Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_33.1459650048520210.0
YNL154C (YCK2)54633516920.0
CAGL0G06138g53933216790.0
Scas_654.1752333216760.0
AFR040W54733516750.0
YHR135C (YCK1)53833216600.0
KLLA0D11044g53633516280.0
Scas_697.1252933016010.0
CAGL0J05940g48634515840.0
Scas_627.447533611691e-157
YER123W (YCK3)52436011621e-155
ADL053C47134611461e-153
Kwal_47.1731442136111221e-150
KLLA0E13563g47334611231e-150
CAGL0K02299g53836211191e-148
Sklu_2359.348836411141e-148
Kwal_56.240644752938331e-106
KLLA0D03168g5052938351e-106
CAGL0H03553g4952938311e-106
Sklu_1892.34743228281e-105
Scas_720.244732938271e-105
AFL091W4782938271e-105
YPL204W (HRR25)4942938241e-105
Scas_690.124882896862e-84
KLLA0C08525g15512371835e-14
YDR490C (PKH1)7662421721e-12
AAR009W4532131663e-12
Scas_618.84272191646e-12
Kwal_23.632515422321603e-11
KLLA0E03487g6472301585e-11
Scas_660.209572271577e-11
CAGL0L03520g14472251578e-11
Kwal_26.735514462221551e-10
YDR466W (PKH3)8982961542e-10
Kwal_56.240593532331493e-10
AER264C14832321523e-10
YJL095W (BCK1)14782721523e-10
Sklu_2437.1610712551513e-10
KLLA0F16467g3401591484e-10
Kwal_56.226939842481505e-10
YPL203W (TPK2)3802351476e-10
Sklu_2436.147842351471e-09
Kwal_47.183076212321461e-09
Kwal_0.964272151441e-09
AEL284C4792521442e-09
Scas_502.211162621443e-09
AFL090W3462341413e-09
KLLA0D03190g3722281413e-09
CAGL0I07513g10762741434e-09
Sklu_2429.54322151414e-09
KLLA0C12485g9252321415e-09
AFR335C10332511407e-09
YFR014C (CMK1)4461781398e-09
YCR073C (SSK22)13312371409e-09
Sklu_2232.23741591379e-09
Scas_711.2515152701401e-08
CAGL0L07326g5062381381e-08
KLLA0F14190g13382221381e-08
YHR102W (KIC1)10802211381e-08
CAGL0G09020g3612511361e-08
KLLA0B02332g3612241352e-08
Kwal_26.76356912291362e-08
AFR377C7262291362e-08
CAGL0F04741g4422171352e-08
AFL101C3672141343e-08
Kwal_33.138463752281343e-08
YGL158W (RCK1)5122481353e-08
ADR204W3391591333e-08
CAGL0K03399g7032301353e-08
YOL100W (PKH2)10811431353e-08
AFR092W14232221353e-08
CAGL0L11550g10722281344e-08
Scas_690.133542351315e-08
YOR061W (CKA2)3391591315e-08
YOL016C (CMK2)4472151316e-08
CAGL0K06479g9912441326e-08
KLLA0B12716g7162301318e-08
AFL188C4722381309e-08
Scas_689.25*4092141309e-08
YHR205W (SCH9)8241341311e-07
ABL028W7222341301e-07
Scas_720.9416832531301e-07
CAGL0G02035g3391591281e-07
Sklu_2430.57332301292e-07
CAGL0G04609g9652371292e-07
Scas_613.55172331282e-07
CAGL0M08404g4622291282e-07
Scas_673.20*7582171282e-07
YJL164C (TPK1)3972341272e-07
YPL141C8652691282e-07
CAGL0B04301g5421391273e-07
KLLA0F23155g4272141253e-07
YKL166C (TPK3)3982281244e-07
Scas_580.610152281264e-07
YBR028C5251351245e-07
Scas_703.57492371246e-07
Scas_660.286231611246e-07
CAGL0M08910g6121681246e-07
CAGL0F09075g7461341246e-07
ADL389W7112371246e-07
Scas_648.173401631227e-07
KLLA0E01584g4152431227e-07
CAGL0K07458g7041411238e-07
YDR477W (SNF1)6331611238e-07
YNR031C (SSK2)15792581239e-07
CAGL0C05005g10762261239e-07
Scas_721.1246842351221e-06
Kwal_47.167617441231221e-06
YOR233W (KIN4)8002201221e-06
CAGL0K08514g14892521221e-06
Kwal_47.182335981601202e-06
KLLA0B03586g7341341202e-06
KLLA0D08415g7741391202e-06
KLLA0F24618g5561351192e-06
Kwal_56.240913811171182e-06
Kwal_14.12734152581182e-06
AEL083W5361471192e-06
YBR274W (CHK1)5271091192e-06
CAGL0I09504g5282221192e-06
Kwal_26.778812672161193e-06
Scas_717.696741321183e-06
AEL230W6081601183e-06
CAGL0K10604g4462141173e-06
YKL126W (YPK1)6801401183e-06
KLLA0F01507g4721201173e-06
YKL171W9281731183e-06
YPL153C (RAD53)8212381183e-06
YPL209C (IPL1)3671451164e-06
Kwal_33.139846491821174e-06
YMR104C (YPK2)6771231174e-06
ABL143C7252231174e-06
YGR052W3692201155e-06
Kwal_33.144347591381175e-06
CAGL0J06072g7731491165e-06
CAGL0I05896g7781841165e-06
CAGL0J03872g6612281166e-06
ADL283W3061671137e-06
ABL034W14252241167e-06
KLLA0F13552g12672181158e-06
YKL101W (HSL1)15182491158e-06
Scas_698.373471581138e-06
KLLA0A03806g6021601148e-06
Sklu_2392.68081551158e-06
Kwal_55.217093401631139e-06
KLLA0B07205g4552291139e-06
YNL161W (CBK1)7561511149e-06
Scas_651.183711341139e-06
CAGL0K12562g16821851151e-05
YOR231W (MKK1)5081321131e-05
Kwal_55.215458652291131e-05
Kwal_14.115915211541131e-05
Kwal_27.119192092071082e-05
ACR218W15691541122e-05
AEL115C3861191112e-05
ADR058C2952081102e-05
AFR076W8201961122e-05
KLLA0F09020g9282011122e-05
Sklu_1843.34861271112e-05
Kwal_26.87967962151112e-05
YGL179C (TOS3)5602381112e-05
Scas_707.315981541122e-05
AFR035W7191511112e-05
ACL191C3651601102e-05
ACR133C8512251112e-05
ABR014W9712141112e-05
YDL214C (PRR2)6991281112e-05
CAGL0F00649g5141821102e-05
ABL011C7012551112e-05
CAGL0M02299g8932291113e-05
KLLA0D10527g6452031103e-05
Kwal_33.145547141551103e-05
Scas_201.1*2741171083e-05
Kwal_26.87098292261103e-05
Sklu_2104.12992071083e-05
Kwal_55.203267502601103e-05
YJL141C (YAK1)8071841103e-05
KLLA0E21780g10162191103e-05
CAGL0E05720g3582141084e-05
KLLA0F01276g5192301084e-05
YDL101C (DUN1)5132381084e-05
Scas_654.127371511085e-05
YPL140C (MKK2)5061271085e-05
Scas_700.546982281085e-05
CAGL0L06820g3661641075e-05
Scas_616.1014611291085e-05
Kwal_26.78619552091086e-05
Kwal_27.98044731721076e-05
YHL007C (STE20)9392071086e-05
KLLA0A05819g7041841076e-05
YMR139W (RIM11)3701641066e-05
AEL120W773611076e-05
CAGL0B02739g6762351076e-05
Scas_655.28001381077e-05
YNL183C (NPR1)7901381077e-05
CAGL0K04301g3552321067e-05
Sklu_2361.38842441077e-05
ACR249C6431841077e-05
KLLA0B13607g9892141077e-05
CAGL0M10153g8671421077e-05
Scas_675.25272191068e-05
CAGL0J03828g4672211068e-05
KLLA0D07810g7181521068e-05
CAGL0F03245g10362501068e-05
KLLA0E14828g3101891049e-05
AEL205W793971061e-04
YLR113W (HOG1)4351631051e-04
Scas_593.14d4951541051e-04
CAGL0I03498g451941041e-04
Sklu_2417.133631661041e-04
CAGL0H10318g3071851031e-04
Scas_651.37931821051e-04
Scas_613.13*3121991031e-04
Scas_627.73491101041e-04
CAGL0M02233g7672341051e-04
Scas_721.462962081031e-04
Scas_640.165051331041e-04
Scas_689.229011661051e-04
YDL159W (STE7)5151191041e-04
Kwal_26.87034441191041e-04
Kwal_14.24974181231032e-04
Sklu_2323.34001061032e-04
Scas_653.256662291042e-04
Kwal_23.52908191111042e-04
Scas_713.384321631022e-04
KLLA0A06776g8001801032e-04
CAGL0H07535g2982081012e-04
YFL033C (RIM15)17701781032e-04
Scas_716.335732301022e-04
Scas_700.354391191022e-04
Scas_711.15727791022e-04
Sklu_2385.24341631022e-04
KLLA0F20053g4441631022e-04
ACR117W5241271023e-04
ACR142W8371531023e-04
CAGL0M02519g7561651023e-04
KLLA0C17160g8312651023e-04
KLLA0C04191g7972491023e-04
Scas_683.123562251003e-04
ADR033W5772271013e-04
Scas_668.228932071023e-04
YNL298W (CLA4)8421111013e-04
Scas_544.6489931013e-04
CAGL0M03729g861971013e-04
CAGL0J03432g6221381013e-04
CAGL0J11308g7281381013e-04
ADL315C4342301003e-04
Scas_477.57031491013e-04
Sklu_2366.54661081003e-04
CAGL0K02673g9151301014e-04
ACR196C530961004e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.14596
         (493 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.14596                                                         783   0.0  
YNL154C (YCK2) [4443] chr14 complement(343636..345276) Casein ki...   656   0.0  
CAGL0G06138g complement(585585..587204) similar to sp|P23291 Sac...   651   0.0  
Scas_654.17                                                           650   0.0  
AFR040W [3232] [Homologous to ScYHR135C (YCK1) - SH; ScYNL154C (...   649   0.0  
YHR135C (YCK1) [2422] chr8 complement(372695..374311) Casein kin...   644   0.0  
KLLA0D11044g complement(942458..944068) gi|730472|sp|P40230|RAG8...   631   0.0  
Scas_697.12                                                           621   0.0  
CAGL0J05940g 560563..562023 similar to sp|P23291 Saccharomyces c...   614   0.0  
Scas_627.4                                                            454   e-157
YER123W (YCK3) [1553] chr5 (404809..406383) Casein kinase I isof...   452   e-155
ADL053C [1688] [Homologous to ScYER123W (YCK3) - SH] (589602..59...   446   e-153
Kwal_47.17314                                                         436   e-150
KLLA0E13563g 1193481..1194902 some similarities with sp|P39962 S...   437   e-150
CAGL0K02299g complement(205332..206948) similar to sp|P39962 Sac...   435   e-148
Sklu_2359.3 YER123W, Contig c2359 7455-8921 reverse complement        433   e-148
Kwal_56.24064                                                         325   e-106
KLLA0D03168g 265761..267278 some similarities with sp|P29295 Sac...   326   e-106
CAGL0H03553g complement(328668..330155) highly similar to sp|P29...   324   e-106
Sklu_1892.3 YPL204W, Contig c1892 5770-7194                           323   e-105
Scas_720.24                                                           323   e-105
AFL091W [3102] [Homologous to ScYPL204W (HRR25) - SH] complement...   323   e-105
YPL204W (HRR25) [5244] chr16 (164275..165759) Casein kinase I (s...   322   e-105
Scas_690.12                                                           268   2e-84
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...    75   5e-14
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...    71   1e-12
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...    69   3e-12
Scas_618.8                                                             68   6e-12
Kwal_23.6325                                                           66   3e-11
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...    65   5e-11
Scas_660.20                                                            65   7e-11
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    65   8e-11
Kwal_26.7355                                                           64   1e-10
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...    64   2e-10
Kwal_56.24059                                                          62   3e-10
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...    63   3e-10
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...    63   3e-10
Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement      63   3e-10
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    62   4e-10
Kwal_56.22693                                                          62   5e-10
YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit o...    61   6e-10
Sklu_2436.14 YDR466W, Contig c2436 31299-33653                         61   1e-09
Kwal_47.18307                                                          61   1e-09
Kwal_0.96                                                              60   1e-09
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    60   2e-09
Scas_502.2                                                             60   3e-09
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...    59   3e-09
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...    59   3e-09
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...    60   4e-09
Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement        59   4e-09
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...    59   5e-09
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...    59   7e-09
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...    58   8e-09
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    59   9e-09
Sklu_2232.2 YOR061W, Contig c2232 1216-2340 reverse complement         57   9e-09
Scas_711.25                                                            59   1e-08
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...    58   1e-08
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    58   1e-08
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    58   1e-08
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...    57   1e-08
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...    57   2e-08
Kwal_26.7635                                                           57   2e-08
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...    57   2e-08
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...    57   2e-08
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...    56   3e-08
Kwal_33.13846                                                          56   3e-08
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...    57   3e-08
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    56   3e-08
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...    57   3e-08
YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine pr...    57   3e-08
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    57   3e-08
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    56   4e-08
Scas_690.13                                                            55   5e-08
YOR061W (CKA2) [4869] chr15 (441535..442554) Casein kinase II (P...    55   5e-08
YOL016C (CMK2) [4800] chr15 complement(294777..296120) Calcium/c...    55   6e-08
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...    55   6e-08
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...    55   8e-08
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...    55   9e-08
Scas_689.25*                                                           55   9e-08
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...    55   1e-07
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...    55   1e-07
Scas_720.94                                                            55   1e-07
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    54   1e-07
Sklu_2430.5 YKL126W, Contig c2430 8144-10345                           54   2e-07
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...    54   2e-07
Scas_613.5                                                             54   2e-07
CAGL0M08404g complement(836791..838179) some similarities with s...    54   2e-07
Scas_673.20*                                                           54   2e-07
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...    54   2e-07
YPL141C (YPL141C) [5305] chr16 complement(283463..286060) Serine...    54   2e-07
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...    54   3e-07
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...    53   3e-07
YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic...    52   4e-07
Scas_580.6                                                             53   4e-07
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...    52   5e-07
Scas_703.5                                                             52   6e-07
Scas_660.28                                                            52   6e-07
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...    52   6e-07
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...    52   6e-07
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...    52   6e-07
Scas_648.17                                                            52   7e-07
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...    52   7e-07
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...    52   8e-07
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...    52   8e-07
YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinas...    52   9e-07
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...    52   9e-07
Scas_721.124                                                           52   1e-06
Kwal_47.16761                                                          52   1e-06
YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine pr...    52   1e-06
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...    52   1e-06
Kwal_47.18233                                                          51   2e-06
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...    51   2e-06
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    51   2e-06
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...    50   2e-06
Kwal_56.24091                                                          50   2e-06
Kwal_14.1273                                                           50   2e-06
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....    50   2e-06
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    50   2e-06
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...    50   2e-06
Kwal_26.7788                                                           50   3e-06
Scas_717.69                                                            50   3e-06
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...    50   3e-06
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...    50   3e-06
YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine pr...    50   3e-06
KLLA0F01507g 144356..145774 some similarities with sp|P47042 Sac...    50   3e-06
YKL171W (YKL171W) [3100] chr11 (127480..130266) Serine/threonine...    50   3e-06
YPL153C (RAD53) [5294] chr16 complement(261726..264191) Serine/t...    50   3e-06
YPL209C (IPL1) [5240] chr16 complement(156489..157592) Serine/th...    49   4e-06
Kwal_33.13984                                                          50   4e-06
YMR104C (YPK2) [4061] chr13 complement(473419..475452) Serine/th...    50   4e-06
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    50   4e-06
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    49   5e-06
Kwal_33.14434                                                          50   5e-06
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...    49   5e-06
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    49   5e-06
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...    49   6e-06
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    48   7e-06
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...    49   7e-06
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...    49   8e-06
YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine pr...    49   8e-06
Scas_698.37                                                            48   8e-06
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....    49   8e-06
Sklu_2392.6 YNL161W, Contig c2392 12867-15293 reverse complement       49   8e-06
Kwal_55.21709                                                          48   9e-06
KLLA0B07205g complement(624606..625973) some similarities with s...    48   9e-06
YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine pr...    49   9e-06
Scas_651.18                                                            48   9e-06
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...    49   1e-05
YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine pr...    48   1e-05
Kwal_55.21545                                                          48   1e-05
Kwal_14.1159                                                           48   1e-05
Kwal_27.11919                                                          46   2e-05
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...    48   2e-05
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...    47   2e-05
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    47   2e-05
AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH] complement(...    48   2e-05
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...    48   2e-05
Sklu_1843.3 YOR231W, Contig c1843 2632-4092 reverse complement         47   2e-05
Kwal_26.8796                                                           47   2e-05
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    47   2e-05
Scas_707.3                                                             48   2e-05
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...    47   2e-05
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...    47   2e-05
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...    47   2e-05
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    47   2e-05
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    47   2e-05
CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces cer...    47   2e-05
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    47   2e-05
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...    47   3e-05
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...    47   3e-05
Kwal_33.14554                                                          47   3e-05
Scas_201.1*                                                            46   3e-05
Kwal_26.8709                                                           47   3e-05
Sklu_2104.1 YBR160W, Contig c2104 694-1593                             46   3e-05
Kwal_55.20326                                                          47   3e-05
YJL141C (YAK1) [2777] chr10 complement(147885..150308) Serine/th...    47   3e-05
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...    47   3e-05
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...    46   4e-05
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    46   4e-05
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...    46   4e-05
Scas_654.12                                                            46   5e-05
YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinas...    46   5e-05
Scas_700.54                                                            46   5e-05
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...    46   5e-05
Scas_616.10                                                            46   5e-05
Kwal_26.7861                                                           46   6e-05
Kwal_27.9804                                                           46   6e-05
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    46   6e-05
KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces c...    46   6e-05
YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3...    45   6e-05
AEL120W [2386] [Homologous to ScYKL171W - SH] complement(396394....    46   6e-05
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    46   6e-05
Scas_655.2                                                             46   7e-05
YNL183C (NPR1) [4417] chr14 complement(293137..295509) Serine/th...    46   7e-05
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    45   7e-05
Sklu_2361.3 YPL150W, Contig c2361 3677-6331                            46   7e-05
ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH] (797020..79...    46   7e-05
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    46   7e-05
CAGL0M10153g complement(1010688..1013291) some similarities with...    46   7e-05
Scas_675.2                                                             45   8e-05
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    45   8e-05
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...    45   8e-05
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    45   8e-05
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...    45   9e-05
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    45   1e-04
YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK), ...    45   1e-04
Scas_593.14d                                                           45   1e-04
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    45   1e-04
Sklu_2417.13 YMR139W, Contig c2417 24824-25915 reverse complement      45   1e-04
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    44   1e-04
Scas_651.3                                                             45   1e-04
Scas_613.13*                                                           44   1e-04
Scas_627.7                                                             45   1e-04
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...    45   1e-04
Scas_721.46                                                            44   1e-04
Scas_640.16                                                            45   1e-04
Scas_689.22                                                            45   1e-04
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    45   1e-04
Kwal_26.8703                                                           45   1e-04
Kwal_14.2497                                                           44   2e-04
Sklu_2323.3 YPL209C, Contig c2323 5241-6443                            44   2e-04
Scas_653.25                                                            45   2e-04
Kwal_23.5290                                                           45   2e-04
Scas_713.38                                                            44   2e-04
KLLA0A06776g 612115..614517 some similarities with sp|P36003 Sac...    44   2e-04
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...    44   2e-04
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...    44   2e-04
Scas_716.33                                                            44   2e-04
Scas_700.35                                                            44   2e-04
Scas_711.15                                                            44   2e-04
Sklu_2385.2 YLR113W, Contig c2385 3805-5109 reverse complement         44   2e-04
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    44   2e-04
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    44   3e-04
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...    44   3e-04
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...    44   3e-04
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...    44   3e-04
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...    44   3e-04
Scas_683.12                                                            43   3e-04
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...    44   3e-04
Scas_668.22                                                            44   3e-04
YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine prot...    44   3e-04
Scas_544.6                                                             44   3e-04
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    44   3e-04
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...    44   3e-04
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    44   3e-04
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    43   3e-04
Scas_477.5                                                             44   3e-04
Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement       43   3e-04
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...    44   4e-04
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    43   4e-04
CAGL0K01815g 162144..163658 similar to sp|P06243 Saccharomyces c...    43   4e-04
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...    44   4e-04
CAGL0M08316g 829069..831963 weakly similar to sp|P36003 Saccharo...    44   4e-04
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...    43   4e-04
KLLA0F02838g 264329..266596 some similarities with sp|P32581 Sac...    43   4e-04
YOR351C (MEK1) [5128] chr15 complement(995013..996506) Serine/th...    43   4e-04
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    43   5e-04
YPL031C (PHO85) [5407] chr16 complement(492014..492914,493017..4...    42   5e-04
YKL048C (ELM1) [3211] chr11 complement(346859..348781) Serine/th...    43   5e-04
KLLA0D13266g complement(1137750..1141208) similar to sp|P32361 S...    43   5e-04
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    43   5e-04
Kwal_23.6458                                                           43   5e-04
Kwal_33.13112                                                          43   5e-04
Scas_640.14*                                                           43   6e-04
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    43   6e-04
Sklu_1995.2 YLR362W, Contig c1995 1578-3767                            43   6e-04
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    43   6e-04
Kwal_23.3590                                                           42   6e-04
Kwal_14.1249                                                           42   7e-04
Scas_718.72                                                            42   7e-04
Kwal_56.22788                                                          42   7e-04
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...    42   7e-04
Scas_598.6                                                             42   8e-04
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...    42   8e-04
Scas_713.21                                                            42   8e-04
Kwal_56.24584                                                          42   9e-04
YNL020C (ARK1) [4567] chr14 complement(595621..597537) Serine/th...    42   0.001
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....    42   0.001
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...    42   0.001
Kwal_14.1416                                                           42   0.001
YPR111W (DBF20) [5532] chr16 (747302..748996) Cell cycle protein...    42   0.001
Sklu_2401.9 YGR092W, Contig c2401 17788-19521                          42   0.001
Kwal_23.3992                                                           42   0.001
Kwal_26.7276                                                           42   0.001
Sklu_1603.2 YPR054W, Contig c1603 1858-3324 reverse complement         42   0.001
YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase ...    42   0.001
Scas_623.11                                                            42   0.001
Scas_671.16                                                            42   0.001
KLLA0F22297g complement(2083448..2085547) some similarities with...    42   0.001
Sklu_2255.4 YGR040W, Contig c2255 6834-7940 reverse complement         41   0.001
Sklu_1851.1 YJL106W, Contig c1851 2732-4783 reverse complement         42   0.001
Scas_720.103                                                           42   0.001
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...    42   0.001
Kwal_27.10581                                                          42   0.002
Kwal_33.14192                                                          41   0.002
YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine pro...    41   0.002
Kwal_47.17868                                                          41   0.002
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...    41   0.002
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    41   0.002
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    41   0.002
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...    41   0.002
Scas_667.18                                                            41   0.002
YOL128C (YGK3) [4695] chr15 complement(78351..79478) Member of t...    41   0.002
Sklu_2211.5 YBL105C, Contig c2211 10237-13764                          41   0.002
Scas_700.34                                                            41   0.002
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...    41   0.002
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...    41   0.002
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    41   0.002
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...    40   0.002
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...    41   0.002
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    40   0.003
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...    40   0.003
Scas_568.9*                                                            40   0.003
Scas_693.17                                                            41   0.003
CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces c...    40   0.003
Scas_602.11                                                            41   0.003
Sklu_2186.4 YHR030C, Contig c2186 5713-7278 reverse complement         40   0.003
Kwal_26.9032                                                           40   0.003
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...    40   0.003
AEL173W [2333] [Homologous to ScYJL057C (IKS1) - SH] complement(...    40   0.003
Kwal_27.11542                                                          40   0.003
Scas_629.16                                                            40   0.003
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...    40   0.003
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...    40   0.003
Sklu_2277.8 YOR267C, Contig c2277 9591-11441 reverse complement        40   0.003
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    40   0.004
KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces...    40   0.004
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...    40   0.004
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    40   0.004
Scas_707.36                                                            40   0.004
Kwal_55.21900                                                          40   0.004
CAGL0K11275g 1093797..1095374 similar to tr|Q03785 Saccharomyces...    40   0.004
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...    40   0.004
Kwal_47.17345                                                          40   0.004
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    40   0.005
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...    39   0.005
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    40   0.005
YMR216C (SKY1) [4172] chr13 complement(698810..701038) Serine/th...    40   0.005
YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine...    40   0.006
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...    39   0.006
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...    39   0.006
Scas_705.23                                                            39   0.006
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...    40   0.006
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    39   0.006
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...    39   0.006
YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine pr...    39   0.007
AEL179W [2327] [Homologous to NOHBY] complement(302948..303817) ...    39   0.007
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    39   0.007
Kwal_17.2687                                                           39   0.007
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...    39   0.007
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    39   0.007
ADR293C [2034] [Homologous to ScYHR079C (IRE1) - SH] (1207023..1...    39   0.007
Scas_685.24                                                            39   0.007
Scas_721.132                                                           39   0.007
CAGL0K01661g complement(146952..148400) some similarities with t...    39   0.007
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....    39   0.008
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    39   0.008
Kwal_56.23841                                                          39   0.008
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    39   0.008
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    39   0.009
Sklu_2442.21 YLR248W, Contig c2442 39541-41052 reverse complement      39   0.009
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...    39   0.009
Kwal_55.22001                                                          39   0.009
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...    39   0.009
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...    39   0.010
Scas_336.1                                                             39   0.010
Kwal_23.5668                                                           39   0.010
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...    39   0.010
Scas_715.34                                                            39   0.010
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...    39   0.010
Scas_718.90                                                            39   0.010
Sklu_1477.2 YKL116C, Contig c1477 684-2414 reverse complement          39   0.011
YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine pr...    39   0.011
Kwal_47.17252                                                          39   0.011
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    39   0.012
Kwal_56.23717                                                          39   0.012
KLLA0C16577g complement(1451181..1452695) some similarities with...    39   0.012
YDL017W (CDC7) [843] chr4 (424206..425729) Protein kinase that a...    39   0.012
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    38   0.012
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    39   0.012
YFL029C (CAK1) [1654] chr6 complement(78053..79159) Cdk-activati...    38   0.013
Scas_677.18                                                            39   0.013
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...    39   0.013
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...    39   0.013
Scas_584.11                                                            39   0.013
Kwal_26.7552                                                           38   0.014
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...    38   0.014
KLLA0E11979g complement(1060048..1061892) some similarities with...    38   0.014
Scas_707.34                                                            39   0.015
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    38   0.015
Kwal_47.17263                                                          39   0.015
Scas_649.30                                                            38   0.016
KLLA0C03938g complement(358851..360632) some similarities with s...    38   0.016
YOR267C (HRK1) [5054] chr15 complement(822585..824864) Serine/th...    38   0.017
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    38   0.017
YBR059C (AKL1) [250] chr2 complement(356821..360147) Serine/thre...    38   0.017
Sklu_2354.4 YNL307C, Contig c2354 4429-5520 reverse complement         38   0.017
Scas_703.47                                                            38   0.017
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    38   0.018
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...    38   0.018
Scas_683.6                                                             38   0.018
Sklu_2226.7 YIL095W, Contig c2226 8986-11373                           38   0.019
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    38   0.020
YPR161C (SGV1) [5576] chr16 complement(864443..866416) Serine/th...    38   0.020
Scas_713.7                                                             38   0.020
KLLA0D09328g complement(788565..791705) some similarities with s...    38   0.022
Kwal_26.7682                                                           37   0.023
Scas_584.8                                                             38   0.026
AER216C [2718] [Homologous to ScYDL017W (CDC7) - SH] (1032840..1...    37   0.026
Scas_619.5*                                                            37   0.026
KLLA0D12100g complement(1031728..1033161) some similarities with...    37   0.027
Kwal_23.4276                                                           37   0.027
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...    37   0.028
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    37   0.028
YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine...    37   0.029
Kwal_0.155                                                             37   0.029
YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine pro...    37   0.029
Scas_610.7                                                             37   0.029
Kwal_33.14167                                                          37   0.030
CAGL0J05082g 481179..483140 similar to sp|P47042 Saccharomyces c...    37   0.031
ADL043C [1698] [Homologous to ScYLL019C (KNS1) - SH] (612091..61...    37   0.032
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...    37   0.035
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...    37   0.036
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    37   0.042
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    37   0.042
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    36   0.044
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...    37   0.045
Scas_721.61                                                            37   0.045
KLLA0C04345g 397899..399326 similar to sp|P06243 Saccharomyces c...    37   0.046
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...    37   0.046
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    37   0.048
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...    36   0.050
YGR188C (BUB1) [2139] chr7 complement(872047..875112) Serine/thr...    37   0.052
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    37   0.055
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...    36   0.056
Sklu_2073.3 YER129W, Contig c2073 2194-5742                            37   0.056
YLL019C (KNS1) [3399] chr12 complement(105685..107898) Serine/th...    36   0.058
CAGL0D06600g 626571..628748 similar to tr|Q12399 Saccharomyces c...    36   0.059
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...    36   0.061
Kwal_27.9763                                                           36   0.062
Scas_695.33                                                            36   0.062
Scas_635.1                                                             36   0.065
KLLA0F18612g 1711131..1713575 some similarities with sp|P38080 S...    36   0.067
Kwal_23.3471                                                           35   0.067
Kwal_27.10004                                                          36   0.074
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    36   0.075
KLLA0F22605g complement(2109034..2111913) similar to sp|P41695 S...    36   0.078
CAGL0H10208g complement(996853..999936) similar to sp|P38080 Sac...    36   0.080
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    36   0.084
Scas_568.13                                                            35   0.095
CAGL0B03509g complement(349638..351431) similar to sp|P38623 Sac...    35   0.098
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...    36   0.10 
Kwal_23.5576                                                           35   0.10 
Kwal_55.20189                                                          35   0.10 
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    35   0.10 
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    35   0.11 
CAGL0H01837g complement(176352..178736) tr|Q9C1R8 Candida glabra...    35   0.11 
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    35   0.11 
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    35   0.11 
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...    35   0.11 
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    35   0.12 
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...    35   0.12 
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    35   0.12 
Kwal_0.307                                                             35   0.13 
Sklu_1883.2 YKL171W, Contig c1883 1300-4338                            35   0.13 
Kwal_27.11777                                                          35   0.13 
Scas_707.7                                                             35   0.14 
Kwal_27.11803                                                          34   0.15 
YDR247W (VHS1) [1081] chr4 (956005..957390) Serine/threonine pro...    35   0.15 
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    35   0.15 
Kwal_27.12559                                                          35   0.16 
CAGL0G03047g 282299..283918 highly similar to sp|P22204 Saccharo...    35   0.17 
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...    35   0.17 
Scas_653.33                                                            35   0.18 
Scas_573.10                                                            35   0.18 
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    35   0.18 
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...    35   0.18 
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...    35   0.18 
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    35   0.18 
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    35   0.19 
Scas_548.6                                                             35   0.21 
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...    34   0.22 
Scas_689.24                                                            34   0.24 
Scas_678.24                                                            35   0.24 
Scas_688.14                                                            34   0.24 
Kwal_56.22476                                                          34   0.24 
YKL116C (PRR1) [3148] chr11 complement(220990..222546) Serine/th...    34   0.26 
Scas_710.28                                                            34   0.26 
Sklu_1752.2 YBR059C, Contig c1752 577-3153 reverse complement          34   0.27 
AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH] (1043479..1...    34   0.29 
Kwal_26.8941                                                           34   0.29 
Scas_692.24                                                            34   0.30 
AER348C [2849] [Homologous to ScYMR216C (SKY1) - SH] (1275897..1...    34   0.31 
YKL139W (CTK1) [3128] chr11 (182963..184549) C-terminal domain (...    34   0.31 
AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W (R...    34   0.31 
ADR163W [1905] [Homologous to ScYDR247W - SH; ScYPL026C (SKS1) -...    34   0.33 
CAGL0M08360g complement(833220..835520) some similarities with s...    34   0.33 
Sklu_1987.1 YBL016W, Contig c1987 623-1996                             34   0.33 
Scas_493.2                                                             34   0.34 
Scas_618.15                                                            34   0.35 

