEDHSA
Sbjct: 361 SSSATSSRRGSNDSIKSKLKSFFGSENKVFTPTYRGSHTRTLSVAALNSVTEDDEEDHSA 420

Query: 421 VASGSNTPNGAVAAIRPSLEQRSKSMGPLESSPAADDYFGFIHGARPSMGIAATTPGSPC 480
           VASGSNTPNGAVAAIRPSLEQRSKSMGPLESSPAADDYFGFIHGARPSMGIAATTPGSPC
Sbjct: 421 VASGSNTPNGAVAAIRPSLEQRSKSMGPLESSPAADDYFGFIHGARPSMGIAATTPGSPC 480

Query: 481 SEVSVGGATINSNDLQVQTGFHSNTGLQNDLNELQQVIYXXXXXXXXXXXXXXXXXXXXX 540
           SEVSVGGATINSNDLQVQTGFHSNTGLQNDLNELQQVIY                     
Sbjct: 481 SEVSVGGATINSNDLQVQTGFHSNTGLQNDLNELQQVIYEHNEGVEEETEESPVSENNDN 540

Query: 541 XXXXXXXXXXXXXIDSVHPNSTTQATSIYQEEGIFHDSEDDYYYVVDRNDAFRRRASSVT 600
                        IDSVHPNSTTQATSIYQEEGIFHDSEDDYYYVVDRNDAFRRRASSVT
Sbjct: 541 DDDDDDDADDADDIDSVHPNSTTQATSIYQEEGIFHDSEDDYYYVVDRNDAFRRRASSVT 600

Query: 601 SNLSSTPYGSGDVKWHPPRKEMSRRRYIRDSLRCIKPLPDNEEWLGKVLIRPVSAPDYDT 660
           SNLSSTPYGSGDVKWHPPRKEMSRRRYIRDSLRCIKPLPDNEEWLGKVLIRPVSAPDYDT
Sbjct: 601 SNLSSTPYGSGDVKWHPPRKEMSRRRYIRDSLRCIKPLPDNEEWLGKVLIRPVSAPDYDT 660

Query: 661 NNPPIXXXXXXXXXXXXXXXXXXXXXXXXXGVILQKCKNHYAKPYIVGP 709
           NNPPI                         GVILQKCKNHYAKPYIVGP
Sbjct: 661 NNPPISGFVGGTGKSGKSKASPNKSSKSDKGVILQKCKNHYAKPYIVGP 709

>KLLA0E23056g complement(2044323..2046779) weakly similar to
           sp|P38835 Saccharomyces cerevisiae YHR131c, start by
           similarity
          Length = 818

 Score =  277 bits (708), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 129/230 (56%), Positives = 171/230 (74%), Gaps = 4/230 (1%)

Query: 73  DLFSWIDPLPAKPPSYKSSDPSRRVTFPVYETLDDGSLPGYSPAVEAITVVSMKLEWLDP 132
           + F W+D  P +PPSYKS + +RR+T+P+YETLDD  LPGYSPAV+AITV+S+K EWL+P
Sbjct: 124 EYFQWVDNAPRRPPSYKSVNSNRRITYPIYETLDDNVLPGYSPAVKAITVISLKQEWLNP 183

Query: 133 YTCSPSRSWKNFVMEINSTQLNFYLIDPALTRGIKNYCNGKSHFGGEHLDPSLEYEXXXX 192
           Y  S SR+WKNF+MEINSTQLNFY I  +LT  IKNY  G ++F  + L+ S   +    
Sbjct: 184 YELSSSRAWKNFIMEINSTQLNFYHIHESLTSNIKNYYGGPTNFPND-LNSS---KQSTR 239

Query: 193 XXXXXXXKNTYQFNKADQECXXXXXXXXXXXYLTDNKLFRSYSLQFAKYGIPTDYNRKTF 252
                  K+TYQFN++DQ+            YL+++ LF+S+SLQ+ K+GIPTDY +KTF
Sbjct: 240 FLPSLHSKSTYQFNRSDQQWITKMIQSNEKKYLSNDMLFKSFSLQYGKFGIPTDYTKKTF 299

