Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_33.146121291125766e-78
Sklu_1881.41301064784e-63
AFR044C1261054177e-54
KLLA0F27907g150983954e-50
CAGL0G06094g1381103353e-41
YHR132W-A1311033328e-41
Scas_697.151421083284e-40
YNL157W1681203062e-36
CAGL0F05885g71247602.7
AAR020W111285569.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.14612
         (128 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.14612                                                         226   6e-78
Sklu_1881.4 YHR132W-A, Contig c1881 4533-4925 reverse complement      188   4e-63
AFR044C [3236] [Homologous to ScYHR132W-A - SH; ScYNL157W - SH] ...   165   7e-54
KLLA0F27907g complement(2581760..2582212) some similarities with...   156   4e-50
CAGL0G06094g 583297..583713 highly similar to tr|Q9P305 Saccharo...   133   3e-41
YHR132W-A (YHR132W-A) [2419] chr8 (370055..370450) Member of the...   132   8e-41
Scas_697.15                                                           130   4e-40
YNL157W (YNL157W) [4440] chr14 (340352..340858) Protein with sim...   122   2e-36
CAGL0F05885g 588828..590966 similar to sp|Q05080 Saccharomyces c...    28   2.7  
AAR020W [206] [Homologous to ScYER013W (PRP22) - SH] complement(...    26   9.8  

>Kwal_33.14612
          Length = 129

 Score =  226 bits (576), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%)

Query: 1   MNKDNDLSPTSSSVNLNEKVDTSKMTPQELKLYKMYGKLPSKKDLFKHKLQERKYFDSGD 60
           MNKDNDLSPTSSSVNLNEKVDTSKMTPQELKLYKMYGKLPSKKDLFKHKLQERKYFDSGD
Sbjct: 1   MNKDNDLSPTSSSVNLNEKVDTSKMTPQELKLYKMYGKLPSKKDLFKHKLQERKYFDSGD 60

Query: 61  YALNKAGVKSDDLQSDSIGNSHLPVTNPSGLRESIIKRRLSSSAGGMDAQEL 112
           YALNKAGVKSDDLQSDSIGNSHLPVTNPSGLRESIIKRRLSSSAGGMDAQEL
Sbjct: 61  YALNKAGVKSDDLQSDSIGNSHLPVTNPSGLRESIIKRRLSSSAGGMDAQEL 112

>Sklu_1881.4 YHR132W-A, Contig c1881 4533-4925 reverse complement
          Length = 130

 Score =  188 bits (478), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 90/106 (84%), Positives = 102/106 (96%)

Query: 4   DNDLSPTSSSVNLNEKVDTSKMTPQELKLYKMYGKLPSKKDLFKHKLQERKYFDSGDYAL 63
           +ND+SPTSS+++L   VDTSK+TPQELKLYK+YGKLPSKKDLFKHKLQERKYFDSGDYAL
Sbjct: 2   NNDISPTSSNIDLKNPVDTSKLTPQELKLYKLYGKLPSKKDLFKHKLQERKYFDSGDYAL 61

Query: 64  NKAGVKSDDLQSDSIGNSHLPVTNPSGLRESIIKRRLSSSAGGMDA 109
           +KAGVKSDDLQSDSIG+SHLPVTNPSGLRESII+RR+SSSAG +DA
Sbjct: 62  SKAGVKSDDLQSDSIGSSHLPVTNPSGLRESIIRRRMSSSAGSVDA 107

>AFR044C [3236] [Homologous to ScYHR132W-A - SH; ScYNL157W - SH]
           (511998..512378) [381 bp, 126 aa]
          Length = 126

 Score =  165 bits (417), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 93/105 (88%)

Query: 8   SPTSSSVNLNEKVDTSKMTPQELKLYKMYGKLPSKKDLFKHKLQERKYFDSGDYALNKAG 67
           SPT+S++     VD S +TPQELKLYK+YGKLP KKDLFKHKL ERKYFDSGDYAL+KAG
Sbjct: 6   SPTNSTLADTGDVDLSALTPQELKLYKLYGKLPGKKDLFKHKLHERKYFDSGDYALSKAG 65