>Kwal_33.14596
          Length = 500

 Score =  783 bits (2021), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/485 (80%), Positives = 392/485 (80%)

Query: 1   MNSTXXXXXXXXXXXXXXXXXREDSTIVGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAI 60
           MNST                 REDSTIVGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAI
Sbjct: 1   MNSTSASASQHALGSSASSSAREDSTIVGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAI 60

Query: 61  KFEPRKSEAPQLKDEYRTYKILAGTAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCG 120
           KFEPRKSEAPQLKDEYRTYKILAGTAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCG
Sbjct: 61  KFEPRKSEAPQLKDEYRTYKILAGTAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCG 120

Query: 121 RRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQ 180
           RRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQ
Sbjct: 121 RRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQ 180

Query: 181 YRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG 240
           YRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG
Sbjct: 181 YRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG 240

Query: 241 LKAPNNKQKYEKIGEKKRVTNVYDLAQGLPVQFGRYLEVVRSLAFEETPDYEGYRKLFLS 300
           LKAPNNKQKYEKIGEKKRVTNVYDLAQGLPVQFGRYLEVVRSLAFEETPDYEGYRKLFLS
Sbjct: 241 LKAPNNKQKYEKIGEKKRVTNVYDLAQGLPVQFGRYLEVVRSLAFEETPDYEGYRKLFLS 300

Query: 301 ILDDMDNQADGEYDWMKLNGGRGWDLNINKKPNLHGYGHPNPPNDKNRRHRSKYAQGQGM 360
           ILDDMDNQADGEYDWMKLNGGRGWDLNINKKPNLHGYGHPNPPNDKNRRHRSKYAQGQGM
Sbjct: 301 ILDDMDNQADGEYDWMKLNGGRGWDLNINKKPNLHGYGHPNPPNDKNRRHRSKYAQGQGM 360

Query: 361 DPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDP 420
           DP                                                        DP
Sbjct: 361 DPQQQLRYQQQQLLHQQQQQQQQQQQQQQQQRQQQQQQQQQQQQQQQQLQQQALQQRLDP 420

Query: 421 TSYEXXXXXXXXXXXXXXXXXXXXGRSNYNQHASQQNANLYGAQQPPTVKPHAQPSNKVA 480
           TSYE                    GRSNYNQHASQQNANLYGAQQPPTVKPHAQPSNKVA
Sbjct: 421 TSYEAYQQQTQQKYAQQQQKLQQQGRSNYNQHASQQNANLYGAQQPPTVKPHAQPSNKVA 480

Query: 481 AADGR 485
           AADGR
Sbjct: 481 AADGR 485

>YNL154C (YCK2) [4443] chr14 complement(343636..345276) Casein
           kinase I isoform [1641 bp, 546 aa]
          Length = 546

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/335 (91%), Positives = 323/335 (96%)

Query: 22  REDSTIVGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKI 81
           R+DSTIVGLHY+IGKKIGEGSFGVLFEGTNMING+PVAIKFEPRK+EAPQLKDEYRTYKI
Sbjct: 66  RDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKI 125

Query: 82  LAGTAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED 141
           LAGT GIPQ YYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED
Sbjct: 126 LAGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED 185

Query: 142 LHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 201
           LH HDLIYRDIKPDNFLIGRPG PD NKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT
Sbjct: 186 LHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 245

Query: 202 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTN 261
           ARYMSINTHLGREQSRRDDMEA+GHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKR+TN
Sbjct: 246 ARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTN 305

Query: 262 VYDLAQGLPVQFGRYLEVVRSLAFEETPDYEGYRKLFLSILDDMDNQADGEYDWMKLNGG 321
           VYDLAQGLP+QFGRYLE+VR+L+FEETPDYEGYR L LS+LDD+   ADG+YDWMKLNGG
Sbjct: 306 VYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYDWMKLNGG 365

Query: 322 RGWDLNINKKPNLHGYGHPNPPNDKNRRHRSKYAQ 356
           RGWDL+INKKPNLHGYGHPNPPN+K++RHRSK  Q
Sbjct: 366 RGWDLSINKKPNLHGYGHPNPPNEKSKRHRSKNHQ 400

>CAGL0G06138g complement(585585..587204) similar to sp|P23291
           Saccharomyces cerevisiae YHR135c YCK1, start by
           similarity
          Length = 539

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/332 (90%), Positives = 320/332 (96%), Gaps = 1/332 (0%)

Query: 22  REDSTIVGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKI 81
           R+DSTIVGLHY+IGKKIGEGSFGVLFEGTNMING+PVAIKFEPRK+EAPQLKDEYRTYKI
Sbjct: 51  RDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKI 110

Query: 82  LAGTAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED 141
           +AGT  +PQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR+FSVKTVVQVAVQMITLIED
Sbjct: 111 MAGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIED 170

Query: 142 LHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 201
           LH HDLIYRDIKPDNFLIGRPG PDENK+HLIDFGMAKQYRDPKTKQHIPYRE+KSLSGT
Sbjct: 171 LHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGT 230

Query: 202 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTN 261
           ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKR TN
Sbjct: 231 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTN 290

Query: 262 VYDLAQGLPVQFGRYLEVVRSLAFEETPDYEGYRKLFLSILDDMDNQADGEYDWMKLNGG 321
           VYDL+ G PVQFGRYLE+VRSL+FEETPDY+GYRKL LS+LDDM++ ADG YDWMKLNGG
Sbjct: 291 VYDLSNGYPVQFGRYLEIVRSLSFEETPDYQGYRKLLLSVLDDMNDSADGTYDWMKLNGG 350

Query: 322 RGWDLNINKKPNLHGYGHPNPPNDKNRRHRSK 353
           RGWDL INKKPNLHGYGHPNPPNDK RRH++K
Sbjct: 351 RGWDLTINKKPNLHGYGHPNPPNDK-RRHKNK 381

>Scas_654.17
          Length = 523

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/332 (90%), Positives = 317/332 (95%)

Query: 22  REDSTIVGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKI 81
           R+DSTIVGLHY+IGKKIGEGSFGVLFEGTNMING+PVAIKFEPRK+EAPQLKDEYRTYKI
Sbjct: 60  RDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKI 119

Query: 82  LAGTAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED 141
           L GT G+PQAYYFGQEGLHNILVIDLLGPSLEDLFDWC R+FSVKTVVQVAVQMITLIED
Sbjct: 120 LTGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIED 179

Query: 142 LHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 201
           LH HDLIYRDIKPDNFL+GRPG  D NK+HLIDFGMAKQYRDPKTKQHIPYREKKSLSGT
Sbjct: 180 LHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 239