Query: 253 VLRVRCETEQFMLSFSHVDDMIMWNMYLSIGIGVSLDLDFRELPTYRTVP 302
           VLR+RCE +QF+++F+HVDDMI W++ LSIGI VSLDL +RE+PTYRTVP
Sbjct: 300 VLRLRCELQQFLINFAHVDDMIDWSVSLSIGIDVSLDLAYREMPTYRTVP 349

 Score =  162 bits (411), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 86/220 (39%), Positives = 115/220 (52%), Gaps = 5/220 (2%)

Query: 493 NDLQVQTGFHSNTGLQNDLNELQQVIYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 552
           NDL  QTG+ +    + +LNELQ ++                                  
Sbjct: 591 NDLSAQTGYQNAICSRLELNELQTILNEHNEEDSEEQDQDQEEEEEEEEEEEDEDDGTET 650

Query: 553 XIDSVH---PNSTTQATSIYQEEGIFHDSEDDYYYVVDRNDAFRRRASSVTSNLSSTPYG 609
              S      ++ + A+SIY EEGIFHDS+DDY YV    +  RRR SS+TSNLS+TPYG
Sbjct: 651 AASSNELPTRHARSAASSIYHEEGIFHDSDDDYIYVP--TEIHRRRTSSITSNLSNTPYG 708

Query: 610 SGDVKWHPPRKEMSRRRYIRDSLRCIKPLPDNEEWLGKVLIRPVSAPDYDTNNPPIXXXX 669
             ++KW+PPRKE++RRRYIRDSLRCIKPL  +E W+ K+ + P   P Y+TNNPP+    
Sbjct: 709 GDEMKWNPPRKEITRRRYIRDSLRCIKPLGFDESWVNKIALAPSMGPKYETNNPPVSGFI 768

Query: 670 XXXXXXXXXXXXXXXXXXXXXGVILQKCKNHYAKPYIVGP 709
                                 ++L +CKNHY  PYI+ P
Sbjct: 769 SNSDLSSKNKFSLKKLYNTQPALLLSRCKNHYLTPYIITP 808

>Scas_697.17
          Length = 694

 Score =  233 bits (593), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 112/230 (48%), Positives = 149/230 (64%), Gaps = 14/230 (6%)

Query: 73  DLFSWIDPLPAKPPSYKSSDPSRRVTFPVYETLDDGSL----PGYSPAVEAITVVSMKLE 128
           +    ID  P  PP+Y   +P++R+ FP++E      +    P Y PAVE +T+VSMKLE
Sbjct: 87  EFLQCIDHKPVSPPNYNEMNPNKRINFPIWEHTAPCPINELPPSYKPAVEELTIVSMKLE 146

Query: 129 WLDPYTCSPSRSWKNFVMEINSTQLNFYLIDPALTRGIKNYCNGKSHFGGEHLDPSLEYE 188
           WL PY  SP R+WKN +MEINSTQLNFY ID +LT  I+NY N  S         +  + 
Sbjct: 147 WLSPYDVSPLRTWKNLIMEINSTQLNFYHIDESLTSHIRNYSNDSSSSSPSKQRSTFSF- 205

Query: 189 XXXXXXXXXXXKNTYQFNKADQECXXXXXXXXXXXYLTDNKLFRSYSLQFAKYGIPTDYN 248
                      + TY+FNK DQE            YL+++KL++SYSLQFAK+G+P DY 
Sbjct: 206 ---------GNRTTYEFNKNDQEQIAFRIKRNKKLYLSNDKLYKSYSLQFAKFGLPIDYK 256

Query: 249 RKTFVLRVRCETEQFMLSFSHVDDMIMWNMYLSIGIGVSLDLDFRELPTY 298
           +KT+VLR+RCE+EQF+L+F+HVDDMIMW MYL++GI V+LDL+ R LP Y
Sbjct: 257 KKTYVLRLRCESEQFLLNFAHVDDMIMWTMYLNMGISVALDLELRALPDY 306

 Score =  114 bits (284), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 58/149 (38%), Positives = 81/149 (54%), Gaps = 10/149 (6%)

