Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_33.1460524123911901e-168
Sklu_1881.22562546422e-84
Scas_697.132572635721e-73
KLLA0F27863g2432475129e-65
YHR134W (WSS1)2692275052e-63
AFR042C2241274534e-56
CAGL0G06116g2991334542e-55
CAGL0J05786g614109690.75
KLLA0C16269g48436626.1
Scas_446.2149724619.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.14605
         (239 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.14605                                                         462   e-168
Sklu_1881.2 YHR134W, Contig c1881 2666-3436 reverse complement        251   2e-84
Scas_697.13                                                           224   1e-73
KLLA0F27863g complement(2579510..2580241) some similarities with...   201   9e-65
YHR134W (WSS1) [2421] chr8 (371750..372559) Protein involved in ...   199   2e-63
AFR042C [3234] [Homologous to ScYHR134W (WSS1) - SH] (510151..51...   179   4e-56
CAGL0G06116g 584454..585353 similar to sp|P38838 Saccharomyces c...   179   2e-55
CAGL0J05786g complement(549438..551282) highly similar to KLLA0E...    31   0.75 
KLLA0C16269g complement(1423302..1424756) similar to sgd|S000230...    28   6.1  
Scas_446.2                                                             28   9.1  

>Kwal_33.14605
          Length = 241

 Score =  462 bits (1190), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 225/239 (94%), Positives = 225/239 (94%)

Query: 1   MTIQKNEHIDKVAVMQKKPNRDYALEILKDIAHRVSYLMREYKFKVGQLVEFYPKNKRLL 60
           MTIQKNEHIDKVAVMQKKPNRDYALEILKDIAHRVSYLMREYKFKVGQLVEFYPKNKRLL
Sbjct: 1   MTIQKNEHIDKVAVMQKKPNRDYALEILKDIAHRVSYLMREYKFKVGQLVEFYPKNKRLL 60

Query: 61  GMNVNRGAKIMLRLRDPFNEEVFLSREAVLGTMLHELTHNVYGPHNALFYKKLDELTARA 120
           GMNVNRGAKIMLRLRDPFNEEVFLSREAVLGTMLHELTHNVYGPHNALFYKKLDELTARA
Sbjct: 61  GMNVNRGAKIMLRLRDPFNEEVFLSREAVLGTMLHELTHNVYGPHNALFYKKLDELTARA 120

Query: 121 WVIKQQGLFDGFVGRGRKLGVKPKAAIPPQRXXXXXXXXXXXXXXPREMAFLAAEKRATD 180
           WVIKQQGLFDGFVGRGRKLGVKPKAAIPPQR              PREMAFLAAEKRATD
Sbjct: 121 WVIKQQGLFDGFVGRGRKLGVKPKAAIPPQRLGTLSGSKSTKGKSPREMAFLAAEKRATD 180

Query: 181 AQWCAGSRAEAEPKKNELVFIEIDSEGEELPEMNGLKTSKDQGVAGKPTQSALDIEVID 239
           AQWCAGSRAEAEPKKNELVFIEIDSEGEELPEMNGLKTSKDQGVAGKPTQSALDIEVID
Sbjct: 181 AQWCAGSRAEAEPKKNELVFIEIDSEGEELPEMNGLKTSKDQGVAGKPTQSALDIEVID 239

>Sklu_1881.2 YHR134W, Contig c1881 2666-3436 reverse complement
          Length = 256

 Score =  251 bits (642), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 132/254 (51%), Positives = 167/254 (65%), Gaps = 15/254 (5%)

Query: 1   MTIQK-NEHIDKVAVMQKKPNRDYALEILKDIAHRVSYLMREYKFKVGQLVEFYPKNKRL 59
           MT+QK N HI ++A +Q KPN+D AL +L+DIAHRVSYLMRE KFKVG+LVEFYP++KRL
Sbjct: 1   MTVQKKNPHIGRIASLQGKPNKDDALALLEDIAHRVSYLMRENKFKVGELVEFYPRDKRL 60