Query: 202 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTN 261
           ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKR TN
Sbjct: 240 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTN 299

Query: 262 VYDLAQGLPVQFGRYLEVVRSLAFEETPDYEGYRKLFLSILDDMDNQADGEYDWMKLNGG 321
           VYDLAQGLP+QFGRYLE+VR+L+FEETPDYEGYR L LS LDD+   ADGEYDWMKLNGG
Sbjct: 300 VYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSALDDLGQSADGEYDWMKLNGG 359

Query: 322 RGWDLNINKKPNLHGYGHPNPPNDKNRRHRSK 353
           RGWDL INKKPNLHGYGHPNPPN+K++RHR+K
Sbjct: 360 RGWDLAINKKPNLHGYGHPNPPNEKSKRHRNK 391

>AFR040W [3232] [Homologous to ScYHR135C (YCK1) - SH; ScYNL154C
           (YCK2) - SH] complement(505602..507245) [1644 bp, 547
           aa]
          Length = 547

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/335 (90%), Positives = 320/335 (95%)

Query: 22  REDSTIVGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKI 81
           R+D+TIVGLH++IGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRK+EAPQLKDEYRTYKI
Sbjct: 59  RDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKI 118

Query: 82  LAGTAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED 141
           LAGT+G+PQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED
Sbjct: 119 LAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED 178

Query: 142 LHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 201
           LH HDLIYRDIKPDNFLIGRP  PD NKVHLIDFGMAK YRDPKTKQHIPYREKKSLSGT
Sbjct: 179 LHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGT 238

Query: 202 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTN 261
           ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKR TN
Sbjct: 239 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRSTN 298

Query: 262 VYDLAQGLPVQFGRYLEVVRSLAFEETPDYEGYRKLFLSILDDMDNQADGEYDWMKLNGG 321
           VYDL+QGLPVQFGRYLE+VR+L FEETPDY+GYRKL LS L+++  + DGEYDWMKLNGG
Sbjct: 299 VYDLSQGLPVQFGRYLEIVRNLGFEETPDYDGYRKLLLSTLEELGLEYDGEYDWMKLNGG 358

Query: 322 RGWDLNINKKPNLHGYGHPNPPNDKNRRHRSKYAQ 356
           RGWDL INKKPNLHGYGHPNPPN+K RRHRSKY Q
Sbjct: 359 RGWDLTINKKPNLHGYGHPNPPNEKGRRHRSKYPQ 393

>YHR135C (YCK1) [2422] chr8 complement(372695..374311) Casein kinase
           I isoform [1617 bp, 538 aa]
          Length = 538

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/332 (90%), Positives = 316/332 (95%)

Query: 22  REDSTIVGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKI 81
           R+DSTIVGLHY+IGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRK+EAPQL+DEY+TYKI
Sbjct: 59  RDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKI 118

Query: 82  LAGTAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED 141
           L GT  IP AYYFGQEGLHNILVIDLLGPSLEDLFDWCGR+FSVKTVVQVAVQMITLIED
Sbjct: 119 LNGTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIED 178

Query: 142 LHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 201
           LH HDLIYRDIKPDNFLIGRPG PD N +HLIDFGMAKQYRDPKTKQHIPYREKKSLSGT
Sbjct: 179 LHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 238

Query: 202 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTN 261
           ARYMSINTHLGREQSRRDDMEALGHVFFYFLRG LPWQGLKAPNNKQKYEKIGEKKR TN
Sbjct: 239 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTN 298

Query: 262 VYDLAQGLPVQFGRYLEVVRSLAFEETPDYEGYRKLFLSILDDMDNQADGEYDWMKLNGG 321
           VYDLAQGLPVQFGRYLE+VRSL+FEE PDYEGYRKL LS+LDD+   ADG+YDWMKLN G
Sbjct: 299 VYDLAQGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKLNDG 358

Query: 322 RGWDLNINKKPNLHGYGHPNPPNDKNRRHRSK 353
           RGWDLNINKKPNLHGYGHPNPPN+K+R+HR+K
Sbjct: 359 RGWDLNINKKPNLHGYGHPNPPNEKSRKHRNK 390

>KLLA0D11044g complement(942458..944068)
           gi|730472|sp|P40230|RAG8_KLULA Kluyveromyces lactis
           CASEIN KINASE I HOMOLOG RAG8, start by similarity
          Length = 536

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/335 (87%), Positives = 314/335 (93%)

Query: 22  REDSTIVGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKI 81
           R+DSTIVGLHY+IGKKIGEGSFGVLFEG NMIN VPVAIKFEPRK++APQLKDEYRTYKI
Sbjct: 67  RDDSTIVGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKI 126

Query: 82  LAGTAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED 141
           L+G+ GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFS+KTVV VA+QMITLIE+
Sbjct: 127 LSGSEGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEE 186

Query: 142 LHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 201
           LH HDLIYRDIKPDNFLIGRP  PD N VHLIDFGMAK YRDPKTKQHIPYREKKSLSGT
Sbjct: 187 LHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGT 246

Query: 202 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTN 261
           ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA NNK KYEKIGEKKR TN
Sbjct: 247 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKKRSTN 306

Query: 262 VYDLAQGLPVQFGRYLEVVRSLAFEETPDYEGYRKLFLSILDDMDNQADGEYDWMKLNGG 321
           VYDL+QGLPVQFGRYLE+VR+L FEETPDYEGYRKL LS+LD++  + DGEYDWMKLNGG
Sbjct: 307 VYDLSQGLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVLDELGQKLDGEYDWMKLNGG 366

Query: 322 RGWDLNINKKPNLHGYGHPNPPNDKNRRHRSKYAQ 356
           RGWDL INKKPNLHGYGHP PPN+K++RHR+K+ Q
Sbjct: 367 RGWDLAINKKPNLHGYGHPTPPNEKSKRHRNKFNQ 401

>Scas_697.12
          Length = 529

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/330 (90%), Positives = 312/330 (94%)

Query: 23  EDSTIVGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKIL 82
           ++STIVGLHYRIGKKIGEGSFGVLFEG NMING PVAIKFEPRK+EAPQLKDEYRTYKIL
Sbjct: 39  DNSTIVGLHYRIGKKIGEGSFGVLFEGINMINGTPVAIKFEPRKTEAPQLKDEYRTYKIL 98

Query: 83  AGTAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDL 142
           AGT  IP AYYFGQEGLHNILVIDLLGPSLEDLFDWC RRFSVKTVVQVAVQMITLIEDL
Sbjct: 99  AGTPNIPLAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRRFSVKTVVQVAVQMITLIEDL 158

Query: 143 HTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 202
           H +DLIYRDIKPDNFLIGRPG PDEN +HLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA
Sbjct: 159 HANDLIYRDIKPDNFLIGRPGQPDENFIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 218

Query: 203 RYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTNV 262
           RYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYE+IGEKKR TNV
Sbjct: 219 RYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYERIGEKKRTTNV 278

Query: 263 YDLAQGLPVQFGRYLEVVRSLAFEETPDYEGYRKLFLSILDDMDNQADGEYDWMKLNGGR 322
           YDLAQGLPVQF RYLEVVR+L+FEETPDY GYR+L LS LDD+   ADGEYDWMKLNGG+
Sbjct: 279 YDLAQGLPVQFARYLEVVRNLSFEETPDYRGYRELLLSSLDDLGQSADGEYDWMKLNGGK 338

Query: 323 GWDLNINKKPNLHGYGHPNPPNDKNRRHRS 352
           GWDLNINKKPNLHGYGHP PPN+K+RRHR+
Sbjct: 339 GWDLNINKKPNLHGYGHPTPPNEKSRRHRT 368

>CAGL0J05940g 560563..562023 similar to sp|P23291 Saccharomyces
           cerevisiae YHR135c YCK1 or sp|P23292 Saccharomyces
           cerevisiae YNL154c YCK2, hypothetical start
          Length = 486

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/345 (83%), Positives = 311/345 (90%), Gaps = 8/345 (2%)

Query: 26  TIVGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGT 85
           TI GLHY+IGKKIGEGSFGVLFEGTN+ING+PVA+KFEPRK+EAPQLKDEYRTYKILAGT
Sbjct: 35  TIAGLHYQIGKKIGEGSFGVLFEGTNIINGMPVAVKFEPRKTEAPQLKDEYRTYKILAGT 94

Query: 86  AGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTH 145
            G+PQAYYFGQEGLHNILV+DLLGPSLEDLFDWCGR+FS KTVVQVAVQMITLIEDLH H
Sbjct: 95  PGVPQAYYFGQEGLHNILVMDLLGPSLEDLFDWCGRQFSPKTVVQVAVQMITLIEDLHAH 154

Query: 146 DLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 205
           DLIYRDIKPDNFL+GRPG PDEN +HLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM
Sbjct: 155 DLIYRDIKPDNFLVGRPGQPDENNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 214

Query: 206 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTNVYDL 265
           SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYE+IGEKKR T+VYDL
Sbjct: 215 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYERIGEKKRTTDVYDL 274

Query: 266 AQGLPVQFGRYLEVVRSLAFEETPDYEGYRKLFLSILDDMDNQADGEYDWMKLNGGRGWD 325
           A G PVQF RYLE+VR+L F+ETPDYEGYRKL  S LDD+    DG+YDWM+LNGGRGWD
Sbjct: 275 ANGYPVQFARYLEIVRNLGFDETPDYEGYRKLLASALDDIGETMDGKYDWMELNGGRGWD 334

Query: 326 LNINKKPNLHGYGHPNPPNDKNRRHRSKYAQGQ--------GMDP 362
           L INKKPNLHGYGHPNPP DK+ R+R+    G         G+DP
Sbjct: 335 LTINKKPNLHGYGHPNPPGDKSHRNRNAAKGGNHANDANHGGLDP 379

>Scas_627.4
          Length = 475

 Score =  454 bits (1169), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 217/336 (64%), Positives = 256/336 (76%), Gaps = 18/336 (5%)

Query: 27  IVGLHYRIGKKIGEGSFGVLFEGTNMINGV---PVAIKFEPRKSEAPQLKDEYRTYKILA 83
           IVG+HY +G KIGEGSFGV+FEG N++      PVAIKFEPR S+APQL+DE+R+YKIL 
Sbjct: 10  IVGIHYAVGPKIGEGSFGVIFEGENLLKDASNEPVAIKFEPRHSDAPQLRDEFRSYKILN 69

Query: 84  GTAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLH 143
              GIP  YYFGQEG+HNIL+IDLLGPSLEDLF+WCGRRFS+KT   +A QMI  I+D+H
Sbjct: 70  NCTGIPHVYYFGQEGMHNILIIDLLGPSLEDLFEWCGRRFSIKTTCMIAKQMIRRIKDIH 129

Query: 144 THDLIYRDIKPDNFLIG---RPGT----------PDENKVHLIDFGMAKQYRDPKTKQHI 190
            HDLIYRDIKPDNFLI    R G+           D N ++L+DFGMAKQ+RDP++KQHI
Sbjct: 130 NHDLIYRDIKPDNFLISQYQRIGSNEKCINSNAHADPNLIYLVDFGMAKQFRDPRSKQHI 189

Query: 191 PYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKY 250
           PYRE+KSLSGTARYMSINTH GREQSRRDD+E+LGHVFFYFLRG LPWQGLKA NNK KY
Sbjct: 190 PYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQGLKAANNKLKY 249

Query: 251 EKIGEKKRVTNVYDLAQG--LPVQFGRYLEVVRSLAFEETPDYEGYRKLFLSILDDMDNQ 308
           EKIG  K+  N  DL     +P QF  YL+  RSL FE+ PDY+    L    L++++  
Sbjct: 250 EKIGLTKQKLNPDDLLMNNHIPKQFATYLKYARSLKFEQDPDYDYLVSLMDDTLNELNLV 309

Query: 309 ADGEYDWMKLNGGRGWDLNINKKPNLHGYGHPNPPN 344
            DG YDWM LN G+GWD+ INK+ NLHGYG+PNP N
Sbjct: 310 DDGHYDWMDLNDGKGWDIKINKRTNLHGYGNPNPRN 345

>YER123W (YCK3) [1553] chr5 (404809..406383) Casein kinase I
           isoform, plasma membrane-bound [1575 bp, 524 aa]
          Length = 524

 Score =  452 bits (1162), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 218/360 (60%), Positives = 258/360 (71%), Gaps = 43/360 (11%)

Query: 22  REDSTIVGLHYRIGKKIGEGSFGVLFEGTNMINGV-----------------PVAIKFEP 64
           R    IVG+HY +G KIGEGSFGV+FEG N+++                   PVAIKFEP
Sbjct: 4   RSSQHIVGIHYAVGPKIGEGSFGVIFEGENILHSCQAQTGSKRDSSIIMANEPVAIKFEP 63

Query: 65  RKSEAPQLKDEYRTYKILAGTAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFS 124
           R S+APQL+DE+R Y+IL G  GIP AYYFGQEG+HNIL+IDLLGPSLEDLF+WCGR+FS
Sbjct: 64  RHSDAPQLRDEFRAYRILNGCVGIPHAYYFGQEGMHNILIIDLLGPSLEDLFEWCGRKFS 123

Query: 125 VKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGR----------------PGTPDEN 168
           VKT   VA QMI  +  +H HDLIYRDIKPDNFLI +                    D N
Sbjct: 124 VKTTCMVAKQMIDRVRAIHDHDLIYRDIKPDNFLISQYQRISPEGKVIKSCASSSNNDPN 183

Query: 169 KVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVF 228
            ++++DFGMAKQYRDP+TKQHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E+LGHVF
Sbjct: 184 LIYMVDFGMAKQYRDPRTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVF 243

Query: 229 FYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTNVYDLA--QGLPVQFGRYLEVVRSLAFE 286
           FYFLRG LPWQGLKAPNNK KYEKIG  K+  N  DL     +P QF  YL+  RSL F+
Sbjct: 244 FYFLRGSLPWQGLKAPNNKLKYEKIGMTKQKLNPDDLLLNNAIPYQFATYLKYARSLKFD 303

Query: 287 ETPDYEGYRKLFLSILDDM----DNQADGEYDWMKLNGGRGWDLNINKKPNLHGYGHPNP 342
           E PDY+      +S++DD     D + DG YDWM LNGG+GW++ IN++ NLHGYG+PNP
Sbjct: 304 EDPDYD----YLISLMDDALRLNDLKDDGHYDWMDLNGGKGWNIKINRRANLHGYGNPNP 359

>ADL053C [1688] [Homologous to ScYER123W (YCK3) - SH]
           (589602..591017) [1416 bp, 471 aa]
          Length = 471

 Score =  446 bits (1146), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 214/346 (61%), Positives = 260/346 (75%), Gaps = 22/346 (6%)

Query: 22  REDSTIVGLHYRIGKKIGEGSFGVLFEGTNMING-----VPVAIKFEPRKSEAPQLKDEY 76
           R    +VG+HY +G KIGEGSFG++FEG NM+ G      PVAIKFEPR+S+APQL+DE+
Sbjct: 4   RGSQHVVGIHYAVGPKIGEGSFGIIFEGENMMEGGDAGRRPVAIKFEPRRSDAPQLRDEF 63

Query: 77  RTYKILAGTAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMI 136
           R Y+IL G  GIP+AYYFGQEG+HNIL+IDLLGPSLEDLF+WCGRRFSVKT   +A QMI
Sbjct: 64  RAYRILNGVRGIPRAYYFGQEGVHNILIIDLLGPSLEDLFEWCGRRFSVKTTCMLAKQMI 123

Query: 137 TLIEDLHTHDLIYRDIKPDNFLI--------------GRPGTP--DENKVHLIDFGMAKQ 180
             +  +H  DLIYRDIKPDNFLI              G   T   D N ++++DFGMAKQ
Sbjct: 124 ERVRAIHGRDLIYRDIKPDNFLISEFQREVAAGEVVRGCAATAGGDANLIYVVDFGMAKQ 183

Query: 181 YRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG 240
           YRDPKTKQHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E+LGHVFFYFLRG LPWQG
Sbjct: 184 YRDPKTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQG 243

Query: 241 LKAPNNKQKYEKIGEKKRVTNVYDL-AQGLPVQFGRYLEVVRSLAFEETPDYEGYRKLFL 299
           LKAPNNK KYEKIG  K+     +L ++ +PVQF  YL+  RSL F+E PDY+    L  
Sbjct: 244 LKAPNNKAKYEKIGLTKQKLKPEELISENIPVQFAEYLKYCRSLRFDEEPDYDYLISLMD 303

Query: 300 SILDDMDNQADGEYDWMKLNGGRGWDLNINKKPNLHGYGHPNPPND 345
           S++ D++ + +  YDWM LN   GW++ +NK+ NLHGYG+P+P N+
Sbjct: 304 SVMHDLNIEDNQHYDWMDLNNHTGWNIAVNKRANLHGYGNPHPRNN 349

>Kwal_47.17314
          Length = 421

 Score =  436 bits (1122), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 213/361 (59%), Positives = 257/361 (71%), Gaps = 29/361 (8%)

Query: 27  IVGLHYRIGKKIGEGSFGVLFEGTNMIN--GVPVAIKFEPRKSEAPQLKDEYRTYKILAG 84
           IVG+HY +G KIGEGSFGV+FEG N++N    PVAIKFEPR++EAPQL+DE+R YKIL G
Sbjct: 8   IVGIHYAVGPKIGEGSFGVIFEGENVLNNSSSPVAIKFEPRRTEAPQLRDEFRAYKILNG 67

Query: 85  TAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHT 144
             GIP+A+YFGQEG+HN+L+IDLLGPSLEDLF+WCGRRFSVKT   +A QMI  ++ +H 
Sbjct: 68  LEGIPKAFYFGQEGMHNVLIIDLLGPSLEDLFEWCGRRFSVKTTCLLAKQMIRRVQSIHQ 127

Query: 145 HDLIYRDIKPDNFLIGR------------------PGTPDENKVHLIDFGMAKQYRDPKT 186
            DLIYRDIKPDNFLI                     G P  N V+++DFGMAKQYRDPKT
Sbjct: 128 RDLIYRDIKPDNFLIAEYQRELPNGQLVKNCATSAHGNP--NLVYVVDFGMAKQYRDPKT 185

Query: 187 KQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNN 246
           KQHIPY+E+KSLSGTARYMSINTH GREQSRRDD+E+LGHVFFYFLRG LPWQGLK  N 
Sbjct: 186 KQHIPYKERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGFLPWQGLKVANT 245

Query: 247 KQKYEKIGEKKRVTNVYDLAQ-GLPVQFGRYLEVVRSLAFEETPDYEGYRKLFLSILDDM 305
           K KYEKIG  K+     DL +  +P QF  YL   RSL FEE PDY+    L    L + 
Sbjct: 246 KLKYEKIGLTKQKVRPEDLLERNIPTQFATYLTYCRSLRFEEEPDYDFLVSLMTQALQER 305

Query: 306 DNQADGEYDWMKLNGGRGWDLNINKKPNLHGYGHPNPPNDKN------RRHRSKYAQGQG 359
             + D  YDW+ LN G+GW++ +N++ NLHGYG+P P   +       R HR  Y++ Q 
Sbjct: 306 GYEEDDHYDWLDLNQGQGWNIFVNRRANLHGYGNPTPKTSQAARKSAPRAHRDSYSKAQR 365

Query: 360 M 360
           +
Sbjct: 366 L 366

>KLLA0E13563g 1193481..1194902 some similarities with sp|P39962
           Saccharomyces cerevisiae YER123w YCK3 casein kinase,
           isoform 3, hypothetical start
          Length = 473

 Score =  437 bits (1123), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 208/346 (60%), Positives = 252/346 (72%), Gaps = 20/346 (5%)