Query: 567 SIYQEEGIFHDSE-DDYYY-----VVDRNDAFRRRASSVTSNLSSTPYGSGDVKWHPPRK 620
           S+Y EEGIFH +E D+Y Y     +   + ++RRR SS+ S +SS PY S ++KW PP K
Sbjct: 527 SVYDEEGIFHYNETDEYEYSYAQSITTNSTSYRRRTSSLISTMSSVPYSSDEIKWTPPLK 586

Query: 621 EMSRRRYIRDSLRCIKPLPDNEEWLGKVLIRPVSAPDYDTNNPPIXXXXXXXXXXXXXXX 680
              RR+YIR+SLRCI P  +   W+  ++++P + P + TNN PI               
Sbjct: 587 ITPRRKYIRNSLRCIVPFIEETNWIDNIVVKPTAGPKFKTNNSPI----AGSLDSTCTSY 642

Query: 681 XXXXXXXXXXGVILQKCKNHYAKPYIVGP 709
                     G  L + KNHY K Y+VGP
Sbjct: 643 RKKLLAGCTSGSDLNRVKNHYLKAYVVGP 671

>YHR131C (YHR131C) [2417] chr8 complement(365342..367864) Protein
           containing a pleckstrin homology (PH) domain, which
           mediate protein-protein and protein-lipid interactions,
           has low similarity to uncharacterized S. cerevisiae
           Ynl144p [2523 bp, 840 aa]
          Length = 840

 Score =  230 bits (586), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 118/242 (48%), Positives = 160/242 (66%), Gaps = 10/242 (4%)

Query: 71  QEDLFSWIDPLPAKPPSYKSSDPSRRVTFPVY---ETLDDGSLPG-YSPAVEAITVVSMK 126
           ++DL+  IDPLPA PPSY   +P++ V FP++         SLP  Y+PAV  +T++S+K
Sbjct: 70  KQDLYEHIDPLPAYPPSYDLVNPNKEVRFPIFGDTAPCPKSSLPPLYAPAVYELTLISLK 129

Query: 127 LEWLDPYTCSPSRSWKNFVMEINSTQLNFYLIDPALTRGIKNYCNGKSHFGGE---HLD- 182
           LE L PY  S +RSW+NF++EINSTQLNFY ID +LT+ I+NY +G++    E   H D 
Sbjct: 130 LERLSPYEISSNRSWRNFIIEINSTQLNFYHIDESLTKHIRNYSSGETKSEKEDRIHSDL 189

Query: 183 --PSLEYEXXXXXXXXXXXKNTYQFNKADQECXXXXXXXXXXXYLTDNKLFRSYSLQFAK 240
              S + +           ++  +F KADQE            YLTD  L++S++LQ A+
Sbjct: 190 VHRSDQSQHLHHRLFTLPTRSASEFKKADQERISYRVKRDRSRYLTDEALYKSFTLQNAR 249

Query: 241 YGIPTDYNRKTFVLRVRCETEQFMLSFSHVDDMIMWNMYLSIGIGVSLDLDFRELPTYRT 300
           +GIPTDY +K+FVLR+ CE+EQF+L FSH+DDMI W+MYLSIGI VSLDL+ RE P YR 
Sbjct: 250 FGIPTDYTKKSFVLRMSCESEQFLLRFSHIDDMIDWSMYLSIGISVSLDLEVREYPDYRI 309

Query: 301 VP 302
           VP
Sbjct: 310 VP 311

 Score = 95.5 bits (236), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 57/137 (41%), Positives = 75/137 (54%), Gaps = 22/137 (16%)

Query: 573 GIFHDSEDDYYYVVDRNDAFRRRASSVTSNLSSTPYGSGDVKWHPPRKEMSRRRYIRDSL 632
           G  + SE DY  +++     RRRASS  S  S+ PYG+ D+KW P  KE+SRRRY+RDSL
Sbjct: 652 GYAYGSESDYSCLIEERIRNRRRASSTLSCFSNIPYGTDDIKWKPAIKEISRRRYLRDSL 711

Query: 633 RCIKPLPDNEEWLGKVLIRPVSAPDYDTNNPPIXXXXXXXXXXXXXXXXXXXXXXXXXGV 692
           +CIKP  D+ + LGKV+  PVS P ++T+N                              
Sbjct: 712 KCIKPFLDSNDCLGKVIYIPVSGPTFETSNKIHFSNRQS--------------------- 750