Query: 60  LGMNVNRGAKIMLRLRDPFNEEVFLSREAVLGTMLHELTHNVYGPHNALFYKKLDELTAR 119
           LGMNVN GAKIMLRLR P +E  FL+RE++LGTMLHELTHN++GPH+A FY+KLD+L+  
Sbjct: 61  LGMNVNGGAKIMLRLRHPNDESQFLARESILGTMLHELTHNLFGPHDAKFYRKLDDLSGT 120

Query: 120 AWVIKQQGLFDGFVGRGRKLGVKPKAAIPPQRX---XXXXXXXXXXXXXPREMAFLAAEK 176
            WVI+Q+GLFD FVGRGR+LG  P++ IPP                   P+ MA  AAEK
Sbjct: 121 QWVIEQRGLFDSFVGRGRRLGCTPRSRIPPTERRLGTIEVVSSNNRDKSPKRMAAAAAEK 180

Query: 177 RATDAQWCAGSR--AEAEPKKNELVFIEIDSEGEELPEMNG---------LKTSKDQGVA 225
           RA D  WC   +     EP   EL +I +D E ++    NG         L   +DQ   
Sbjct: 181 RARDTMWCGDLKRNKHVEPDAAELEYIILDDEDKDQARENGNSSILVVDLLNAHRDQNSC 240

Query: 226 GKPTQSALDIEVID 239
            +  Q +   E+ID
Sbjct: 241 DRRRQGSGTPEIID 254

>Scas_697.13
          Length = 257

 Score =  224 bits (572), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 124/263 (47%), Positives = 162/263 (61%), Gaps = 34/263 (12%)

Query: 3   IQKNEHIDKVAVMQKKPNRDYALEILKDIAHRVSYLMREYKFKVGQLVEFYPKNKRLLGM 62
           + +N HI KVAV+Q+KPN +YAL+IL+DI  +VSYLM+E KFKV  LVEFYPK+KRLLGM
Sbjct: 1   MHENPHITKVAVLQRKPNNEYALQILQDITKQVSYLMKEEKFKVQTLVEFYPKDKRLLGM 60

Query: 63  NVNRGAKIMLRLRDPFNEEVFLSREAVLGTMLHELTHNVYGPHNALFYKKLDELTARAWV 122
           NVN G KIMLRLR P +E  FL+REA+LGTMLHELTHN++GPH+  FY+KLD+L+AR WV
Sbjct: 61  NVNAGQKIMLRLRTPGDEFQFLNREAILGTMLHELTHNLFGPHDRRFYEKLDQLSARQWV 120

Query: 123 IKQQGLFDGFVGRGRKLGVKPKAAIPPQR-----------------XXXXXXXXXXXXXX 165
           I+QQGLFD F+G GR+LG   +     +R                               
Sbjct: 121 IEQQGLFDTFLGSGRRLGGSTRTLSNNRRVRSIIGRSGKGRGRKLGTITNRPSSTFEGKT 180

Query: 166 PREMAFLAAEKRATDAQWCA-----GSRAEAEPKKNEL----VFIEIDSEGEELPEMNGL 216
           PREMA +AAE+R  D +WC       ++ + EP +++L    + I  D +    PE    
Sbjct: 181 PREMAAVAAERRYNDDKWCGEKNNLENKKKLEPNQDDLREETIIILDDDDATTTPETQ-- 238

Query: 217 KTSKDQGVAGKPTQSALDIEVID 239
           K +KD     +P      IE+ID
Sbjct: 239 KENKDDDDDIRP------IEIID 255

>KLLA0F27863g complement(2579510..2580241) some similarities with
           sp|P38838 Saccharomyces cerevisiae YHR134w WSS1
           singleton, hypothetical start
          Length = 243

 Score =  201 bits (512), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 113/247 (45%), Positives = 156/247 (63%), Gaps = 20/247 (8%)

Query: 3   IQKNEHIDKVAVMQKKPNRDYALEILKDIAHRVSYLMREYKFKVGQLVEFYPKNKRLLGM 62
           IQKN H+  +AV+Q KP ++ AL ILK +AH VSYLM+E +FKV QLVEFYP+N+ LLGM
Sbjct: 5   IQKNPHVGSIAVLQTKPGKNDALNILKRVAHNVSYLMKEERFKVRQLVEFYPRNRSLLGM 64