Query: 22  REDSTIVGLHYRIGKKIGEGSFGVLFEGTNMING---VPVAIKFEPRKSEAPQLKDEYRT 78
           R    +VG+HY +G KIGEGSFG++FEG N++NG    PVAIKFEPR+S++PQL+DE+R 
Sbjct: 4   RSSQHVVGIHYAVGPKIGEGSFGIIFEGENILNGGSKNPVAIKFEPRRSDSPQLRDEFRA 63

Query: 79  YKILAGTAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITL 138
           Y+IL    GIP AYYF QEG+HNIL+IDLLGPSLEDLF+WC R+FSVKT   +A QMI  
Sbjct: 64  YRILNDVRGIPHAYYFSQEGIHNILIIDLLGPSLEDLFEWCSRKFSVKTTAMLAKQMIDR 123

Query: 139 IEDLHTHDLIYRDIKPDNFLIGR----------------PGTPDENKVHLIDFGMAKQYR 182
           +  +H HDLIYRDIKPDNFLI                      D N ++++DFGMAKQ+R
Sbjct: 124 VRSIHEHDLIYRDIKPDNFLISEFQRELSDGSVVKSCATSSGGDANLIYVVDFGMAKQFR 183

Query: 183 DPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLK 242
           DP TKQHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E+LGHVFFYFLRG LPWQGLK
Sbjct: 184 DPNTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQGLK 243

Query: 243 APNNKQKYEKIG-EKKRVTNVYDLAQGLPVQFGRYLEVVRSLAFEETPDYEGYRKLFLSI 301
           A NNK KYEKIG  K+R+     L   +P QF  YL   RSL F++ PDY+    L   I
Sbjct: 244 ALNNKAKYEKIGLTKQRLKPTDLLTPEIPKQFAEYLSYCRSLRFDQDPDYDYLISLMTQI 303

Query: 302 LDDMDNQADGEYDWMKLNGGRGWDLNINKKPNLHGYGHPNPPNDKN 347
           + +   + DG YDWM LNGG+GW++ +NK+ NLHGYG+P P N K+
Sbjct: 304 MQENGYEEDGHYDWMDLNGGQGWNIKVNKRVNLHGYGNPTPRNTKH 349

>CAGL0K02299g complement(205332..206948) similar to sp|P39962
           Saccharomyces cerevisiae YER123w Casein kinase I,
           hypothetical start
          Length = 538

 Score =  435 bits (1119), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 210/362 (58%), Positives = 252/362 (69%), Gaps = 46/362 (12%)

Query: 27  IVGLHYRIGKKIGEGSFGVLFEGTNMIN---------------------------GVPVA 59
           +VG+HY +G KIGEGSFGV+FEG N++N                           G PVA
Sbjct: 17  VVGMHYAVGPKIGEGSFGVIFEGQNILNSSDGRQGHGSGSGSAHGSGNGNGNSLAGFPVA 76

Query: 60  IKFEPRKSEAPQLKDEYRTYKILAGTAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWC 119
           IKFEPR S+APQL+DE+R Y+IL G+ GIP AYYFGQEG+HN+L+IDLLGPSLEDLF+WC
Sbjct: 77  IKFEPRHSDAPQLRDEFRAYRILNGSKGIPHAYYFGQEGMHNVLIIDLLGPSLEDLFEWC 136

Query: 120 GRRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLI-----------------GRP 162
           GR+FS+KT   +A QMI  +  +H HDLIYRDIKPDNFLI                  + 
Sbjct: 137 GRKFSIKTTCMLAKQMIERVRIIHDHDLIYRDIKPDNFLISEFQKASNNNGECVKYCAQS 196

Query: 163 GTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDME 222
              D N ++++DFGMAKQYRDP+TKQHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E
Sbjct: 197 AGGDPNLIYMVDFGMAKQYRDPRTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLE 256

Query: 223 ALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTNVYD--LAQGLPVQFGRYLEVV 280
           +LGHVFFYFLRG LPWQGLKAPNNK KYEKIG  K+  N  +  L+  +P QF  YL+  
Sbjct: 257 SLGHVFFYFLRGSLPWQGLKAPNNKLKYEKIGLTKQKLNPDELLLSNQIPSQFATYLKYT 316

Query: 281 RSLAFEETPDYEGYRKLFLSILDDMDNQADGEYDWMKLNGGRGWDLNINKKPNLHGYGHP 340
           RSL F+E PDY+    L   +L     + DG YDWM LN G GWD+ +NK+ NLHGYG+ 
Sbjct: 317 RSLKFDEDPDYDYLISLMDGVLLSKGYKDDGHYDWMDLNNGAGWDIRVNKRANLHGYGNA 376

Query: 341 NP 342
            P
Sbjct: 377 QP 378

>Sklu_2359.3 YER123W, Contig c2359 7455-8921 reverse complement
          Length = 488

 Score =  433 bits (1114), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 212/364 (58%), Positives = 256/364 (70%), Gaps = 37/364 (10%)

Query: 22  REDSTIVGLHYRIGKKIGEGSFGVLFEGTNMINGV--------------------PVAIK 61
           R    +VG+HY +G KIGEGSFGV+FEG N++N                      PVAIK
Sbjct: 4   RGSQHVVGIHYAVGPKIGEGSFGVIFEGENILNSNNNNSSNNSSSASTGTANPVDPVAIK 63

Query: 62  FEPRKSEAPQLKDEYRTYKILAGTAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR 121
           FEPR+S+APQL+DE+R Y+IL G  GIP AYYFGQEG+HN+L+IDLLGPSLEDLF+WCG 
Sbjct: 64  FEPRRSDAPQLRDEFRAYRILNGITGIPHAYYFGQEGMHNVLIIDLLGPSLEDLFEWCGH 123

Query: 122 RFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGR----------------PGTP 165
           RFSVKT   VA QMI  +  +H  DLIYRDIKPDNFLI                      
Sbjct: 124 RFSVKTTCMVAKQMIDRVRSIHQRDLIYRDIKPDNFLISEYQRELPTGQILRSCSSSSNG 183

Query: 166 DENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALG 225
           D N ++++DFGMAKQYRDPKTKQHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E+LG
Sbjct: 184 DPNLIYVVDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLG 243

Query: 226 HVFFYFLRGQLPWQGLKAPNNKQKYEKIG-EKKRVTNVYDLAQGLPVQFGRYLEVVRSLA 284
           HVFFYFLRG LPWQGLKAPNNK KYEKIG  K+R++    L+ G+P QF  YL+  R+L 
Sbjct: 244 HVFFYFLRGSLPWQGLKAPNNKLKYEKIGTTKQRLSPEKLLSDGIPEQFATYLKYCRNLK 303

Query: 285 FEETPDYEGYRKLFLSILDDMDNQADGEYDWMKLNGGRGWDLNINKKPNLHGYGHPNPPN 344
           F+E PDY+    L    L+   +  DG YDWM LN G+GW++ +N++ NLHGYG+P P +
Sbjct: 304 FDEDPDYDYLISLMDEALNTSGSVEDGHYDWMDLNQGQGWNIRVNRRANLHGYGNPTPRD 363

Query: 345 DKNR 348
            K +
Sbjct: 364 QKAK 367

>Kwal_56.24064
          Length = 475

 Score =  325 bits (833), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 161/293 (54%), Positives = 206/293 (70%), Gaps = 6/293 (2%)

Query: 28  VGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTAG 87
           VG  YRIG+KIG GSFG ++ GTN+I+G  VAIK E  +S  PQL  E R YK L+G  G
Sbjct: 5   VGRKYRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYKYLSGGIG 64

Query: 88  IPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDL 147
           IP   +FG+EG +N +VIDLLGPSLEDLF++C R+FS KTV+ +A+QMI  I+ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFSFKTVIMLALQMICRIQYIHGRSF 124

Query: 148 IYRDIKPDNFL--IGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 205
           I+RDIKPDNFL  +GR G+     VH+IDFG++K+YRD  T  HIPYRE K+L+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRGS----TVHVIDFGLSKKYRDFSTHHHIPYRENKNLTGTARYA 180

Query: 206 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTNVYDL 265
           S+NTHLG EQSRRDD+E+LG+V  YF +G LPWQGLKA   +QKY++I EKK   NV  L
Sbjct: 181 SVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKRQKYDRIMEKKLCINVEQL 240

Query: 266 AQGLPVQFGRYLEVVRSLAFEETPDYEGYRKLFLSILDDMDNQADGEYDWMKL 318
             GLP++F  Y+   R+L F+E PDY    +LF  +   +D   D  +DW  L
Sbjct: 241 CAGLPMEFVEYMRYCRNLRFDERPDYLYLARLFKDLGIKLDYHNDHLFDWTML 293

>KLLA0D03168g 265761..267278 some similarities with sp|P29295
           Saccharomyces cerevisiae YPL204w HRR25 casein kinase I,
           ser/thr/tyr protein kinase, hypothetical start
          Length = 505

 Score =  326 bits (835), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 157/293 (53%), Positives = 209/293 (71%), Gaps = 6/293 (2%)

Query: 28  VGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTAG 87
           VG  +RIG+KIG GSFG ++ GTN+I+G  VAIK EP +++ PQL  E R YK L+G  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLEPIRTKHPQLDYESRVYKYLSGGIG 64

Query: 88  IPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDL 147
           IP   +FG+EG +N +VIDLLGPSLEDLF++C R+FS KTV+ +A+QMI  I+ +H    
Sbjct: 65  IPFIRWFGKEGEYNAMVIDLLGPSLEDLFNYCHRKFSFKTVIMLALQMICRIQYIHGRSF 124

Query: 148 IYRDIKPDNFL--IGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 205
           I+RDIKPDNFL  +GR G+     VH+IDFG++K+YRD ++  HIPYRE K+L+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRGST----VHVIDFGLSKKYRDFRSHNHIPYRENKNLTGTARYA 180

Query: 206 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTNVYDL 265
           S+NTHLG EQSRRDD+E+LG+V  YF +G LPWQGL+A   +QKY++I EKK    V  L
Sbjct: 181 SVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLRATTKRQKYDRIMEKKLCITVEQL 240

Query: 266 AQGLPVQFGRYLEVVRSLAFEETPDYEGYRKLFLSILDDMDNQADGEYDWMKL 318
            QGLP++F  Y+   R+L F+E PDY    +LF  +   ++   D  +DW  L
Sbjct: 241 CQGLPMEFVEYMRYCRNLRFDERPDYMYLARLFKDLFIKLEYHNDHLFDWTML 293

>CAGL0H03553g complement(328668..330155) highly similar to sp|P29295
           Saccharomyces cerevisiae YPL204w HRR25, start by
           similarity
          Length = 495

 Score =  324 bits (831), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 158/293 (53%), Positives = 207/293 (70%), Gaps = 6/293 (2%)

Query: 28  VGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTAG 87
           VG  +RIG+KIG GSFG ++ GTN+I+G  VAIK E  +S  PQL  E R YK L+G  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYKYLSGGVG 64

Query: 88  IPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDL 147
           IP   +FG+EG +N +VIDLLGPSLEDLF++C R+FS KTV+ +A+QMI  ++ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFSFKTVIMLALQMICRVQYIHGRSF 124

Query: 148 IYRDIKPDNFL--IGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 205
           I+RDIKPDNFL  +GR G+     VH+IDFG++K+YRD  T +HIPYRE KSL+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRGS----TVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYA 180

Query: 206 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTNVYDL 265
           S+NTHLG EQSRRDD+E+LG++  YF +G LPWQGLKA   KQKY++I EKK   +V  L
Sbjct: 181 SVNTHLGIEQSRRDDLESLGYMLIYFCKGSLPWQGLKATTKKQKYDRILEKKLCISVETL 240

Query: 266 AQGLPVQFGRYLEVVRSLAFEETPDYEGYRKLFLSILDDMDNQADGEYDWMKL 318
             GLP++F  Y+   R+L F+E PDY    +LF  +   ++   D  +DW  L
Sbjct: 241 CAGLPLEFSEYMNYCRNLKFDERPDYLYLARLFKDLSIKLEYHNDHLFDWTML 293

>Sklu_1892.3 YPL204W, Contig c1892 5770-7194
          Length = 474

 Score =  323 bits (828), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 164/322 (50%), Positives = 214/322 (66%), Gaps = 9/322 (2%)

Query: 28  VGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTAG 87
           VG  +RIG+KIG GSFG ++ GTN+I+G  VAIK E  +S  PQL  E R YK L+G  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYKYLSGGIG 64

Query: 88  IPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDL 147
           IP   +FG+EG +N +VIDLLGPSLEDLF++C R+FS KTV+ +A+QMI  I+ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFSFKTVIMLALQMICRIQYIHGRSF 124

Query: 148 IYRDIKPDNFL--IGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 205
           I+RDIKPDNFL  +GR G+     VH+IDFG++K+YRD  T  HIPYRE K+L+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRGST----VHVIDFGLSKKYRDFSTHHHIPYRENKNLTGTARYA 180

Query: 206 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTNVYDL 265
           S+NTHLG EQSRRDD+E+LG+V  YF +G LPWQGLKA   +QKY++I EKK   +V  L
Sbjct: 181 SLNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKRQKYDRIMEKKLCISVEQL 240

Query: 266 AQGLPVQFGRYLEVVRSLAFEETPDYEGYRKLFLSILDDMDNQADGEYDWMKLNGGRGWD 325
             GLP++F  Y+   R+L F+E PDY    +LF  +   ++   D  +DW  L   +   
Sbjct: 241 CAGLPMEFVEYMRYCRNLRFDERPDYLYLARLFKDLSIKLEYHNDHLFDWTMLRYTKAM- 299

Query: 326 LNINKKPNLHGYGHPNPPNDKN 347
             I K+       H     DKN
Sbjct: 300 --IEKQRAAGELSHLEESEDKN 319

>Scas_720.24
          Length = 473

 Score =  323 bits (827), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 157/293 (53%), Positives = 207/293 (70%), Gaps = 6/293 (2%)

Query: 28  VGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTAG 87
           VG  +RIG+KIG GSFG ++ GTN+I+G  VAIK E  +S  PQL  E R YK L+G  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYKYLSGGVG 64

Query: 88  IPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDL 147
           IP   +FG+EG +N +VIDLLGPSLEDLF++C R+F+ KTV+ +A+QMI  ++ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFTFKTVIMLALQMICRVQYIHGRSF 124

Query: 148 IYRDIKPDNFLIG--RPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 205
           I+RDIKPDNFL+G  R G+     VH+IDFG++K+YRD  T +HIPYRE KSL+GTARY 
Sbjct: 125 IHRDIKPDNFLMGTGRRGS----TVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYA 180

Query: 206 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTNVYDL 265
           S+NTHLG EQSRRDD+E+LG++  YF +G LPWQGLKA   KQKY++I EKK   +V  L
Sbjct: 181 SVNTHLGIEQSRRDDLESLGYMLVYFCKGSLPWQGLKATTKKQKYDRILEKKLCISVETL 240

Query: 266 AQGLPVQFGRYLEVVRSLAFEETPDYEGYRKLFLSILDDMDNQADGEYDWMKL 318
             GLP++F  Y+   R+L F+E PDY    +LF  +   ++   D  +DW  L
Sbjct: 241 CAGLPIEFADYMNYCRNLKFDERPDYLYLARLFKDLSIKLEYHNDHLFDWTML 293

>AFL091W [3102] [Homologous to ScYPL204W (HRR25) - SH]
           complement(272431..273867) [1437 bp, 478 aa]
          Length = 478

 Score =  323 bits (827), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 156/293 (53%), Positives = 210/293 (71%), Gaps = 6/293 (2%)

Query: 28  VGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTAG 87
           VG  +RIG+KIG GSFG ++ GTN+I+G  VAIK EP +++ PQL  E R YK L+G  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLEPIRTKHPQLDYESRVYKYLSGGIG 64

Query: 88  IPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDL 147
           IP   +FG+EG +N +VIDLLGPSLEDLF++C R+FS+KTV+ +A+QMI  I+ +H    
Sbjct: 65  IPFIRWFGREGDYNAMVIDLLGPSLEDLFNYCHRKFSLKTVMMLALQMICRIQYIHGRSF 124

Query: 148 IYRDIKPDNFL--IGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 205
           I+RDIKPDNFL  +GR G+     VH+IDFG++K++RD +T  HIPYRE K+L+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRGS----TVHVIDFGLSKKFRDFRTHNHIPYRENKNLTGTARYA 180

Query: 206 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTNVYDL 265
           S+NTHLG EQSRRDD+E+LG+V  YF +G LPWQGL+A   +QKY++I EKK   +V  L
Sbjct: 181 SVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLRATTKRQKYDRIMEKKLCISVEQL 240

Query: 266 AQGLPVQFGRYLEVVRSLAFEETPDYEGYRKLFLSILDDMDNQADGEYDWMKL 318
             GLP++F  Y+   R+L F+E PDY    +LF  +   ++   D  +DW  L
Sbjct: 241 CVGLPIEFVEYMRYCRNLRFDERPDYMYVARLFKDLSIKLEYHNDHLFDWTML 293

>YPL204W (HRR25) [5244] chr16 (164275..165759) Casein kinase I
           (serine/threonine/tyrosine protein kinase) involved in
           DNA repair and meiosis [1485 bp, 494 aa]
          Length = 494

 Score =  322 bits (824), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 158/293 (53%), Positives = 206/293 (70%), Gaps = 6/293 (2%)

Query: 28  VGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTAG 87
           VG  +RIG+KIG GSFG ++ GTN+I+G  VAIK E  +S  PQL  E R Y+ L+G  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYRYLSGGVG 64

Query: 88  IPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDL 147
           IP   +FG+EG +N +VIDLLGPSLEDLF++C RRFS KTV+ +A+QM   I+ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRRFSFKTVIMLALQMFCRIQYIHGRSF 124

Query: 148 IYRDIKPDNFL--IGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 205
           I+RDIKPDNFL  +GR G+     VH+IDFG++K+YRD  T +HIPYRE KSL+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRGS----TVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYA 180

Query: 206 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTNVYDL 265
           S+NTHLG EQSRRDD+E+LG+V  YF +G LPWQGLKA   KQKY++I EKK   +V  L
Sbjct: 181 SVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKKQKYDRIMEKKLNVSVETL 240

Query: 266 AQGLPVQFGRYLEVVRSLAFEETPDYEGYRKLFLSILDDMDNQADGEYDWMKL 318
             GLP++F  Y+   ++L F+E PDY    +LF  +   ++   D  +DW  L
Sbjct: 241 CSGLPLEFQEYMAYCKNLKFDEKPDYLFLARLFKDLSIKLEYHNDHLFDWTML 293

>Scas_690.12
          Length = 488

 Score =  268 bits (686), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 134/289 (46%), Positives = 192/289 (66%), Gaps = 3/289 (1%)

Query: 28  VGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILA-GTA 86
           VG  YR+G++IG GSFG ++ G ++I+G  +AIK E  ++  PQL+ E R Y  ++ G+ 
Sbjct: 5   VGKRYRVGRRIGGGSFGEIYHGIDLISGEEIAIKLESSETRHPQLEYESRVYNFVSDGSM 64

Query: 87  GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHD 146
           GIP    F +   ++ LV+DLLGPSLEDLF++C R FS KT+  +A QMI  +  +H   
Sbjct: 65  GIPNIRMFERGFGYSALVMDLLGPSLEDLFNYCHRSFSYKTIFMLAWQMIARVAYVHGKS 124

Query: 147 LIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 206
            ++RDIKP+NFL+G       N V+LIDFG++K+YRD  + +H P +  KSL GTARY S
Sbjct: 125 FLHRDIKPENFLLG--TGRRANIVNLIDFGLSKKYRDFNSHRHNPRKTHKSLVGTARYAS 182