Query: 693 ILQKCKNHYAKPYIVGP 709
            LQK KNH+ K +IVGP
Sbjct: 751 -LQKQKNHFLKGFIVGP 766

>YNL144C (YNL144C) [4452] chr14 complement(352820..355042) Protein
           of unknown function, has low similarity to
           uncharacterized S. cerevisiae Yhr131p [2223 bp, 740 aa]
          Length = 740

 Score =  217 bits (553), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 107/235 (45%), Positives = 150/235 (63%), Gaps = 5/235 (2%)

Query: 72  EDLFSWIDPLPAKPPSYKSSDPSRRVTFPVYE----TLDDGSLPGYSPAVEAITVVSMKL 127
           +++   IDP P +PP Y  ++PS+ + +P+YE     L     P Y+P+VE  TVVSMK+
Sbjct: 86  KNVLYCIDPYPVEPPCYDFANPSKVIRYPIYEHCRPCLTSVKPPSYTPSVEHYTVVSMKM 145

Query: 128 EWLDPYTCSPSRSWKNFVMEINSTQLNFYLIDPALTRGIKNYCNGKSHFGGEHLD-PSLE 186
           E L P+  + SR W NF+++INSTQ+NFY ID +LTR IKNY  G       H    S  
Sbjct: 146 EKLSPFENASSRLWNNFILQINSTQINFYSIDDSLTRHIKNYRGGDMFDHSHHSKTASDR 205

Query: 187 YEXXXXXXXXXXXKNTYQFNKADQECXXXXXXXXXXXYLTDNKLFRSYSLQFAKYGIPTD 246
           +            K+TYQF+K D+E            +L+D +LF+SYSLQ AK G+P D
Sbjct: 206 HHSARSLLNAFTTKSTYQFDKYDKERICGEIARDEHKFLSDERLFKSYSLQCAKVGLPID 265

Query: 247 YNRKTFVLRVRCETEQFMLSFSHVDDMIMWNMYLSIGIGVSLDLDFRELPTYRTV 301
           Y+ + FVLR+RCE +QF++ FSHVD++I W MYL++GI +SLDL+ RE+PTYR+V
Sbjct: 266 YSSRDFVLRMRCEGQQFLVQFSHVDELIYWAMYLNMGISLSLDLELREMPTYRSV 320

 Score = 85.1 bits (209), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 53/100 (53%), Gaps = 18/100 (18%)

Query: 609 GSGDVKWHPPRKEMSRRRYIRDSLRCIKPLPDNEEWLGKVLIRPVSAPDYDTNNPPIXXX 668
            S D KW P  + +SR+RYI+DSLRCIKPL ++  W+GK++ +P   P ++TNNPPI   
Sbjct: 635 SSNDSKWAPATQLVSRKRYIKDSLRCIKPLTEDHPWVGKIIFKPALPPAFETNNPPIRVY 694

Query: 669 XXXXXXXXXXXXXXXXXXXXXXGVILQKCKNHYAKPYIVG 708
                                    L   KNHY KPYIVG
Sbjct: 695 SGEDSTD------------------LMHVKNHYLKPYIVG 716

>AFR049W [3241] [Homologous to ScYNL144C - SH; ScYHR131C - SH]
           complement(517312..519465) [2154 bp, 717 aa]
          Length = 717

 Score =  202 bits (515), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 98/248 (39%), Positives = 147/248 (59%), Gaps = 11/248 (4%)

Query: 55  LPRS---ESGKLSKESKMHQEDLFSWIDPLPAKPPSYKSSDPSRRVTFPVYETLDDGSLP 111
           LP+S   ESG+L         D+ + + P PA+PP Y + +P+RR+ +P+YE  +   LP
Sbjct: 48  LPQSGEVESGEL-------HADVLAVLQPQPARPPPYYAVNPNRRIRYPIYEREETNELP 100

Query: 112 GYSPAVEAITVVSMKLEWLDPYTCSPSRSWKNFVMEINSTQLNFYLIDPALTRGIKNYCN 171
            Y+PAV  + +VS+K EW  PY  + SRSW+  +ME+NSTQLNFY +D  L RG++    
Sbjct: 101 AYAPAVHELALVSVKQEWASPYEPAVSRSWRTLLMELNSTQLNFYHVDEGLLRGLRGRAA 160