Query: 68  VKSDDLQSDSIGNSHLPVTNPSGLRESIIKRRLSSSAGGMDAQEL 112
           VKS+DL S ++G+SHLPVTNPSGLRESII+RR+SSSAGG+D+Q L
Sbjct: 66  VKSEDLGSAAVGSSHLPVTNPSGLRESIIRRRMSSSAGGLDSQNL 110

>KLLA0F27907g complement(2581760..2582212) some similarities with
           sgd|S0007496 Saccharomyces cerevisiae YHR132wa Pi,
           hypothetical start
          Length = 150

 Score =  156 bits (395), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 76/98 (77%), Positives = 87/98 (88%), Gaps = 3/98 (3%)

Query: 18  EKVDTSKMTPQELKLYKMYGKLPSKKDLFKHKLQERKYFDSGDYALNKAGVKSDDLQSDS 77
           E VD SK++PQELK+YKMYGKLPSKKDLF+HKLQERKYFDSGDYAL +AGVKSDDLQS  
Sbjct: 35  ENVDLSKLSPQELKIYKMYGKLPSKKDLFQHKLQERKYFDSGDYALRRAGVKSDDLQSSP 94

Query: 78  IGNSHLPVTNPSGLRESIIKRRLSSSAGG---MDAQEL 112
           + N++LP+TNPSGLRESIIKRR+SSSA G   +DAQ L
Sbjct: 95  VANNNLPLTNPSGLRESIIKRRMSSSANGPSNVDAQRL 132

>CAGL0G06094g 583297..583713 highly similar to tr|Q9P305
           Saccharomyces cerevisiae YHR132wa, start by similarity
          Length = 138

 Score =  133 bits (335), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 68/110 (61%), Positives = 90/110 (81%), Gaps = 7/110 (6%)

Query: 3   KDNDLSPTSSSVNLNEK------VDTSKMTPQELKLYKMYGKLPSKKDLFKHKLQERKYF 56
           K++ +SPT+S + L++       VD S+++ QELKLYKMYGKLPSKKD+FKH++  RKYF
Sbjct: 9   KEDSISPTNSELELDKHGVDKNGVDVSRLSEQELKLYKMYGKLPSKKDIFKHRMAGRKYF 68

Query: 57  DSGDYALNKAGV-KSDDLQSDSIGNSHLPVTNPSGLRESIIKRRLSSSAG 105
           DSGDYAL KAGV +SDD+  ++  +++LPVTNPSGLRESII+RR+SSSAG
Sbjct: 69  DSGDYALKKAGVIRSDDVIDENNSSNNLPVTNPSGLRESIIRRRMSSSAG 118

>YHR132W-A (YHR132W-A) [2419] chr8 (370055..370450) Member of the
           cAMP-regulated phosphoprotein or endosulfine conserved
           region containing family, has high similarity to
           uncharacterized S. cerevisiae Ynl157p [396 bp, 131 aa]
          Length = 131

 Score =  132 bits (332), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 71/103 (68%), Positives = 85/103 (82%), Gaps = 9/103 (8%)

Query: 6   DLSPTSSSVNLN-------EKVDTSKMTPQELKLYKMYGKLPSKKDLFKHKLQERKYFDS 58
           DLSPTSS V+L+       E VD SK++PQELKLYKMYGKLPSKKDL +HK+Q+R+YFDS
Sbjct: 4   DLSPTSSRVDLSNPHGFTKEGVDLSKLSPQELKLYKMYGKLPSKKDLLRHKMQDRQYFDS 63

Query: 59  GDYALNKAGV-KSDDLQSDSIGNSHLPVTNPSGLRESIIKRRL 100
           GDYAL KAGV KSDD+  ++  N +LPVTNPSGLRESII+RR+
Sbjct: 64  GDYALKKAGVIKSDDVIVNNSSN-NLPVTNPSGLRESIIRRRM 105

>Scas_697.15
          Length = 142

 Score =  130 bits (328), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 70/108 (64%), Positives = 82/108 (75%), Gaps = 12/108 (11%)