Query: 207 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTNVYDLA 266
           +NTH G EQSRRDD+E+LG+V  YF +G LPWQGL+A   KQKY++I ++K       L 
Sbjct: 183 VNTHFGIEQSRRDDLESLGYVLVYFAKGHLPWQGLRATTKKQKYDRILQRKLCITTDILC 242

Query: 267 QGLPVQFGRYLEVVRSLAFEETPDYEGYRKLFLSILDDMDNQADGEYDW 315
           +GLP QF  Y+  VRSL +++ PDY    +LF ++ + ++   D  +DW
Sbjct: 243 EGLPSQFVAYMGYVRSLQYDQRPDYVYLEQLFKNLSEQLNYTNDYLFDW 291

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score = 75.1 bits (183), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 111/237 (46%), Gaps = 31/237 (13%)

Query: 25   STIVGLHYRIGKK--IGEGSFGVLFEGTNMINGVPVA---IKFEPRKSEA---PQLKDEY 76
            S+I  L  R  K+  IG GSFG ++   N+  G  +A   IK +  KS     P LK+E 
Sbjct: 1250 SSISNLSIRWQKRSFIGSGSFGTVYSAVNLDTGDILAVKEIKIQDAKSMKQIFPSLKEEM 1309

Query: 77   RTYKILAGTAGIPQAYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRRFSVKTVVQV- 131
            R  +IL     I Q  Y+G E +H    NI +    G SL  L +    R   + V QV 
Sbjct: 1310 RVMEIL-NHPNIVQ--YYGVE-VHRDKVNIFMEFCEGSSLASLLE--HGRIEDEMVTQVY 1363

Query: 132  AVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIP 191
             +Q++  +  LH   +++RDIKP+N L+ R G      +  +DFG AK      +K+   
Sbjct: 1364 TLQLLEGLACLHQSGVVHRDIKPENILLDRNGV-----IKYVDFGAAKLIAKNGSKRISL 1418

Query: 192  YREKKS-----LSGTARYMSINTHLGREQSR--RDDMEALGHVFFYFLRGQLPWQGL 241
                KS     + GT  YM+  T  G+   +   DD+ +LG V    + G+ PW  L
Sbjct: 1419 DANNKSTGGKDMIGTPMYMAPETVTGQGHGKFGSDDIWSLGCVVLEMVTGRRPWANL 1475

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 70/242 (28%), Positives = 111/242 (45%), Gaps = 37/242 (15%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILA-----GTA 86
           ++ G+++G+GS+  +   T   +G   A+K   ++    Q K +Y T + LA     GT 
Sbjct: 125 FKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEYLIRQKKVKYVTVEKLALQKLNGTK 184

Query: 87  GIPQAYYFGQEGLHNILVI------DLLG--PSLEDLFDWCGRRFSVKTVVQVAVQMITL 138
           GI + ++  Q+      ++      D LG       L + C R +        A Q+I  
Sbjct: 185 GIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKYGSLNETCARYY--------ASQIIDA 236

Query: 139 IEDLHTHDLIYRDIKPDNFLIGRPGTPDEN-KVHLIDFGMAKQY-RDPK-TKQHIP---- 191
           ++ LH   +I+RDIKP+N L+      D+N KV L DFG AK    +P  T    P    
Sbjct: 237 VDSLHNIGIIHRDIKPENILL------DKNMKVKLTDFGTAKILPEEPSNTADGKPYFDL 290

Query: 192 YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYE 251
           Y + KS  GTA Y+S           R D+ A G + +  L G+ P+   KA N    ++
Sbjct: 291 YAKSKSFVGTAEYVSPELLNDNYTDSRCDIWAFGCILYQMLAGKPPF---KAANEYLTFQ 347

Query: 252 KI 253
           K+
Sbjct: 348 KV 349

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 103/213 (48%), Gaps = 18/213 (8%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKS----EAPQLKDEYRTYKILAGTAG 87
           Y  GK +G G+FGV+ +  N      VAIK   +++    E   L DE    + L     
Sbjct: 56  YIFGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRALKGNELQMLYDELSILQKLDHPNI 115

Query: 88  IPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDLHTH 145
           +    +F  E      ++  L    E LFD   ++  F+    V++ VQM+T +E +H+ 
Sbjct: 116 VKFKDWF--ESREKFYIVTQLATGGE-LFDRILKKGKFTETDAVKIVVQMLTAVEYMHSQ 172

Query: 146 DLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 205
           ++++RD+KP+N L   P   DE+++ + DFG+AKQ     ++  + +R     +G+  Y+
Sbjct: 173 NVVHRDLKPENVLYLDPS--DESQLVISDFGIAKQL---SSESQLIHRA----AGSMGYV 223

Query: 206 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 238
           +          +  D+ +LG + +  L G  P+
Sbjct: 224 APEVLTTSGHGKPCDIWSLGVITYTLLCGYSPF 256

>Scas_618.8
          Length = 427

 Score = 67.8 bits (164), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 59/219 (26%), Positives = 106/219 (48%), Gaps = 22/219 (10%)

Query: 25  STIVGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKS------EAPQLKDEYRT 78
           S +    Y  GK +G GSFGV+ E T   N   VAIK   +K+      +   L DE   
Sbjct: 20  SKVTKSDYEFGKTLGAGSFGVVREATKKSNNEEVAIKILLKKALEGNQVQLQMLYDELTI 79

Query: 79  YKILAGTAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKTVVQVAVQMI 136
            K L     +    +F  E    I ++  L    E LFD   +  RFS    V++ +Q++
Sbjct: 80  LKKLHHPNIVEFKNWF--ETDDKIYIVTQLATGGE-LFDRIIKKGRFSEDDAVKILIQIL 136

Query: 137 TLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKK 196
           + +E +H+ D+++RD+KP+N L       +++++ + DFG+AK+    K  + + ++   
Sbjct: 137 SAVEYIHSRDIVHRDLKPENLL--YLTEKEDSELVIADFGIAKEL---KKGEQLIFKAAG 191

Query: 197 SLSGTA-RYMSINTHLGREQSRRDDMEALGHVFFYFLRG 234
           SL   A   ++++ H      +  D+ ++G + +  L G
Sbjct: 192 SLGYVAPEVLTVDGH-----GKPCDIWSIGVITYTLLSG 225

>Kwal_23.6325
          Length = 1542

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 108/232 (46%), Gaps = 29/232 (12%)

Query: 28   VGLHYRIGKKIGEGSFGVLFEGTNMINGVPVA---IKFEPRKSEA---PQLKDEYRTYKI 81
            V + ++  + +G G+FG +F   N+  G  +A   IK + RKS     P +K+E    ++
Sbjct: 1245 VSIRWQKRQFVGGGAFGTVFSAVNLDTGEILAVKEIKIQDRKSMKQVFPAIKEEMSVLEM 1304

Query: 82   LAGTAGIPQAYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRRFSVKTVVQV-AVQMI 136
            L     +    Y+G E +H    N+ +    G SL  L +    R   + V Q+ A+QM+
Sbjct: 1305 LNHPNVVQ---YYGVE-VHRDKVNLFMEYCEGGSLAQLLE--HGRIEDEMVTQIYALQML 1358

Query: 137  TLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKK 196
              +  LH   +++RDIKP+N L+   G      +  +DFG A+      TK      E K
Sbjct: 1359 EGLAYLHQSSVVHRDIKPENILLDFNGV-----IKYVDFGAARSLAANGTKAPNVGAEGK 1413

Query: 197  -----SLSGTARYMSINTHLGREQSR--RDDMEALGHVFFYFLRGQLPWQGL 241
                 S+ GT  YMS  +  G ++ +    D+ +LG V    + G+ PW  L
Sbjct: 1414 ADGVNSMMGTPMYMSPESITGAKKGKFGSGDIWSLGCVILEMVTGRRPWFNL 1465

>KLLA0E03487g complement(323764..325707) similar to sgd|S0002874
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 647

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 100/230 (43%), Gaps = 22/230 (9%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEY-----RTYKILA--G 84
           +   +++G GS+  +++  +   G   AIK   +K    + K +Y      T  +LA   
Sbjct: 10  FSFKERLGHGSYSTVYKAVDRSTGQLFAIKVCSKKHIISENKVKYVTIEKNTLNLLAHGN 69

Query: 85  TAGIPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLH 143
             GI + YY   +  +   V+D   G  L  L    GR F+         Q+I  +E +H
Sbjct: 70  HPGIIKLYYTFHDSENLYFVLDFAPGGELLQLLQTQGR-FNEAWTKHFMCQLIDALEYIH 128

Query: 144 THDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 203
              +++RD+KP+N L+       E K+ + DFG+A                  S  GTA 
Sbjct: 129 GCKVVHRDLKPENLLLS-----SEGKLMITDFGVASNLAATDN-----LSSTSSFVGTAE 178

Query: 204 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 253
           Y+S    L  + +   D+ A+G + + F +G  P++G    N    +EKI
Sbjct: 179 YVSPELLLQNKSNFCSDIWAVGCMLYQFTQGTPPFRG---ENELAAFEKI 225

>Scas_660.20
          Length = 957

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 63/227 (27%), Positives = 104/227 (45%), Gaps = 21/227 (9%)

Query: 36  KKIGEGSFGVLFEG-----TNMINGVPVAIKFEP-RKSEAPQLKDEYRTYKILAGT--AG 87
           +++G GS+  +++      T  I  + V  K    ++S+   +  E  T  +LA     G
Sbjct: 15  EELGHGSYSTVYKAIDKRNTKRIFAIKVCSKAHIIKESKVKYVTIEKNTLNLLAKAHHPG 74

Query: 88  IPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHD 146
           I + YY   +  +   V+D L G  L  L     + FS        VQ++  +E +H+  
Sbjct: 75  IVKLYYTFHDEENLYYVLDYLPGGELLSLLHKM-KTFSEVWSKHFTVQLVDTLEFIHSQG 133

Query: 147 LIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 206
           +I+RD+KP+N L+ R G     K+ + DFG A          +   +   S  GTA Y+S
Sbjct: 134 VIHRDLKPENVLLDRDG-----KLMITDFGAAYTTTAGNNDAN---KSSSSFVGTAEYVS 185

Query: 207 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 253
               L  + S   D+ ALG + F F+ G  P++G    N  + +EKI
Sbjct: 186 PELLLHNQCSFSSDVWALGCMIFQFVTGSPPFRG---ENELKTFEKI 229

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 63/225 (28%), Positives = 102/225 (45%), Gaps = 33/225 (14%)

Query: 35   GKKIGEGSFGVLFEGTNMINGVPVAIK----------FEPRKSEAPQLKDEYRTYKILAG 84
            G+ IG+GSFG ++   N+  G  +A+K           E  K     LK E  T K L  
Sbjct: 1154 GEMIGKGSFGAVYLSLNITTGEMMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKDL-D 1212

Query: 85   TAGIPQAYYFGQEGLHNILVIDL---LGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED 141
               I Q  Y G E   NI  + L    G S+  L    GR F  K +  +  Q+++ ++ 
Sbjct: 1213 HLNIVQ--YLGSEIRGNIYSLFLEYVAGGSVGSLIRLYGR-FDEKLIRHLNTQVLSGLKY 1269

Query: 142  LHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 201
            LH+  +++RD+K DN L+   G        + DFG++K+ ++  +   +  R      GT
Sbjct: 1270 LHSKGILHRDMKADNLLLDEDGI-----CKISDFGISKKSKNIYSNSDMTMR------GT 1318

Query: 202  ARYMS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 243
              +M+   ++T  G   S + D+ +LG V      G+ PW  L+ 
Sbjct: 1319 VFWMAPEMVDTKQG--YSAKVDIWSLGCVVLEMFAGKRPWSNLEV 1361

>Kwal_26.7355
          Length = 1446

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 57/222 (25%), Positives = 102/222 (45%), Gaps = 27/222 (12%)

Query: 35   GKKIGEGSFGVLFEGTNMINGVPVAIKF----------EPRKSEAPQLKDEYRTYKILAG 84
            G+ IG+GSFG +F G N+  G  +A+K           E   S    L+ E  T K L  
Sbjct: 1149 GEMIGKGSFGSVFLGLNVTTGEMIAVKQVEVPRYGSQDETTLSVLEALRSEVATLKDLDH 1208

Query: 85   TAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHT 144
            T  +    +  +  ++++ +  + G S+  L    G +F    +  +AVQ++  +  LH+
Sbjct: 1209 TNIVQYLGFENKNYVYSLFLEYVAGGSVGSLIRLYG-KFDENLIRFLAVQVLRGLSYLHS 1267

Query: 145  HDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 204
              +++RD+K DN L+   G        + DFG++K+  +  +   +  R      GT  +
Sbjct: 1268 KKILHRDMKADNLLLDVDGI-----CKISDFGISKKSNNIYSNSDMTMR------GTVFW 1316

Query: 205  MS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 243
            M+   ++T  G   S + D+ +LG V      G+ PW  L+ 
Sbjct: 1317 MAPEMVDTKQG--YSAKVDIWSLGCVVLEMFAGKRPWSNLEV 1356

>YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine
           protein kinase of unknown function [2697 bp, 898 aa]
          Length = 898

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 74/296 (25%), Positives = 127/296 (42%), Gaps = 48/296 (16%)

Query: 36  KKIGEGSFGVLFEGTNMINGVPV-AIKFEPRKSEAPQLKDEY-----RTYKILAGT--AG 87
           +++G GS+  +F+  +  +   + AIK   +K    + K +Y      T  +LA    AG
Sbjct: 15  EELGHGSYSTVFKALDKKSPNKIYAIKVCSKKHIIKEAKVKYVTIEKNTMNLLAQKHHAG 74

Query: 88  IPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHD 146
           I + YY   +  +   V+D   G  L  L    G  F+         Q+I  +E +H+H 
Sbjct: 75  IIKLYYTFHDEENLYFVLDFAPGGELLSLLHKMGT-FNDIWTRHFTAQLIDALEFIHSHG 133

Query: 147 LIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKK---------- 196
           +I+RD+KP+N L+ R G     ++ + DFG A       +     +              
Sbjct: 134 IIHRDLKPENVLLDRDG-----RLMITDFGAAATIDPSLSGDSAKFNSDSNGSKDNQNCA 188

Query: 197 SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI--- 253
           S  GTA Y+S    L  +     D+ ALG + + F++GQ P++G    N  + +EKI   
Sbjct: 189 SFVGTAEYVSPELLLYNQCGYGSDIWALGCMIYQFVQGQPPFRG---ENELKTFEKIVAL 245

Query: 254 ----GEKKRVTN--------VYDLAQGLPVQFGRYLEVVRSLAFEETPDYEGYRKL 297
               G   R+ N        V +L Q + V     +EV   ++ E+   +  + K+
Sbjct: 246 DYPWGPNNRINNSTSPINPLVINLVQKILV-----IEVNERISLEQIKRHPYFSKV 296

>Kwal_56.24059
          Length = 353

 Score = 62.0 bits (149), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 67/233 (28%), Positives = 108/233 (46%), Gaps = 28/233 (12%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLK------DEYRTYKILAGT 85
           ++I + +G GSFG +    ++ NG   AIK   +K +  ++K      DE R  K++   
Sbjct: 43  FQILRTLGTGSFGRVHLVRSVHNGRYYAIKVL-KKEQVIRMKQIEHTNDERRMLKLVDHP 101

Query: 86  AGIPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHT 144
             I     F Q+  +  +V+D + G  L  L     +RF        A ++I  +E LH+
Sbjct: 102 FLIRMWGTF-QDSRNLFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVILALEYLHS 159

Query: 145 HDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 204
           HD+IYRD+KP+N L+ R G      + + DFG AK+  D  T          +L GT  Y
Sbjct: 160 HDIIYRDLKPENILLDRNG-----HIKITDFGFAKEV-DTVT---------WTLCGTPDY 204

Query: 205 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKK 257
           ++      +  ++  D  +LG + F  L G  P+         + YEKI + K
Sbjct: 205 IAPEVIATKPYNKSVDWWSLGILIFEMLAGYTPFYD---ATPMKTYEKILQGK 254

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 69/232 (29%), Positives = 105/232 (45%), Gaps = 32/232 (13%)

Query: 28   VGLHYRIGKKIGEGSFGVLFEGTNMINGVPVA---IKFEPRKSEA---PQLKDEYRTYKI 81
            V + ++    IG GSFG ++   N+  G  +A   IKF  RK+     P ++DE    ++
Sbjct: 1187 VSIKWQKRSFIGGGSFGSVYSAVNLDTGDILAVKEIKFNDRKTIKQVFPSIRDEMTVLEM 1246

Query: 82   LAGTAGIPQAYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRRFSVKTVVQV-AVQMI 136
            L     +    Y+G E +H    NI +    G SL  L      R   + V QV ++QM+
Sbjct: 1247 LNHPNVVQ---YYGVE-VHRDRVNIFMEYCEGGSLASLL--AHGRIEDEMVTQVYSLQML 1300

Query: 137  TLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTK-----QHIP 191
              +  LH   + +RDIKP+N L+   G      +  +DFG AK      +K     QH+ 
Sbjct: 1301 EGLAYLHESGVDHRDIKPENILLDFNGI-----IKYVDFGAAKVLASNGSKKLNLEQHM- 1354

Query: 192  YREKKSLSGTARYMSINTHLGREQSR--RDDMEALGHVFFYFLRGQLPWQGL 241
              E + + GT  YMS     G    +   DD+ +LG V    + G+ PW  L
Sbjct: 1355 --EGEKMIGTPMYMSPEAISGTGYGKFGSDDIWSLGCVILEMVTGRRPWANL 1404

>YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine protein
            kinase of the MEKK family involved in the cell wall
            integrity (low-osmolarity) and nutrient sensing pathways
            [4437 bp, 1478 aa]
          Length = 1478

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 69/272 (25%), Positives = 118/272 (43%), Gaps = 37/272 (13%)

Query: 35   GKKIGEGSFGVLFEGTNMINGVPVAIK----------FEPRKSEAPQLKDEYRTYKILAG 84
            G+ IG+GSFG ++   N+  G  +A+K           E   S    L+ E  T K L  
Sbjct: 1178 GEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDH 1237

Query: 85   TAGIPQAYYFGQEGLHNILVIDL---LGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED 141
               +    Y G E  +NI  + L    G S+  L    GR F    +  +  Q++  +  
Sbjct: 1238 LNIV---QYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGR-FDEPLIKHLTTQVLKGLAY 1293

Query: 142  LHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 201
            LH+  +++RD+K DN L+ + G        + DFG++++ +D  +   +  R      GT
Sbjct: 1294 LHSKGILHRDMKADNLLLDQDGI-----CKISDFGISRKSKDIYSNSDMTMR------GT 1342

Query: 202  ARYMS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKR 258
              +M+   ++T  G   S + D+ +LG +      G+ PW  L+         KIG+ K 
Sbjct: 1343 VFWMAPEMVDTKQG--YSAKVDIWSLGCIVLEMFAGKRPWSNLEV---VAAMFKIGKSKS 1397

Query: 259  VTNVYDLAQGLPVQFGR-YLEVVRSLAFEETP 289
               + +    L  Q GR +L+    +  E+ P
Sbjct: 1398 APPIPEDTLPLISQIGRNFLDACFEINPEKRP 1429

>Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement
          Length = 1071

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/255 (25%), Positives = 119/255 (46%), Gaps = 38/255 (14%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIK-----FEPRKSEAPQLKDEYRTYKILAGTA 86
           ++ G+ +G+GS+  +   T+  +G   A+K     +  R+ +   +  E  T + L  + 
Sbjct: 182 FKFGEILGDGSYSTVMLATSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKNTLQRLNNSR 241