Query: 172 GKS-HFGGEHLDPSLEYEXXXXXXXXXXXKNTYQFNKADQECXXXXXXXXXXXYLTDNKL 230
             +          SL +            ++  Q + A Q+            +L   +L
Sbjct: 161 DSTLGVACAQAVSSLSFGQVKAGTLLALGRDERQLSPAHQQHVCARAQRDPERHLCAERL 220

Query: 231 FRSYSLQFAKYGIPTDYNRKTFVLRVRCETEQFMLSFSHVDDMIMWNMYLSIGIGVSLDL 290
           ++SYSLQ+A +G+P DY +++FVLR+RCETEQF++ F  VD +I W++ LS+GIGVSLDL
Sbjct: 221 YKSYSLQYATFGVPMDYTKRSFVLRLRCETEQFLVCFGTVDMLISWSVSLSVGIGVSLDL 280

Query: 291 DFRELPTY 298
           D R++P Y
Sbjct: 281 DHRKMPAY 288

 Score = 76.6 bits (187), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 60/112 (53%), Gaps = 27/112 (24%)

Query: 566 TSIYQEEGIFH-----------------------DSEDDYYYVVDR--NDAFRRRASSVT 600
           TSIY++EGI+H                       D+    Y    R  +  FR+RA S  
Sbjct: 540 TSIYEDEGIYHSDDDDDDDDDDDDDDDGAGSAAADTATQDYAARSRALDMEFRQRAHSAA 599

Query: 601 SNLSSTPYGSG--DVKWHPPRKEMSRRRYIRDSLRCIKPLPDNEEWLGKVLI 650
           S+LS  PYG      KW PP KE +RRR++RDS+RCI+PL D++ WLG +++
Sbjct: 600 SSLSFAPYGYSFSREKWVPPVKESTRRRFVRDSIRCIRPLCDDDTWLGALVV 651

>CAGL0G06182g 589050..591095 similar to sp|P38835 Saccharomyces
           cerevisiae YHR131c, start by similarity
          Length = 681

 Score =  193 bits (490), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 95/225 (42%), Positives = 135/225 (60%), Gaps = 8/225 (3%)

Query: 78  IDPLPAKPPSYKSSDPSRRVTFPVYETLDDGSL----PGYSPAVEAITVVSMKLEWLDPY 133
           ID  PA PP Y   + +R VTFP++E L   S+    P Y P V  + +VS+KLEWL P+
Sbjct: 55  IDGEPASPPDYDEVNYNRHVTFPIWEDLTPCSMTEKPPAYHPTVYNVAIVSVKLEWLSPF 114

Query: 134 TCSPSRSWKNFVMEINSTQLNFYLIDPALTRGIKNYCNGKSHFGGEHLDPSLEYEXXXXX 193
             SP+RSW+ F+MEINSTQ+NFY ++P   R +KNY N K   G + L   +        
Sbjct: 115 EPSPNRSWRTFIMEINSTQINFYALEPEFHRLVKNYYNLKYDDGAKSLAKGI----LSLG 170

Query: 194 XXXXXXKNTYQFNKADQECXXXXXXXXXXXYLTDNKLFRSYSLQFAKYGIPTDYNRKTFV 253
                  N     +   +            YL+D +L+RS++LQ+A+ GIPTDY +    
Sbjct: 171 NSKKKNDNKIVDTEPHWKRLNAKLERNYSKYLSDARLYRSFTLQYARMGIPTDYRKSAHA 230

Query: 254 LRVRCETEQFMLSFSHVDDMIMWNMYLSIGIGVSLDLDFRELPTY 298
           LR+RCE EQF+++F +VDD+I W+MY+++GI V+LDLD R+LP Y
Sbjct: 231 LRLRCEAEQFLVAFDNVDDLINWSMYINMGISVALDLDCRQLPNY 275

 Score = 97.4 bits (241), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 47/98 (47%), Positives = 64/98 (65%), Gaps = 3/98 (3%)