Query: 63  NVNRGAKIMLRLRDPFNEEVFLSREAVLGTMLHELTHNVYGPHNALFYKKLDELTARAWV 122
           NVN+G KIMLRLRDP +E  FL  E+++GTMLHELTHN++GPH+  FY+KLD+L+ R W 
Sbjct: 65  NVNKGMKIMLRLRDPLDEYKFLPIESIMGTMLHELTHNLHGPHDRKFYEKLDQLSGRQWT 124

Query: 123 IKQQGLFDGFVGRGRKLGVKPKAAIPPQRXXXXXXXXXXXXXXP--------REMAFLAA 174
           I+Q GL+D F+G G++LG KP  +I   +              P        REMA +AA
Sbjct: 125 IEQMGLYDSFLGTGKRLGSKPMGSIIIGKTLERGKGRRLGGTTPGTGPRRNAREMAAIAA 184

Query: 175 EKRATDAQWCAGSRAEAE--PKKNELVFIEIDSEGEELPEMNGLKTSKDQGVAGKPTQSA 232
           +KRA D + C  S  +    P + +LV   +D +  E  E + ++ +K +   G      
Sbjct: 185 DKRAADNKTCCNSNDQKNYMPVQEDLVIELLDDDSNE--ENHNIEVTKLETAGG------ 236

Query: 233 LDIEVID 239
             IE++D
Sbjct: 237 --IEIMD 241

>YHR134W (WSS1) [2421] chr8 (371750..372559) Protein involved in
           sensitivity to UV irradiation, has low similarity to
           uncharacterized C. albicans Orf6.4302p [810 bp, 269 aa]
          Length = 269

 Score =  199 bits (505), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 104/227 (45%), Positives = 138/227 (60%), Gaps = 26/227 (11%)

Query: 4   QKNEHIDKVAVMQKKPNRDYALEILKDIAHRVSYLMREYKFKVGQLVEFYPKNKRLLGMN 63
            KN HI KVAV+Q KPN++ AL ++K+IAH+VSYLM+E  FKV  LVEFYP+++RLLGMN
Sbjct: 24  HKNPHIQKVAVLQSKPNKEDALNLIKEIAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMN 83

Query: 64  VNRGAKIMLRLRDPFNEEVFLSREAVLGTMLHELTHNVYGPHNALFYKKLDELTARAWVI 123
           VN G+KIMLRLR   +E  FL  E ++GTMLHELTHN++GPH+  FY KLDEL  R WVI
Sbjct: 84  VNHGSKIMLRLRCSTDEFQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVI 143

Query: 124 KQQGLFDGFVGRGRKL--------------GVKPKAAIPPQRXXXXX--------XXXXX 161
           +Q+GL+D F+G G++L              G+     I  +R                  
Sbjct: 144 EQRGLYDTFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGISSID 203

Query: 162 XXXXPREMAFLAAEKRATDAQWCAGSRAEAEPKKNELVFIEIDSEGE 208
               PRE+A  AAE+R  D +WC     E +  K++++   I S  E
Sbjct: 204 RGNSPRELAAFAAERRYRDDRWC----GETKNNKDQIISDNISSSLE 246

>AFR042C [3234] [Homologous to ScYHR134W (WSS1) - SH]
           (510151..510825) [675 bp, 224 aa]
          Length = 224

 Score =  179 bits (453), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 80/127 (62%), Positives = 103/127 (81%)

Query: 6   NEHIDKVAVMQKKPNRDYALEILKDIAHRVSYLMREYKFKVGQLVEFYPKNKRLLGMNVN 65
           N HI + AV+Q KP ++ ALE+L+DIA RVSYLMRE  F+VGQL EFYP+ +RLLG+NVN
Sbjct: 8   NPHIAEFAVLQHKPGKERALEMLQDIARRVSYLMREEGFRVGQLAEFYPRERRLLGLNVN 67