Query: 4   DNDLSPTSSSVNLNE----------KVDTSKMTPQELKLYKMYGKLPSKKDLFKHKLQER 53
           +  LSPT+S V+L             VD SK+TPQELKL+KMYGKLPSK+DL KHK+QER
Sbjct: 3   EEQLSPTTSRVDLKNLAHTKDKDGNMVDLSKLTPQELKLFKMYGKLPSKRDLLKHKMQER 62

Query: 54  KYFDSGDYALNKAGV-KSDDLQSDSIGNSHLPVTNPSGLRESIIKRRL 100
           KYFDSGDYAL KAGV K DD+ S +  N ++PVTNPSGLRESII+RRL
Sbjct: 63  KYFDSGDYALRKAGVIKKDDVMSSNSSN-NMPVTNPSGLRESIIRRRL 109

>YNL157W (YNL157W) [4440] chr14 (340352..340858) Protein with
           similarity to Yhr132w-ap and with weak similarity to
           human ENSA alpha-endosulfine and human ARPP-19
           cAMP-regulated phosphoprotein [507 bp, 168 aa]
          Length = 168

 Score =  122 bits (306), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 87/120 (72%), Gaps = 15/120 (12%)

Query: 6   DLSPTSSSVNLNE-------KVDTSKMTPQELKLYKMYGKLPSKKDLFKHKLQERKYFDS 58
           +LSP SS+ +L +        +DTSK +P E+KLYKMYGKLPSKKD+FKH +Q+RKYFDS
Sbjct: 5   NLSPNSSNPDLTKLNNGESGTIDTSKFSPNEMKLYKMYGKLPSKKDIFKHTMQKRKYFDS 64

Query: 59  GDYALNKAGVKSDDLQSDSIGNSHLPVTNPSGLRESIIKRRLS------SSAGGMDAQEL 112
           GDYAL KAG++++D    + G ++LP+TNPS LRE IIKRR+S      S+AG +D   L
Sbjct: 65  GDYALQKAGIQNND--PINYGKNNLPLTNPSKLREDIIKRRISTCPSTASTAGVVDNATL 122

>CAGL0F05885g 588828..590966 similar to sp|Q05080 Saccharomyces
           cerevisiae YMR032w HOF1 involved in cytokinesis, start
           by similarity
          Length = 712

 Score = 27.7 bits (60), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%)

Query: 45  LFKHKLQERKYFDSGDYALNKAGVKSDDLQSDSIGNSHLPVTNPSGL 91
           L   + QE   F+ GDY L    V  D  + +  GNS+   T+ +GL
Sbjct: 653 LINSEAQELANFEKGDYLLLTEVVNEDWYRGEVYGNSNTTTTHGNGL 699

>AAR020W [206] [Homologous to ScYER013W (PRP22) - SH]
           complement(376250..379588) [3339 bp, 1112 aa]
          Length = 1112

 Score = 26.2 bits (56), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 33/85 (38%), Gaps = 14/85 (16%)

Query: 16  LNEKVDTSKMTPQELKLYKMYGKLP--------------SKKDLFKHKLQERKYFDSGDY 61
           L E+V   K T QEL +  +Y  LP              S+K +F   + E      G Y
Sbjct: 677 LYERVQALKETIQELLILPVYSALPSEVQSKIFEPTPKGSRKVIFATNIAETSITIDGIY 736

Query: 62  ALNKAGVKSDDLQSDSIGNSHLPVT 86
            +   G    ++ +  IG   L V+
Sbjct: 737 YVVDPGYAKSNIYNPKIGIEQLVVS 761

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.306    0.126    0.339 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,088,419
Number of extensions: 172003
Number of successful extensions: 565
Number of sequences better than 10.0: 26
Number of HSP's gapped: 562
Number of HSP's successfully gapped: 26
Length of query: 128
Length of database: 16,596,109
Length adjustment: 89
Effective length of query: 39
Effective length of database: 13,515,107
Effective search space: 527089173
Effective search space used: 527089173
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 55 (25.8 bits)