Query: 565 ATSIYQEEGIFHDSEDDYYYVVDRNDAFRRRASSVTSNLSSTPYGSGDVKWHPPRKEMSR 624
             SIY EEG+ H+SE DYYY  ++    R RA+S  SN+ S    + DVKW PP+K +SR
Sbjct: 518 VVSIYAEEGLVHESESDYYY--EQRRLTRSRAASTASNMISHA-DADDVKWMPPQKILSR 574

Query: 625 RRYIRDSLRCIKPLPDNEEWLGKVLIRPVSAPDYDTNN 662
           RRY++DSLRCIK   ++  W+G+V+  P   P + TNN
Sbjct: 575 RRYVKDSLRCIKGFVEHSSWMGRVVCCPTGPPSFKTNN 612

>Scas_654.22
          Length = 580

 Score =  168 bits (426), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 133/245 (54%), Gaps = 37/245 (15%)

Query: 78  IDPLPAKPPSYKSSDPSRRVTFPVYETLDDG----SLPGYSPAVEAITVVSMKLEWLDPY 133
           IDP P +PP Y + +PSR+++FP+YET  D     + P YSPAV+ IT+VSMKLEW  P 
Sbjct: 94  IDPYPVEPPRYDTMNPSRKISFPIYETYHDTIQQPAPPSYSPAVDEITLVSMKLEWESP- 152

Query: 134 TCSPSR----SWKNFVMEINSTQLNFYLIDPALTRGIKNYCNGKSH---FGGEHLDPSLE 186
             +P R     WK  +ME+NSTQLNFY +D  L   +K     + +   FG  +      
Sbjct: 153 -MAPIRYAAQRWKIVLMEVNSTQLNFYDVDALLQSQLKKTIGPRKNSTLFGMNN------ 205

Query: 187 YEXXXXXXXXXXXKNTYQ-FNKADQECXXXXXXXXXXXYLTDNKLFRSYSLQFAKYGIPT 245
                          T+Q + K+D E            YL D  L +SYSLQF + G PT
Sbjct: 206 ---------NRNEDITFQSYTKSDNEKICQLIRRNKSKYLHDANLVKSYSLQFGRVGFPT 256

Query: 246 DYNRKT--------FVLRVRCETEQFMLSFSHVDDMIMWNMYLSIGIGVSLDLDFRELPT 297
           D + K           LR+RCE +QF+L F+ +D +IM  +++ +GI VSLDL  RELPT
Sbjct: 257 DLSSKNKGKRTSDPIALRLRCEAQQFLLQFTDMDSLIMSAVHIDMGISVSLDLQIRELPT 316

Query: 298 YRTVP 302
           YR VP
Sbjct: 317 YRIVP 321

 Score = 84.3 bits (207), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 73/150 (48%), Gaps = 25/150 (16%)

Query: 559 PNSTTQATSIYQEEGIFHDSEDDYYYVVDRNDAFRRRASSVTSNLSSTPYGSGDVKWHPP 618
           P +   A S+YQEEGI+ D +D+     D  D     AS + S+         D KW P 
Sbjct: 436 PTTNDSAQSVYQEEGIYPDDDDEEEEDEDDGDEDEYYASDIDSD--------DDYKWSPT 487

Query: 619 RKEMSRRRYIRDSLRCIKPLPDNEEWLGKVLIRPVSAPDYDTNNPPIXXXXXXXXXXXXX 678
            K+ SRRRY+RDSLRCIK + +N +W+GKV+  P  AP ++TNN P+             
Sbjct: 488 SKQTSRRRYVRDSLRCIKSMTENHKWVGKVVFCPTKAPSFETNNLPL------------- 534

Query: 679 XXXXXXXXXXXXGVILQKCKNHYAKPYIVG 708
                         +    KNHY K ++VG
Sbjct: 535 ----FIGKGPHASTVYDTTKNHYLKAHVVG 560

>CAGL0J05830g complement(552107..553930) some similarities with
           sp|P53907 Saccharomyces cerevisiae YNL144c or sp|P38835
           Saccharomyces cerevisiae YHR131c, hypothetical start
          Length = 607

 Score =  108 bits (271), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 78/242 (32%), Positives = 102/242 (42%), Gaps = 53/242 (21%)