Query: 87  GIPQAYYFGQE--GLHNILVIDLLGPSLE------DLFDWCGRRFSVKTVVQVAVQMITL 138
           G+ + Y+  Q+   L+ +L     G  L        L + C R +          QM+  
Sbjct: 242 GVIKLYFTFQDEASLYFLLEYAPNGDFLSVMKKFGSLNEECCRYY--------GAQMLDA 293

Query: 139 IEDLHTHDLIYRDIKPDNFLIGRPGTPDEN-KVHLIDFGMAKQY-RDPKTKQHIPYREKK 196
           I+ +H + +++RDIKP+N L+      DE+ KV L DFG AK   RD K+  ++  ++ +
Sbjct: 294 IDFIHKNGVVHRDIKPENILL------DEHMKVKLTDFGTAKLLDRDEKSGYNL-LKKSR 346

Query: 197 SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEK 256
           S  GTA Y+S         + + D+ A G + +  + G+ P+   KA N    ++K+ + 
Sbjct: 347 SFVGTAEYVSPELLNDNCVNYKCDIWAFGCILYQMIAGKPPF---KATNEYLTFQKVMKV 403

Query: 257 KRVTNVYDLAQGLPV 271
           +     Y    G P+
Sbjct: 404 Q-----YAFTAGFPL 413

>KLLA0F16467g 1519800..1520822 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 340

 Score = 61.6 bits (148), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 82/159 (51%), Gaps = 22/159 (13%)

Query: 31  HYRIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKSEAPQLKDEYRTYKILAGTAGIP 89
           +Y + KKIG G +  +F+G +++N +P  IK  +P K     +K  YR  K+L    G P
Sbjct: 50  NYEVIKKIGRGKYSEVFKGKSVLNDIPCVIKVLKPVK-----MKKIYRELKVLTNLTGGP 104

Query: 90  QAYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCGRRFSVKTVVQVAVQMITLIEDL 142
                   GL +I+      +  L+   ++++ F      F++        Q++T ++  
Sbjct: 105 NII-----GLLDIVQDPGSKIPALIFEEVKNVDFRTLYPSFTLSDTQFYFTQLLTALDYC 159

Query: 143 HTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQY 181
           H+  +++RD+KP N +I     P+E K+ LID+G+A+ Y
Sbjct: 160 HSMGIMHRDVKPQNVMID----PNERKLRLIDWGLAEFY 194

>Kwal_56.22693
          Length = 984

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 112/248 (45%), Gaps = 23/248 (9%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIK-----FEPRKSEAPQLKDEYRTYKILAGTA 86
           +R G+ +G+GS+  +    +  +G   A+K     +  R+ +   +  E  T + L    
Sbjct: 158 FRFGEVLGDGSYSTVMLARSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKNTLQRLNDGR 217

Query: 87  GIPQAYYFGQE--GLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHT 144
           G+ + Y+  Q+   L+ +L     G  L  +  +     S +  V  + Q++  I+ LH 
Sbjct: 218 GVIKLYFTFQDEASLYFLLEYAPNGDFLSVIKKFGS--LSQECAVYYSAQILDAIDYLHH 275

Query: 145 HDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREK-KSLSGTAR 203
             +++RDIKP+N L+ +     + KV L DFG A+     +T Q     E+ KS  GTA 
Sbjct: 276 KGIVHRDIKPENILLDK-----DMKVKLTDFGTARILEKDETTQTFNLLERSKSFVGTAE 330

Query: 204 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTNVY 263
           Y+S           + D+ A G + F  + G+ P+   KA N    ++K+ + +     Y
Sbjct: 331 YVSPELLNDNYVDYKCDIWAFGCILFQMIAGKPPF---KATNEYLTFQKVMKVQ-----Y 382

Query: 264 DLAQGLPV 271
               G P+
Sbjct: 383 AFTAGFPL 390

>YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit of
           cAMP-dependent protein kinase 2, protein kinase A or PKA
           [1143 bp, 380 aa]
          Length = 380

 Score = 61.2 bits (147), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 65/235 (27%), Positives = 109/235 (46%), Gaps = 28/235 (11%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLK------DEYRTYKILAGT 85
           ++I + +G GSFG +    ++ NG   AIK   +K +  ++K      DE R  K++   
Sbjct: 70  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVL-KKQQVVKMKQVEHTNDERRMLKLVEHP 128

Query: 86  AGIPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHT 144
             I     F Q+  +  +V+D + G  L  L     +RF        A ++I  +E LH 
Sbjct: 129 FLIRMWGTF-QDARNIFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVILALEYLHA 186

Query: 145 HDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 204
           H++IYRD+KP+N L+ R G      + + DFG AK+       Q + +    +L GT  Y
Sbjct: 187 HNIIYRDLKPENILLDRNG-----HIKITDFGFAKEV------QTVTW----TLCGTPDY 231

Query: 205 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRV 259
           ++      +  ++  D  +LG + +  L G  P+         + YEKI + K V
Sbjct: 232 IAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYD---TTPMKTYEKILQGKVV 283

>Sklu_2436.14 YDR466W, Contig c2436 31299-33653
          Length = 784

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/235 (27%), Positives = 108/235 (45%), Gaps = 28/235 (11%)

Query: 36  KKIGEGSFGVLFEGTNMI---NGVP---VAIKFEPRKSEAPQLKDEY-----RTYKILA- 83
           +++G GS+  +++  +     +G+P    AIK   +K    + K +Y      T  +LA 
Sbjct: 14  EQLGHGSYSTVYKALDKARNNSGLPQHFYAIKVCSKKHIIRENKVKYVTIEKNTLNLLAQ 73

Query: 84  -GTAGIPQAYY--FGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLI 139
               GI + YY    QE L+   V+D   G  L  L    G  F          Q++ ++
Sbjct: 74  GNNPGIVKLYYTFHDQENLY--FVLDYAPGGELLHLLQRYGT-FDEVWSKHFMCQLVDVV 130

Query: 140 EDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREK-KSL 198
           E +H+  +I+RD+KP+N L+ + G     ++ + DFG A       T       E+  S 
Sbjct: 131 EYIHSKGVIHRDLKPENVLLSKDG-----RLMVTDFGAASVVTTDGTSSDNSVSERAASF 185

Query: 199 SGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 253
            GTA Y+S    L  +     D+ ALG + + F++G  P++G    N  Q +EKI
Sbjct: 186 VGTAEYVSPELLLNNQCFFSSDIWALGCILYQFMQGSPPFRG---ENELQTFEKI 237

>Kwal_47.18307
          Length = 621

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 107/232 (46%), Gaps = 23/232 (9%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMIN-GVPVAIKFEPRKSEAPQLKDEYRTYK-----ILA-- 83
           Y    ++G+GS+  ++      N G   AIK   +K    + K +Y T +     +LA  
Sbjct: 10  YVFLDRLGQGSYSTVYRAVERSNSGRNYAIKVCSKKHIIREKKVKYVTIEKDLLNMLAKG 69

Query: 84  GTAGIPQAY--YFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED 141
           G  GI + +  +   E L+ +L   + G  L  L    GR  +      +  Q++  ++ 
Sbjct: 70  GHLGIVKLFCTFHDIENLYFVLEY-VSGGELLALIQRLGR-LTEDLSRHITAQLVDTVDY 127

Query: 142 LHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 201
           +H+  +I+RD+KP+N L+ +     E +V + DFG A    D K +     +   S  GT
Sbjct: 128 MHSKGVIHRDLKPENVLLSQ-----EGRVVITDFGAACTAADRKFENT---KRTASFVGT 179

Query: 202 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 253
           A Y+S    L  +     D+ ALG + +   +G+ P++G    N  Q +EKI
Sbjct: 180 AEYVSPELLLHSQCGFSSDIWALGCIIYQLNQGKPPFRG---ENELQTFEKI 228

>Kwal_0.96
          Length = 427

 Score = 60.1 bits (144), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 100/215 (46%), Gaps = 20/215 (9%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKS------EAPQLKDEYRTYKILAGT 85
           Y  GK +G GSFGV+ +   + +G  VAIK   +K+      E   L DE    + L   
Sbjct: 46  YIFGKTLGAGSFGVVRQARQVSSGENVAIKILLKKALKGKDVELQMLYDELSILQKLDHP 105

Query: 86  AGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKTVVQVAVQMITLIEDLH 143
             +    +F  E      ++  L    E LFD   +  +F+ +  V++  Q++  +E LH
Sbjct: 106 NIVKFKDWF--ESKDKFYIVTQLATGGE-LFDRILKQGKFTEEDAVRIVYQILKAVEYLH 162

Query: 144 THDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 203
           + ++++RD+KP+N L        ++++ L DFG+AK+ ++     H         +G+  
Sbjct: 163 SRNIVHRDLKPENLLYLTEAA--DSQLVLGDFGIAKELKNDDELIH-------KAAGSMG 213

Query: 204 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 238
           Y++          +  D+ +LG V +  L G  P+
Sbjct: 214 YVAPEVVTTSGHGKPCDIWSLGVVTYTLLCGYSPF 248

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 109/252 (43%), Gaps = 37/252 (14%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQ--------LKDEYRTYKILA 83
           Y++G+ I  GSF V+    +   G  VA+K+  +  + P+        + +EY   + L 
Sbjct: 7   YKVGRLIQSGSFSVVHHAQDCQTGQDVALKYVRKPHDNPEQLQKVAALVHNEYAILRRLG 66

Query: 84  GTAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQV-----AVQMITL 138
               I Q   F ++    + V++    +  DL+D+  +    +  +++       Q+ + 
Sbjct: 67  THRNICQLLDFYEDADTYVFVLEYC--AYGDLYDFI-KAIRERPTMRINFHSFLFQLCSA 123

Query: 139 IEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSL 198
           I   H+ D+ +RDIKP+N L+      D  +V L DFG+++          I    K   
Sbjct: 124 ISYCHSKDVSHRDIKPENVLMD-----DRGQVKLTDFGLSQ----------IGSVSKDYC 168

Query: 199 SGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLPWQGLK--APNNKQKYEK-I 253
            GT +Y++  T L RE   +   D  +LG   F  + G  P++     AP     +++ I
Sbjct: 169 IGTEKYLAPETFL-REYHNTFATDYWSLGITIFCLMFGSCPFESASSDAPKRSANFQRFI 227

Query: 254 GEKKRVTNVYDL 265
            +  R    Y L
Sbjct: 228 RDPHRFVESYYL 239

>Scas_502.2
          Length = 1116

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 65/262 (24%), Positives = 116/262 (44%), Gaps = 32/262 (12%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILA-----GTA 86
           ++ G+ +G+G++  +   T+  +G   A+K   ++    Q K +Y   + LA      + 
Sbjct: 174 FKFGEMLGDGAYSTVMLATSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKLALQRLNNSR 233

Query: 87  GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSV--KTVVQVAVQMITLIEDLHT 144
            I + ++  Q+      +++   P+  DL     +  S+  +       Q+I  I+ +H+
Sbjct: 234 SIIRLFFTFQDEASLYFLLEY-APN-GDLLSLMKKFGSLNEECCCYYGAQIIDAIKFMHS 291

Query: 145 HDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAK--QYRDPKTKQHIPYREKKSLSGTA 202
             +I+RDIKP+N L+ +     + KV + DFG AK    + P T   +  R  KS  GTA
Sbjct: 292 KGIIHRDIKPENILLDK-----DMKVKITDFGTAKILDNKPPGTSYDLLTRS-KSFVGTA 345

Query: 203 RYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTNV 262
            Y+S           R D+ A G + F  + G+ P+   KA N    ++K+ + +     
Sbjct: 346 EYVSPELLNDNYTDARSDIWAFGCIVFQMIAGKPPF---KATNEYLTFQKVMKVQ----- 397

Query: 263 YDLAQGLPVQFGRYLEVVRSLA 284
           Y    G P        VVR L 
Sbjct: 398 YAFTAGFPT-------VVRDLV 412

>AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH]
           complement(274336..275376) [1041 bp, 346 aa]
          Length = 346

 Score = 58.9 bits (141), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 103/234 (44%), Gaps = 26/234 (11%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEP-----RKSEAPQLKDEYRTYKILAGTA 86
           ++I + +G GSFG +    ++ NG   AIK        R  +     DE R  K++    
Sbjct: 36  FQIMRTLGTGSFGRVHLVRSIHNGRYYAIKVLKKQQVIRMKQIEHTNDERRMLKVVEHPF 95

Query: 87  GIPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTH 145
            I     F Q+  +  +V+D + G  L  L     +RF        A ++   +E LH H
Sbjct: 96  LIRMWGTF-QDARNLFIVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVTLALEYLHAH 153

Query: 146 DLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 205
           ++IYRD+KP+N L+ R G      + + DFG AK+  D  T          +L GT  Y+
Sbjct: 154 NIIYRDLKPENILLDRNG-----HIKITDFGFAKEV-DTVT---------WTLCGTPDYI 198

Query: 206 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRV 259
           +      +  ++  D  +LG + F  L G  P+  +      + YEKI   K V
Sbjct: 199 APEVITTKPYNKSIDWWSLGILIFEMLAGYTPFYDV---TPIKTYEKILAGKVV 249

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score = 58.9 bits (141), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 61/228 (26%), Positives = 100/228 (43%), Gaps = 26/228 (11%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEP-----RKSEAPQLKDEYRTYKILAGTA 86
           ++I + +G GSFG +    ++ NG   AIK        R  +     DE R  K++    
Sbjct: 62  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQIIRMKQIEHTNDERRMLKLVEHPF 121

Query: 87  GIPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTH 145
            I     F Q+  +  +V+D + G  L  L     +RF        A ++   +E LH+H
Sbjct: 122 LIRMWGTF-QDSRNLFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVTLALEYLHSH 179

Query: 146 DLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 205
           ++IYRD+KP+N L+ R G      + + DFG AK+                +L GT  Y+
Sbjct: 180 NIIYRDLKPENILLDRNG-----HIKITDFGFAKEV----------ITVTWTLCGTPDYI 224

Query: 206 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 253
           +      +  ++  D  +LG + F  L G  P+  +      + YEKI
Sbjct: 225 APEVITTKPYNKSVDWWSLGILIFEMLAGYTPFYDVTP---MKTYEKI 269

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 115/274 (41%), Gaps = 53/274 (19%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEY-----RTYKILAGTA 86
           ++ G+ +G+G++  +   T   +G   A+K   ++    Q K +Y        + L  + 
Sbjct: 182 FKFGEMVGDGAYSTVMLATAKDSGKKYAVKVLNKEYLIKQKKVKYVNIEKNALQRLNNSR 241

Query: 87  GIPQAYYFGQE--GLHNIL----------VIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQ 134
           GI + ++  Q+   L+ +L          V+   G   ED    C R +S         Q
Sbjct: 242 GIVKLFFTFQDESSLYFLLEYAPNGDFLSVMKKYGSLSED----CTRYYSA--------Q 289

Query: 135 MITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIP--- 191
           +I  I+ LH+  +I+RDIKP+N L+ +     + KV + DFG AK        +  P   
Sbjct: 290 IIDGIKYLHSKGIIHRDIKPENILLDK-----DMKVKITDFGTAKILEPKNEDEDNPEFN 344

Query: 192 -YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKY 250
                KS  GTA Y+S           R D+ A G + F  + G+ P+   KA N    +
Sbjct: 345 LLTRSKSFVGTAEYVSPELLNDSYVDARCDIWAFGCMVFQMIAGKPPF---KATNEYLTF 401

Query: 251 EKIGEKKRVTNVYDLAQGLPVQFGRYLEVVRSLA 284
           +K+ + +     Y    G PV       VVR L 
Sbjct: 402 QKVMKVQ-----YAFTAGFPV-------VVRDLV 423

>Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement
          Length = 432

 Score = 58.9 bits (141), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 99/215 (46%), Gaps = 20/215 (9%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKS------EAPQLKDEYRTYKILAGT 85
           Y  GK +G GSFGV+ +   +  G  VA+K   +K+      +   L DE    + L   
Sbjct: 46  YIFGKTLGAGSFGVVRQARKISTGDNVAVKILLKKALKGNDVQLQMLYDELMILQKLNHP 105

Query: 86  AGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDLH 143
             +    +F  E      ++  L    E LFD   ++  F+    V++ VQ++  +E LH
Sbjct: 106 NIVKFKDWF--ESKEKFYIVTQLATGGE-LFDRILQKGKFTEVDAVKIVVQILKAVEYLH 162

Query: 144 THDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 203
           + ++++RD+KP+N L       D +++ L DFG+AK+ ++     H         +G+  
Sbjct: 163 SRNIVHRDLKPENLL--YLDKSDNSQLVLGDFGIAKELKNDGDLIH-------KAAGSMG 213

Query: 204 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 238
           Y++          +  D+ ++G + +  L G  P+
Sbjct: 214 YVAPEVLTSNGHGKPCDIWSIGVITYTLLCGYSPF 248

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 104/232 (44%), Gaps = 21/232 (9%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEY-----RTYKILAGTA 86
           ++ G+ +G+GS+  +   T++ +    A+K   ++    Q K +Y      T + L  T 
Sbjct: 155 FKFGETLGDGSYSTVLLATSIESNKKYAVKILNKEYLIKQKKVKYVNIEKNTLQRLKNTK 214

Query: 87  GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSV--KTVVQVAVQMITLIEDLHT 144
           GI   Y+  Q+      +++   P+  DL     +  SV  K     A Q+I  +  +H 
Sbjct: 215 GIISLYFTFQDESSLYFLLEY-APN-GDLLSLMRKHGSVNEKCTQYYAAQIIDALGFMHD 272

Query: 145 HDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPY---REKKSLSGT 201
             +I+RD+KP+N L+       + KV L DFG A+   D  ++  + Y       S  GT
Sbjct: 273 KGVIHRDLKPENILLDV-----DMKVKLTDFGTAR-LLDSTSEDDLKYDLLTRSNSFVGT 326

Query: 202 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 253
           A Y+S           R D+ A G + F  + G+ P+   KA N    ++K+
Sbjct: 327 AEYVSPELLNDNYVDFRCDIWAFGCILFQMIAGKPPF---KANNEYLTFQKV 375

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 65/251 (25%), Positives = 111/251 (44%), Gaps = 27/251 (10%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEY-----RTYKILAGT- 85
           ++ G+ +G+GS+  +   T + +G   A K   ++    Q K +Y      T + L  + 
Sbjct: 200 FKFGEALGDGSYSTVVLATCIESGKKYAAKILNKEYLIKQKKVKYVNIEKNTLQRLNSSR 259

Query: 86  -AGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRF---SVKTVVQVAVQMITLIED 141
             G+ + Y+  Q+   N+  +    P+ +  F    +RF   S +       Q++  I  
Sbjct: 260 VPGVIKLYFTFQDEA-NLYFLLEYAPNGD--FLSVMKRFGTLSEECTKYYGAQILDAIHH 316

Query: 142 LHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQY-RDPKTKQHIPYREKKSLSG 200
           LH   +I+RD+KP+N L+ +       K+ L DFG AK   R+ + K +      KS  G
Sbjct: 317 LHKQGIIHRDVKPENILLDK-----TMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFVG 371

Query: 201 TARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVT 260
           TA Y+S           R D+ A G + F  + G+ P+   KA N    ++K+    RV 
Sbjct: 372 TAEYVSPELLNDNYVDSRCDIWAFGCILFQMVAGKPPF---KATNEYLTFQKV---MRVQ 425