Query: 66  RGAKIMLRLRDPFNEEVFLSREAVLGTMLHELTHNVYGPHNALFYKKLDELTARAWVIKQ 125
           +GA+I+LRLR+P +E+ FLSRE +L  MLHELTHNV+GPH+A F +KLDEL  R WV+ Q
Sbjct: 68  QGARILLRLREPGDEQQFLSRETILAVMLHELTHNVFGPHDARFRRKLDELVGRQWVLDQ 127

Query: 126 QGLFDGF 132
           +G+ D F
Sbjct: 128 RGIVDSF 134

>CAGL0G06116g 584454..585353 similar to sp|P38838 Saccharomyces
           cerevisiae YHR134w WSS1, start by similarity
          Length = 299

 Score =  179 bits (454), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 104/133 (78%)

Query: 8   HIDKVAVMQKKPNRDYALEILKDIAHRVSYLMREYKFKVGQLVEFYPKNKRLLGMNVNRG 67
           HI  +AV+Q+KP ++ AL++LKDIA  VS LMRE KFKVG LVEFYP+++ LLGMNVN G
Sbjct: 5   HIRNIAVLQRKPGKEDALKLLKDIADAVSLLMRENKFKVGTLVEFYPRDRSLLGMNVNHG 64

Query: 68  AKIMLRLRDPFNEEVFLSREAVLGTMLHELTHNVYGPHNALFYKKLDELTARAWVIKQQG 127
            KIMLRLRDP +E  FL  E+++GTMLHELTHN++GPH+  FY KLDEL+ R W I+Q G
Sbjct: 65  QKIMLRLRDPLDEFRFLPWESLIGTMLHELTHNLHGPHDQKFYSKLDELSGRQWCIQQLG 124

Query: 128 LFDGFVGRGRKLG 140
           L D F+  G +LG
Sbjct: 125 LKDNFMTSGNRLG 137

>CAGL0J05786g complement(549438..551282) highly similar to
           KLLA0E23034g Kluyveromyces lactis and YALI0E27720g
           Yarrowia lipolytica, hypothetical start
          Length = 614

 Score = 31.2 bits (69), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 53/109 (48%), Gaps = 7/109 (6%)

Query: 3   IQKNEHIDKVAVMQKKPNRDYALEILKDIAHRVSYLMREYKFKVGQ-LVEF--YPKNKRL 59
           +Q +E+ D+V ++  K      +E LK+I   +S L+     K+GQ L++   +  N + 
Sbjct: 174 LQVSEYTDRVDILSNKSKSRRIVEQLKEICSVLSGLVVASNMKLGQKLLDMKNFSDNAKW 233

Query: 60  LG--MNVNRGAKIM--LRLRDPFNEEVFLSREAVLGTMLHELTHNVYGP 104
                 + R  KIM   R+RD + +  ++  ++ L  +   +  ++Y P
Sbjct: 234 FQDIFEIGRRYKIMNPERMRDTYGKLCYMVMDSRLPQICEHMEFHLYKP 282

>KLLA0C16269g complement(1423302..1424756) similar to sgd|S0002305
           Saccharomyces cerevisiae YDL146w, hypothetical start
          Length = 484

 Score = 28.5 bits (62), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 3/36 (8%)

Query: 4   QKNEHIDKVAVMQKKPNRDYALEILKDIAHRVSYLM 39
           Q NE+ DK    Q+ P +D  LEI++DI H  + L+
Sbjct: 151 QANEYHDKA---QEDPKKDTNLEIIEDIKHLTTILI 183

>Scas_446.2
          Length = 1497

 Score = 28.1 bits (61), Expect = 9.1,   Method: Composition-based stats.
 Identities = 12/24 (50%), Positives = 17/24 (70%)

Query: 7    EHIDKVAVMQKKPNRDYALEILKD 30
            EH D VAV+    N D+A+E+LK+
Sbjct: 1276 EHSDLVAVVSNSVNADHAIELLKE 1299

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.136    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,256,313
Number of extensions: 285923
Number of successful extensions: 680
Number of sequences better than 10.0: 14
Number of HSP's gapped: 677
Number of HSP's successfully gapped: 16
Length of query: 239
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 140
Effective length of database: 13,168,927
Effective search space: 1843649780
Effective search space used: 1843649780
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)