Query: 110 LPGYSPAVEAITVVSMKLEWLDPYTCSPSRSWKNFVMEINSTQLNF-------------- 155
           LPGYSPAVE       KLEW  P   S    W + V+ INSTQLN               
Sbjct: 40  LPGYSPAVEKFVRAKFKLEWESPTQVSRDPCWYDVVLHINSTQLNLYLPRCPKSRPASKS 99

Query: 156 --YLIDPALTRGIKNYCNGKSHFGGEHLDPSLE--------------YEXXXXXXXXXXX 199
             Y+       G++      + F   +L P+ E              Y+           
Sbjct: 100 LSYVSAKPSVSGVRRLSERFTRFKKNYL-PAFEPLDFHPTPAGFTNSYQNMPQDALGARK 158

Query: 200 KNTYQFN-----KADQECXXXXXXXXXXXYLTDNKLFRSYSLQFAKYGIPTDYNRKTF-- 252
           K + Q++       ++ C                  F+SYSLQ AK G+PT  +RK    
Sbjct: 159 KRSNQYDFIYDTNYEEYCSETCDSMDVSTGFVP---FKSYSLQGAKVGMPTSESRKKVYI 215

Query: 253 ------------VLRVRCETEQFMLSFSHVDDMIMWNMYLSIGIGVSLDLDFRELPTYRT 300
                        LR+R E +QF++ F H+DDMIMW+MYLS+GI VS DL  RE P YR 
Sbjct: 216 DEENVYKDAYLVCLRLRMEDQQFLVQFEHIDDMIMWSMYLSMGINVSKDLYDREYPNYRI 275

Query: 301 VP 302
           VP
Sbjct: 276 VP 277

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 29/38 (76%)

Query: 612 DVKWHPPRKEMSRRRYIRDSLRCIKPLPDNEEWLGKVL 649
           D KW+P +KE +R+RYIR SLRCI+PL  + +W G+ +
Sbjct: 536 DTKWNPVKKEQTRKRYIRHSLRCIRPLAPDAKWEGETI 573

>KLLA0A08206g 730940..731632 no similarity, hypothetical start
          Length = 230

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 73/190 (38%), Gaps = 32/190 (16%)

Query: 110 LPGYSPAVEAITVVSMKLEWLDPYTCSPSRSWKNFVMEINSTQLNFYLIDPALTRGIKNY 169
           LP Y+P+++   ++  + E         S  W    +EINSTQL   LI P +    +  
Sbjct: 39  LPPYTPSLQISFLLQTQFE--------HSHRWTPHCVEINSTQL---LIRPLIHSHDEKL 87

Query: 170 CNGKSHFGGEHLDPSLEYEXXXXXXXXXXXKNTY-QFNKADQECXXXXXXXXXXXYLTDN 228
            N         LD  LEY+            +   Q  +   +            YL  +
Sbjct: 88  INK----WYSKLD-ELEYKQYKATSNHQLCHDQLVQSTQVPNQRDHIVLCTAKGLYLEKD 142

Query: 229 KLF----------RSYSLQFAKYGIPTDYNRKTFVLRVRCETEQFMLSFSHVDDMIMWNM 278
           K            + YSLQ  + G+ TD +R    LR+RCE EQF+L     DD  + ++
Sbjct: 143 KSLNLIQWNRDPIKKYSLQDCRIGLNTDMSR---CLRIRCEREQFLLRVP--DDASVTSL 197

Query: 279 YLSIGIGVSL 288
           +  I     L
Sbjct: 198 FAKIACAAEL 207

>Scas_681.29
          Length = 528

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 24/34 (70%)

Query: 485 VGGATINSNDLQVQTGFHSNTGLQNDLNELQQVI 518
           +GG  I  + L  +TGF++ TG+ +D +E++++I
Sbjct: 480 IGGVRIEDDILVTKTGFYNLTGITSDPDEIEKII 513

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.132    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,066,166
Number of extensions: 784633
Number of successful extensions: 1670
Number of sequences better than 10.0: 20
Number of HSP's gapped: 1689
Number of HSP's successfully gapped: 31
Length of query: 709
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 600
Effective length of database: 12,822,747
Effective search space: 7693648200
Effective search space used: 7693648200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)