Query: 261 NVYDLAQGLPV 271
             Y    G P+
Sbjct: 426 --YAFTAGFPM 434

>YFR014C (CMK1) [1695] chr6 complement(172529..173869)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type I [1341 bp, 446 aa]
          Length = 446

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 88/178 (49%), Gaps = 14/178 (7%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKS---EAPQLKDEYRTYKILAGTAGI 88
           Y  GK +G G+FGV+ +  N   G  VA+K   +K+      QL+  Y    IL      
Sbjct: 37  YVFGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHH- 95

Query: 89  PQAYYFGQ--EGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDLHT 144
           P    F    E      +I  L    E LFD   ++  F+ +  V++ V++++ ++ +H+
Sbjct: 96  PNIVAFKDWFESKDKFYIITQLAKGGE-LFDRILKKGKFTEEDAVRILVEILSAVKYMHS 154

Query: 145 HDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 202
            ++++RD+KP+N L       DE+ + + DFG+AK+    K+ + + Y+   SL   A
Sbjct: 155 QNIVHRDLKPENLLY--IDKSDESPLVVADFGIAKRL---KSDEELLYKPAGSLGYVA 207

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 102/237 (43%), Gaps = 34/237 (14%)

Query: 28   VGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIK------FEPRKSEAPQLKDEYRTYKI 81
            V + ++    IG G+FG ++   N+ NG  +A+K          K   P +K+E    ++
Sbjct: 1030 VSMRWQKRSFIGGGTFGQVYSAINLENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEM 1089

Query: 82   LAGTAGIPQAYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRRFSVKTVVQV-AVQMI 136
            L     I Q  Y+G E +H    NI +    G SL  L D    R   + V QV   +++
Sbjct: 1090 L-NHPNIVQ--YYGVE-VHRDKVNIFMEYCEGGSLASLLD--HGRIEDEMVTQVYTFELL 1143

Query: 137  TLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQH------- 189
              +  LH   +++RDIKP+N L+   G      +  +DFG A+     +T+         
Sbjct: 1144 EGLAYLHQSGVVHRDIKPENILLDFNGI-----IKYVDFGTARTVVGSRTRTVRNAAVQD 1198

Query: 190  --IPYREKKSLSGTARYMSINTHLGREQSRR---DDMEALGHVFFYFLRGQLPWQGL 241
              +  +    + GT  YM+  T  G     +   DD+ ALG V      G+ PW  L
Sbjct: 1199 FGVETKSLNEMMGTPMYMAPETISGSAVKGKLGADDVWALGCVVLEMATGRRPWSNL 1255

>Sklu_2232.2 YOR061W, Contig c2232 1216-2340 reverse complement
          Length = 374

 Score = 57.4 bits (137), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 77/159 (48%), Gaps = 22/159 (13%)

Query: 31  HYRIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKSEAPQLKDEYRTYKILAGTAGIP 89
           +Y I  KIG G +  +F G +++N     IK  +P K     +K  YR  KIL   +G P
Sbjct: 85  NYEIVNKIGRGKYSEVFRGKSIVNDQACVIKVLKPVK-----MKKIYRELKILTNLSGGP 139

Query: 90  QAYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCGRRFSVKTVVQVAVQMITLIEDL 142
                   GL +I+      +  L+   + ++ F      F++  +     Q++  +E  
Sbjct: 140 NVI-----GLLDIVQDPGSKIPALIFEEVRNVDFRTLYPTFTLSDIQYYFTQLLIALEYC 194

Query: 143 HTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQY 181
           H+  +++RD+KP N +I     P E K+ LID+G+A+ Y
Sbjct: 195 HSMGIMHRDVKPQNVMID----PTERKLRLIDWGLAEFY 229

>Scas_711.25
          Length = 1515

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/270 (23%), Positives = 117/270 (43%), Gaps = 35/270 (12%)

Query: 35   GKKIGEGSFGVLFEGTNMINGVPVAIKF----------EPRKSEAPQLKDEYRTYKILAG 84
            G+ IG+GSFG ++   N+  G  +A+K           E   S    L+ E  T K L  
Sbjct: 1217 GEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQDEAIISTVEALRSEVSTLKDLDH 1276

Query: 85   TAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHT 144
               +    +  ++ ++++ +  + G S+  L    GR F    +  +  Q++  +  LH+
Sbjct: 1277 LNIVQYLGFENKDNIYSLFLEYVAGGSVGSLIRMYGR-FDEPLIRHLNTQVLRGLAYLHS 1335

Query: 145  HDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 204
              +++RD+K DN L+ + G        + DFG++++ +D  +   +  R      GT  +
Sbjct: 1336 RGILHRDMKADNLLLDQDGV-----CKISDFGISRKSKDIYSNSDMTMR------GTVFW 1384

Query: 205  MS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTN 261
            M+   ++T  G   S + D+ +LG +      G+ PW   +         KIG+ K    
Sbjct: 1385 MAPEMVDTKQG--YSAKVDIWSLGCIVLEMFAGKRPWSNYEV---VAAMFKIGKSKSAPP 1439

Query: 262  VYDLAQGLPVQFGR-YLEVVRSLAFEETPD 290
            +      L  Q GR +L+      FE  PD
Sbjct: 1440 IPPDTLPLISQNGRDFLDA----CFEIDPD 1465

>CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces
           cerevisiae YDL101c DUN1 protein kinase, start by
           similarity
          Length = 506

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 106/238 (44%), Gaps = 35/238 (14%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKSEAPQLKDEYRTYKILAGTAGIPQ 90
           Y +GK +G G + ++ E  N   G  VA+K F P++++  +   ++R    +      P 
Sbjct: 193 YLLGKDLGSGHYAIVKEAKNKTTGETVAVKIFHPQQNDDQKKNKQFREETTILMKIHHPN 252

Query: 91  AYYF--------GQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAV--QMITLIE 140
                        +  +   LV++ +     +LFD   ++ S+      A+  Q++T ++
Sbjct: 253 IVNLLDSFVEPISKTQIQKYLVLEKIDDG--ELFDRIVKKTSLPQEESKAIFKQILTGLK 310

Query: 141 DLHTHDLIYRDIKPDNFL--IGRPGTPDEN------------KVHLIDFGMAKQYRDPKT 186
            LH+ ++I+RDIKP+N L  I R  +PDE             +V + DFG+AK   + + 
Sbjct: 311 YLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIADFGLAKFTGEMQF 370

Query: 187 KQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAP 244
                     +L GT  Y++    + +  + + D+ + G + +  L G  P+     P
Sbjct: 371 TN--------TLCGTPSYVAPEVLVKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGP 420

>KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyveromyces
            lactis MAP kinase kinase kinase, start by similarity
          Length = 1338

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/222 (23%), Positives = 99/222 (44%), Gaps = 27/222 (12%)

Query: 35   GKKIGEGSFGVLFEGTNMINGVPVAIKF----------EPRKSEAPQLKDEYRTYKILAG 84
            G+ IG+GSFG ++   N+  G  +A+K           E   S    LK E  T K L  
Sbjct: 1041 GEIIGKGSFGAVYLALNVTTGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDLNH 1100

Query: 85   TAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHT 144
               +    +  + G++++ +  + G S+  L    GR F  + +  +  Q++  +  LH+
Sbjct: 1101 VNIVQYLGFEEKNGIYSLFLEYVAGGSVGSLIRMYGR-FDDQLIRHLTKQVLEGLAYLHS 1159

Query: 145  HDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 204
              +++RD+K DN L+   G        + DFG++++        +I      ++ GT  +
Sbjct: 1160 KGILHRDMKADNLLLDNDGV-----CKISDFGISRK------SNNIYSNSDMTMRGTVFW 1208

Query: 205  MS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 243
            M+   ++T  G   S + D+ +LG V      G+ PW   + 
Sbjct: 1209 MAPEMVDTAHG--YSAKVDIWSLGCVVLEMFAGKRPWSNFEV 1248

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 102/221 (46%), Gaps = 19/221 (8%)

Query: 28  VGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTAG 87
           V   ++  + IG G FGV+++G N+  G   AIK     S++ +++D  R  + LA    
Sbjct: 19  VSSLFKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQ 78

Query: 88  IPQ-AYYFG---QEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLH 143
           I     Y+G   ++    I++    G SL  L      +   K +  +  +++  ++ +H
Sbjct: 79  ISNITRYYGSYLKDTSLWIIMEHCAGGSLRSLLR--PGKIDEKYIGVIMRELLVALKCIH 136

Query: 144 THDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 203
             ++I+RDIK  N LI      +E  V L DFG+A Q      +       +++++GT  
Sbjct: 137 KDNVIHRDIKAANVLIT-----NEGNVKLCDFGVAAQVNQTSLR-------RQTMAGTPY 184

Query: 204 YMSINTHL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 243
           +M+    + G     + D+ +LG   +    G  P+  ++A
Sbjct: 185 WMAPEVIMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEA 225

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/251 (26%), Positives = 110/251 (43%), Gaps = 34/251 (13%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLK------DEYRTYKILAGT 85
           + I + +G GSFG +    ++ NG   AIK   +K++  ++K      DE R  K++   
Sbjct: 51  FHIMRTLGTGSFGRVHLVRSVHNGRYYAIKV-LKKAQVVKMKQIEHTNDERRMLKLVEHP 109

Query: 86  AGIPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHT 144
             I     F Q+  +  +V+D + G  L  L     +RF        A ++   +E LH 
Sbjct: 110 FLIRMWGTF-QDSRNLFMVMDYIEGGELFTLLR-KSQRFPNPVAKFYAAEVTLALEYLHF 167

Query: 145 HDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 204
           H++IYRD+KP+N L+ R G      + + DFG AK+                +L GT  Y
Sbjct: 168 HNIIYRDLKPENILLDRNG-----HIKITDFGFAKEVETVTW----------TLCGTPDY 212

Query: 205 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRV----- 259
           ++      +  ++  D  +LG + +  L G  P+         + YEKI   K V     
Sbjct: 213 IAPEVIATKPYNKSVDWWSLGVLIYEMLAGYTPFYD---TTPMKTYEKILHGKVVYPQFF 269

Query: 260 -TNVYDLAQGL 269
            ++V DL   L
Sbjct: 270 NSDVIDLLSKL 280

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 100/224 (44%), Gaps = 41/224 (18%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKSEAPQLKDEYRTYKILAGT---AG 87
           + IGK +G+G FG ++   +   G+  A+K  E ++     ++ ++R    + G+     
Sbjct: 100 FEIGKILGKGKFGKVYCVKHRETGLICALKAMEKKEIVQYTIQKQFRREVEIQGSFKHKN 159

Query: 88  IPQAYYFGQEGLHNILVIDLL------------GPSLEDLFDWCGRRFSVKTVVQVAVQM 135
           + Q Y F  +     L+++ +            GP  E L  +               QM
Sbjct: 160 LTQLYGFFYDEKRVYLLMEYVYYGELYKFLKNNGPLNETLASY------------FVYQM 207

Query: 136 ITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREK 195
              ++ +H+ ++++RDIKP+N LIG       N + L DFG +    D +        ++
Sbjct: 208 ANALDYMHSKNILHRDIKPENILIGF-----NNTIKLTDFGWSVYNEDGQ--------KR 254

Query: 196 KSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 239
           K+L GT  Y+S      RE + + D+ ALG + +  L G  P++
Sbjct: 255 KTLCGTIDYLSPELIKSREYNNKVDVWALGVLTYELLVGSPPFE 298

>Kwal_26.7635
          Length = 691

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 97/229 (42%), Gaps = 25/229 (10%)

Query: 32  YRIGKKIGEGSFGVLFE----GTNMINGVPVAIK-FEPRKSEAPQLKDEYRTYKILAGTA 86
           + + K IG+GSFG + +     TN +  +    K +   KSE      E      +    
Sbjct: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPF 417

Query: 87  GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKTVVQVAVQMITLIEDLHT 144
            +P  + F       I++  + G    +LF    R  RFS+        +++  +E LH 
Sbjct: 418 IVPLKFTFQSPDKLYIVLAFING---GELFYHLQREGRFSLSRARLYTAELLCALETLHN 474

Query: 145 HDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 204
            D+IYRD+KP+N L+   G      + L DFG+ K     + K +       +  GT  Y
Sbjct: 475 LDVIYRDLKPENILLDHQG-----HIALCDFGLCKLNMKGQDKTN-------TFCGTPEY 522

Query: 205 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 253
           ++    LG+  S+  D   LG + +  + G  P+     P   + Y+KI
Sbjct: 523 LAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVP---KMYKKI 568

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 105/229 (45%), Gaps = 24/229 (10%)

Query: 36  KKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKI----LAGTA---GI 88
           +++G GS+  ++      +    AIK   ++    + K +Y T +     L G A   GI
Sbjct: 14  EELGHGSYSTVYRVVERSSQHQYAIKICSKRHIIGENKVKYVTIEKNTLNLLGQANHPGI 73

Query: 89  PQAYY--FGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHD 146
            + YY    QE L+ ++ +   G  L+ L     R FS         Q++  +E +H+  
Sbjct: 74  IKLYYTFHDQENLYFVMDLAPGGELLQLLRR--QRVFSEAWARHYMCQLVDTVEYIHSMG 131

Query: 147 LIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQY--RDPKTKQHIPYREKKSLSGTARY 204
           +I+RD+KP+N L+ +     E ++ + DFG A      D  +    P     S  GTA Y
Sbjct: 132 VIHRDLKPENVLLDK-----EGRLMIADFGAAYTVGQSDAGSDGDKP---ATSFVGTAEY 183

Query: 205 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 253
           +S    L  +     D+ ALG + + FL+G  P++G    N  + +E+I
Sbjct: 184 VSPELLLENKSYYSSDVWALGCMLYQFLQGTPPFRG---QNEMETFEQI 229

>CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, hypothetical start
          Length = 442

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/217 (23%), Positives = 103/217 (47%), Gaps = 16/217 (7%)

Query: 24  DSTIVGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKS------EAPQLKDEYR 77
           +S +   +Y  GK +G G+FGV+ +         VA+K   +K+      +   L DE  
Sbjct: 37  ESYVSKSNYVFGKTLGAGTFGVVRQARYSPTNEDVAVKILLKKALKGNDVQLQMLYDELS 96

Query: 78  TYKILAGTAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMIT 137
             ++L     +    +F  +    I+    +G  L D     G+ F+ +  V + +Q+++
Sbjct: 97  ILQMLKHPNIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKGK-FTERDAVSITMQILS 155

Query: 138 LIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKS 197
            ++ +H+ ++++RD+KP+N L       D++++ + DFG+AKQ +D      + ++   S
Sbjct: 156 AVDYMHSKNVVHRDLKPENVLY--IDKSDDSQLVIADFGIAKQLQD---NDDLIFKAAGS 210

Query: 198 LSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRG 234
           L   A  +  N   G+      D+ ++G + +  L G
Sbjct: 211 LGYVAPEVLTNNGHGKPC----DIWSIGVIVYTLLCG 243

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 99/214 (46%), Gaps = 21/214 (9%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKSEAPQLKDEYRTYKILAGTAGIP- 89
           + IGK +G+G FG ++   ++ +G   A+K  E +      ++ ++R    +  +   P 
Sbjct: 109 FEIGKVLGKGKFGRVYCVRHIESGFVCALKAMEKKDIIQYNIEKQFRREVEIQSSLRHPN 168

Query: 90  --QAY-YFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAV-QMITLIEDLHTH 145
             Q Y YF  E    +L+  L+   L       GR      V    V QM   ++ +H  
Sbjct: 169 LTQLYGYFHDEKRVYLLMEYLVNGELYKHLK--GRSHFNDVVASYYVYQMADALDYMHER 226

Query: 146 DLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 205
           ++++RDIKP+N +IG       N + L DFG +     PK  +      +K+L GT  Y+
Sbjct: 227 NILHRDIKPENIIIGF-----NNTIKLTDFGWS--VITPKGSK------RKTLCGTVDYL 273

Query: 206 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 239
           S      RE + + D+ ALG + +  L G  P++
Sbjct: 274 SPELIRSREYNEKVDVWALGVLTYELLVGSPPFE 307

>Kwal_33.13846
          Length = 375

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 98/228 (42%), Gaps = 26/228 (11%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKS-----EAPQLKDEYRTYKILAGTA 86
           + I + +G GSFG +    +  NG   A+K   +++     +     DE R   +++   
Sbjct: 65  FHILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKRTIVKLKQVEHTNDERRMLSVVSHPF 124

Query: 87  GIPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTH 145
            I     F Q+  H  +++D + G  L  L     +RF        A ++   +E LH  
Sbjct: 125 IIRMWGTF-QDAEHVFMIMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVCLALEYLHAQ 182

Query: 146 DLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 205
           D+IYRD+KP+N L+ + G      V + DFG AK   D      + Y    +L GT  Y+
Sbjct: 183 DIIYRDLKPENVLLDKNG-----HVKITDFGFAKFVPD------VTY----TLCGTPDYI 227

Query: 206 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 253
           +      +  ++  D  + G + F  L G  P+      N  + YE I
Sbjct: 228 APEVVSTKPYNKSVDWWSFGILIFEMLAGYTPFYD---SNTMKTYENI 272

>YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine
           protein kinase with similarity to Cmk1p, Cmk2p, and
           Cmk3p [1539 bp, 512 aa]
          Length = 512

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 104/248 (41%), Gaps = 51/248 (20%)

Query: 31  HYRIGKKIGEGSFGVLFE--GTNMINGVPVAIKFEPRK----------------SEAPQL 72
           +Y++  KIGEG+F  +F+  G N  +  PVAIK   +K                S   ++
Sbjct: 120 NYKLLNKIGEGAFSRVFKAVGINTDDQAPVAIKAIIKKGISSDAILKGNDRIQGSSRKKV 179

Query: 73  KDEYRTYKILA-GTAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKTVV 129
            +E   +K+++       +   F +   +  LV +L+     ++FD   +   FS     
Sbjct: 180 LNEVAIHKLVSKNNPHCTKFIAFQESANYYYLVTELVTGG--EIFDRIVQLTCFSEDLAR 237

Query: 130 QVAVQMITLIEDLHTHDLIYRDIKPDNFLI---------GRPGTPDE----------NKV 170
            V  Q+   I+ +H   +++RD+KP+N L          G     DE            V
Sbjct: 238 HVITQVAIAIKHMHYMGIVHRDVKPENLLFEPIPFYGLDGDMQKEDEFTLGVGGGGIGLV 297

Query: 171 HLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFY 230
            L+DFG+AK+ R+            K+  GT  Y++      +  S + DM ++G V F 
Sbjct: 298 KLMDFGLAKKLRN---------NTAKTPCGTIEYVASEVFTSKRYSMKVDMWSIGCVLFT 348

Query: 231 FLRGQLPW 238
            L G  P+
Sbjct: 349 LLCGYPPF 356

>ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH]
           complement(1062595..1063614) [1020 bp, 339 aa]
          Length = 339

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 77/159 (48%), Gaps = 22/159 (13%)

Query: 31  HYRIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKSEAPQLKDEYRTYKILAGTAGIP 89
           +Y I  KIG G +  +F G +++N  P  IK  +P K     +K  YR  KIL    G P
Sbjct: 49  NYEIINKIGRGKYSEVFRGKSIVNDHPCVIKVLKPVK-----MKKIYRELKILTNLTGGP 103

Query: 90  QAYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCGRRFSVKTVVQVAVQMITLIEDL 142
                   GL +I+      +  L+   ++++ F      F++        Q++  ++  
Sbjct: 104 NII-----GLLDIVQDPGSKIPALIFEEVKNVEFRTLYPAFTLSDTQHYFKQLLIALDYC 158

Query: 143 HTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQY 181
           H+  +++RD+KP N +I     P E K+ LID+G+A+ Y
Sbjct: 159 HSMGIMHRDVKPQNVMID----PTERKLRLIDWGLAEFY 193

>CAGL0K03399g complement(310487..312598) highly similar to sp|P12688
           Saccharomyces cerevisiae YKL126w
           Serine/threonine-protein kinase, start by similarity
          Length = 703

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 97/230 (42%), Gaps = 27/230 (11%)

Query: 32  YRIGKKIGEGSFGVLFE----GTNMINGVPVAIK-FEPRKSEAPQLKDEYRTYKILAGTA 86
           + + K IG+GSFG + +     T  I  +    K +   KSE      E      +    
Sbjct: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPF 429

Query: 87  GIPQAYYF-GQEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKTVVQVAVQMITLIEDLH 143
            +P  + F  QE L+ +L     G    +LF    R  RF +      A +++  ++ LH
Sbjct: 430 IVPLKFSFQSQEKLYLVLACINGG----ELFYHLQREGRFDLSRSRFYAAELLCALDTLH 485

Query: 144 THDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 203
             D+IYRD+KP+N L+   G      + L DFG+ K     + K         +  GT  
Sbjct: 486 KMDVIYRDLKPENILLDYQG-----HIALCDFGLCKLNMKDEDKT-------DTFCGTPE 533

Query: 204 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 253
           Y++    LG+  S+  D   LG + +  L G  P+     P   + Y+KI
Sbjct: 534 YLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVP---KMYKKI 580

>YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine
           protein kinase with similarity to mammalian
           3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk2p, required for
           endocytosis [3246 bp, 1081 aa]
          Length = 1081

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 64/143 (44%), Gaps = 20/143 (13%)

Query: 115 LFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLID 174
           L + C R +        A Q+I  I+ LH++ +I+RDIKP+N L+       E K+ L D
Sbjct: 275 LDETCARYY--------AAQIIDAIDYLHSNGIIHRDIKPENILLD-----GEMKIKLTD 321

Query: 175 FGMAKQYRDPKTKQHIP----YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFY 230
           FG AK           P        KS  GTA Y+S           R D+ A G + F 
Sbjct: 322 FGTAKLLNPTNNSVSKPEYDLSTRSKSFVGTAEYVSPELLNDSFTDYRCDIWAFGCILFQ 381

Query: 231 FLRGQLPWQGLKAPNNKQKYEKI 253
            + G+ P+   KA N    ++K+
Sbjct: 382 MIAGKPPF---KATNEYLTFQKV 401

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 99/222 (44%), Gaps = 27/222 (12%)

Query: 35   GKKIGEGSFGVLFEGTNMINGVPVAIKF----------EPRKSEAPQLKDEYRTYKILAG 84
            G+ IG+GSFG ++ G N+  G  +A+K           E   + A  L  E  T K L  
Sbjct: 1127 GEMIGKGSFGAVYLGLNVTTGEMMAVKQVEVPKFGSQDETTVNNAEALISEVSTLKDLDH 1186

Query: 85   TAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHT 144
               +    +  +  ++++ +  + G S+  L    G  F  + +  +  Q++  +  LH 
Sbjct: 1187 LNIVQYLGFENKNCIYSLFLEYVAGGSVGSLIRLYG-HFDEQLIRFLTTQVLEGLAYLHL 1245

Query: 145  HDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 204
              +++RD+K DN L+   G        + DFG++++        +I    + ++ GT  +
Sbjct: 1246 RGILHRDMKADNLLLDNDGV-----CKISDFGISRK------SNNIYSNSEMTMRGTVFW 1294

Query: 205  MS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 243
            M+   ++T  G   S + D+ +LG V      G+ PW  L+ 
Sbjct: 1295 MAPEMVDTTQG--YSAKVDIWSLGCVVLEMFAGKRPWSNLEV 1334

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 100/228 (43%), Gaps = 33/228 (14%)

Query: 28  VGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTAG 87
           +   ++  + IG G FG++++G ++      AIK     S   +++D  R  + LA    
Sbjct: 12  ISSTFKRTEVIGRGKFGIVYKGYHVKTKQVYAIKVLNLDSSEDEVEDVQREIQFLASLKQ 71

Query: 88  IPQ-AYYFGQEGLHNILVIDLLGPSLEDLFDWCG----------RRFSVKTVVQVAVQMI 136
           IP    Y+G           L G SL  + ++C            +   K +  +  +++
Sbjct: 72  IPNITRYYGSY---------LRGTSLWIIMEYCAGGSLRSLLRPGKIDEKYIGVIMRELL 122

Query: 137 TLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKK 196
             ++ +H  ++I+RDIK  N LI      +E +V L DFG+A Q      +       ++
Sbjct: 123 VALKVIHKDNVIHRDIKAANVLIT-----NEGQVKLCDFGVAAQLNQTSLR-------RQ 170

Query: 197 SLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 243
           +++GT  +M+    + G     + D+ +LG   +    G  P+  ++A
Sbjct: 171 TMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEA 218

>Scas_690.13
          Length = 354

 Score = 55.1 bits (131), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 107/235 (45%), Gaps = 28/235 (11%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLK------DEYRTYKILAGT 85
           +++ + +G GSFG +    ++ NG   AIK   +K +  ++K      DE R  K++   
Sbjct: 44  FQVMRTLGTGSFGRVHLVRSVHNGRYYAIKVL-KKQQVVRMKQIEHTNDERRMLKLVEHP 102

Query: 86  AGIPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHT 144
             I     F Q+  +  +V+D + G  L  L     +RF        A ++   +E LH+
Sbjct: 103 FLIRMWGTF-QDSRNLFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVTLGLEYLHS 160

Query: 145 HDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 204
           H++IYRD+KP+N L+ R G      + + DFG AK+  D  T          +L G   Y
Sbjct: 161 HNIIYRDLKPENILLDRNG-----HIKITDFGFAKEV-DTVT---------WTLCGPPDY 205

Query: 205 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRV 259
           ++      +  ++  D  +LG + F  L G  P+         + YEKI + K V
Sbjct: 206 IAPEVIATKPYNKSVDWWSLGVLIFEMLAGYTPFYDTTP---MKTYEKILQGKVV 257

>YOR061W (CKA2) [4869] chr15 (441535..442554) Casein kinase II
           (Protein kinase CK2), catalytic (alpha-prime) subunit
           [1020 bp, 339 aa]
          Length = 339

 Score = 55.1 bits (131), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 76/159 (47%), Gaps = 22/159 (13%)

Query: 31  HYRIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKSEAPQLKDEYRTYKILAGTAGIP 89
           +Y I  KIG G +  +F G  ++N     IK  +P K     +K  YR  KIL    G P
Sbjct: 49  NYEIINKIGRGKYSEVFSGRCIVNNQKCVIKVLKPVK-----MKKIYRELKILTNLTGGP 103

Query: 90  QAYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCGRRFSVKTVVQVAVQMITLIEDL 142
                   GL++I+      +  L+   ++++ F      F +  +     Q++  ++  
Sbjct: 104 NVV-----GLYDIVQDADSKIPALIFEEIKNVDFRTLYPTFKLPDIQYYFTQLLIALDYC 158

Query: 143 HTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQY 181
           H+  +++RD+KP N +I     P E K+ LID+G+A+ Y
Sbjct: 159 HSMGIMHRDVKPQNVMID----PTERKLRLIDWGLAEFY 193

>YOL016C (CMK2) [4800] chr15 complement(294777..296120)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type II [1344 bp, 447 aa]
          Length = 447

 Score = 55.1 bits (131), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 100/215 (46%), Gaps = 18/215 (8%)

Query: 31  HYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKS---EAPQLKDEYRTYKILAGTAG 87
           +Y  G+ +G GSFGV+ +   +     VAIK   +K+      QL+  Y    IL   + 
Sbjct: 46  NYIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQMLYEELSILQKLSH 105

Query: 88  IPQAYYFGQ--EGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDLH 143
            P    F    E      ++  L    E LFD    R  F+    V++ VQ++  +E +H
Sbjct: 106 -PNIVSFKDWFESKDKFYIVTQLATGGE-LFDRILSRGKFTEVDAVEIIVQILGAVEYMH 163

Query: 144 THDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 203
           + ++++RD+KP+N L       + + + + DFG+AKQ    K ++ + Y+     +G+  
Sbjct: 164 SKNVVHRDLKPENVLY--VDKSENSPLVIADFGIAKQL---KGEEDLIYKA----AGSLG 214

Query: 204 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 238
           Y++          +  D+ ++G + +  L G  P+
Sbjct: 215 YVAPEVLTQDGHGKPCDIWSIGVITYTLLCGYSPF 249

>CAGL0K06479g 636296..639271 some similarities with tr|Q03306
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 991

 Score = 55.5 bits (132), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 107/244 (43%), Gaps = 35/244 (14%)

Query: 36  KKIGEGSFGVLFEGTNMINGV-PVAIKFEPRKSEAPQLKDEY-----RTYKILA--GTAG 87
           +++G GS+  +++  +  +   P AIK   ++    + K +Y      T  +LA     G
Sbjct: 15  EELGHGSYSTVYKALDKKDLKKPYAIKVCSKRHIIKEAKVKYVTIEKNTLNLLARGNHPG 74

Query: 88  IPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHD 146
           I + YY   +  +   V+D   G  L  L    G  F+       A Q++  +E +H   
Sbjct: 75  IVKLYYTFHDEENLYFVLDYASGGELLSLLHKMGT-FTDSWAKHFAAQLVDTLEFMHARG 133

Query: 147 LIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQH--------IP------- 191
           +I+RD+KP+N L+ + G      + + DFG A    +   K +        IP       
Sbjct: 134 VIHRDLKPENVLLSKEGI-----LMITDFGAAATQNNFSDKDNTRSNANEGIPKDDVPSS 188

Query: 192 --YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQK 249
               E  S  GTA Y+S    L  + S   D+ ALG + + F++G  P++G    N  + 
Sbjct: 189 GDKTECSSFVGTAEYVSPELLLYNKCSFGSDIWALGCMVYQFIQGFPPFRG---ENELKT 245

Query: 250 YEKI 253
           +EKI
Sbjct: 246 FEKI 249

>KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces
           cerevisiae YKL126w YPK1 ser/thr-specific protein kinase,
           start by similarity
          Length = 716

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 96/230 (41%), Gaps = 27/230 (11%)

Query: 32  YRIGKKIGEGSFGVLFE----GTNMINGVPVAIK-FEPRKSEAPQLKDEYRTYKILAGTA 86
           + + K IG+GSFG + +     TN I  +    K +   KSE      E      +    
Sbjct: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 441

Query: 87  GIPQAYYF-GQEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKTVVQVAVQMITLIEDLH 143
            +P  + F   E L+ +L     G    +LF    R  RF +        +++  +E LH
Sbjct: 442 IVPLKFSFQSSEKLYLVLAFINGG----ELFYHLQREGRFDLSRSRFYTAELLCALEALH 497

Query: 144 THDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 203
             D+IYRD+KP+N L+   G      + L DFG+ K     + K         +  GT  
Sbjct: 498 DFDIIYRDLKPENILLDYQG-----HIALCDFGLCKLNMKDQEKT-------TTFCGTPE 545

Query: 204 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 253
           Y++    LG+  ++  D   LG + +  L G  P+     P   + Y+KI
Sbjct: 546 YLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVP---KMYKKI 592

>AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..90211)
           [1419 bp, 472 aa]
          Length = 472

 Score = 54.7 bits (130), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 108/238 (45%), Gaps = 35/238 (14%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKSEAPQLKDEYRT-YKILAG----- 84
           Y  GK++G G + ++ E  N I G  VA+K F P+K++  +   ++R   KIL G     
Sbjct: 155 YIPGKELGSGHYAIVKEAINKITGQSVAVKIFHPQKNDDAKKTRQFREETKILMGLNHEN 214

Query: 85  TAGIPQAYY--FGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAV--QMITLIE 140
              + + +     +  +   LV++ +     +LFD   R+  +      A+  Q++  ++
Sbjct: 215 IVKLLERFVEPLSKSQVQTYLVLEKIQDG--ELFDKIVRKTKLHQDETRALFKQILAGLK 272

Query: 141 DLHTHDLIYRDIKPDNFL--IGRPGTPDENK------------VHLIDFGMAKQYRDPKT 186
            LH  ++I+RDIKP+N L  I R  +PD+ +            V + DFG+AK   +   
Sbjct: 273 YLHDRNIIHRDIKPENILLSIRRRTSPDQVQLGPWDEDELDITVKIADFGLAKFTGE--- 329

Query: 187 KQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAP 244
                 +   +L GT  Y++         + + D+ + G + +  L G  P+    AP
Sbjct: 330 -----MQFTTTLCGTPSYVAAEVLTKTGYTSKVDLWSAGVLLYVCLCGFPPFSDQLAP 382

>Scas_689.25*
          Length = 409

 Score = 54.7 bits (130), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 95/214 (44%), Gaps = 25/214 (11%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKS-----EAPQLKDEYRTYKILAGTA 86
           + I +  G GSFG +    ++ NG   A+K   +++     +     DE R   + +  A
Sbjct: 99  FNILRTSGTGSFGRVHLVRSVHNGRFYALKVLKKQTVVRLKQVEHTNDERRMLSV-SVHA 157

Query: 87  GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKTVVQVAVQMITLIEDLHT 144
            I + +   Q+  H  +++D +     +LF    R  RF        A ++   ++ LH+
Sbjct: 158 FIVRLWGTFQDSEHLFMIMDYVEGG--ELFSLLRRSQRFPNPVAKFYAAEVCLALDYLHS 215

Query: 145 HDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 204
            D+IYRD+KP+N L+ R G      + + DFG AK   D      + Y    +L GT  Y
Sbjct: 216 LDIIYRDLKPENLLLDRNG-----HIKVTDFGFAKYVPD------VTY----TLCGTPDY 260

Query: 205 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 238
           ++      +  ++  D  + G + +  L G  P+
Sbjct: 261 IAPEVISAKPYNKSVDWWSFGILIYEMLSGHTPF 294

>YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway that is probably
           parallel to cAMP pathway, affects life span [2475 bp,
           824 aa]
          Length = 824

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 18/134 (13%)

Query: 122 RFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQY 181
           RFS         +++  +E LH +D++YRD+KP+N L+   G      + L DFG++K  
Sbjct: 509 RFSEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILLDANG-----NIALCDFGLSKAD 563

Query: 182 RDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQG 240
              +T          +  GT  Y++    L     ++  D  +LG + F    G   W  
Sbjct: 564 LKDRT---------NTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCG---WSP 611

Query: 241 LKAPNNKQKYEKIG 254
             A NN++ Y+KI 
Sbjct: 612 FFAENNQKMYQKIA 625

>ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C
           (YPK2) - SH] complement(345955..348123) [2169 bp, 722
           aa]
          Length = 722

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 98/234 (41%), Gaps = 35/234 (14%)

Query: 32  YRIGKKIGEGSFGVLFE----GTNMINGVPVAIK-FEPRKSEAPQLKDEYRTYKILAGTA 86
           + + K IG+GSFG + +     TN I  +    K +   KSE      E      +    
Sbjct: 389 FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 448

Query: 87  GIPQAYYF-GQEGLHNILVIDLLGPSL------EDLFDWCGRRFSVKTVVQVAVQMITLI 139
            +P  + F   E L+ +L   + G  L      E  FD    RF          +++  +
Sbjct: 449 IVPLKFSFQSPEKLYLVLAF-INGGELFFHLQKEGRFDLSRARF-------YTAELLCAL 500

Query: 140 EDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLS 199
           E LH+ ++IYRD+KP+N L+   G      + L DFG+ K     + K +       +  
Sbjct: 501 ETLHSLNVIYRDLKPENILLDYQG-----HIALCDFGLCKLNMKDQDKTN-------TFC 548

Query: 200 GTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 253
           GT  Y++    LG+  S+  D   LG + +  L G  P+     P   + Y+KI
Sbjct: 549 GTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVP---KMYKKI 599

>Scas_720.94
          Length = 1683

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 109/253 (43%), Gaps = 49/253 (19%)

Query: 25   STIVGLHYRIGKK--IGEGSFGVLFEGTNMINGVPVAIK------FEPRKSEAPQLKDEY 76
            S+I  L  R  K+  IG G+FG ++   N+ NG  +A+K       +  K   P +K+E 
Sbjct: 1352 SSISNLSIRWQKRNFIGGGTFGTVYSAVNLDNGEILAVKEIKIQDSKTMKKIFPLVKEEM 1411

Query: 77   RTYKILAGTAGIPQAYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRRFSVKTVVQV- 131
               ++L     I Q  Y+G E +H    NI +    G S+  L +    R   + V QV 
Sbjct: 1412 TVLEML-NHPNIVQ--YYGVE-VHRDKVNIFMEYCEGGSMASLLE--HGRIEDEMVTQVY 1465

Query: 132  AVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIP 191
             ++++  +  LH   +++RDIKP+N L+   G      +  +DFG A++     TK  + 
Sbjct: 1466 TLELLEGLAYLHQAGVVHRDIKPENILLDFNGI-----IKYVDFGAARKIAKNGTK--VT 1518

Query: 192  YREKKS--------------------LSGTARYM---SINTHLGREQSRRDDMEALGHVF 228
                KS                    + GT  YM   SI  +  + +   DD+ + G V 
Sbjct: 1519 NINSKSKDDDEPDEKDTEGGANSVHDMLGTPMYMAPESITGYKNKTKFGSDDIWSFGCVV 1578

Query: 229  FYFLRGQLPWQGL 241
               + G+ PW  L
Sbjct: 1579 LEMITGRRPWANL 1591

>CAGL0G02035g 179911..180930 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 339

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 76/159 (47%), Gaps = 22/159 (13%)

Query: 31  HYRIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKSEAPQLKDEYRTYKILAGTAGIP 89
           +Y I  KIG G +  +F G  + N  P  IK  +P K     +K  YR  KIL    G P
Sbjct: 49  NYEIVTKIGRGKYSEVFSGKCITNDQPCVIKVLKPVK-----MKKIYRELKILTNLTGGP 103

Query: 90  QAYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCGRRFSVKTVVQVAVQMITLIEDL 142
                   GL +I+      +  L+   +++  F      F+++ +     Q++  ++  
Sbjct: 104 NVI-----GLLDIVQDQASKIPALIFEEVKNADFRTLYPSFTLQDLQYYFTQLLIALDYC 158

Query: 143 HTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQY 181
           H+  +++RD+KP N +I     P + K+ LID+G+A+ Y
Sbjct: 159 HSMGIMHRDVKPQNVMID----PAQKKLRLIDWGLAEFY 193

>Sklu_2430.5 YKL126W, Contig c2430 8144-10345
          Length = 733

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 98/230 (42%), Gaps = 27/230 (11%)

Query: 32  YRIGKKIGEGSFGVLFE----GTNMINGVPVAIK-FEPRKSEAPQLKDEYRTYKILAGTA 86
           + + K IG+GSFG + +     TN I  +    K +   KSE      E      +    
Sbjct: 400 FDLLKVIGKGSFGKVMQVRKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 459

Query: 87  GIPQAYYF-GQEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKTVVQVAVQMITLIEDLH 143
            +P  + F   E L+ +L     G    +LF    +  RF +        +++  +E LH
Sbjct: 460 IVPLKFSFQSPEKLYLVLAFINGG----ELFYHLQKEGRFDLSRARFYTAELLCALETLH 515

Query: 144 THDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 203
           + ++IYRD+KP+N L+   G      + L DFG+ K     + K +       +  GT  
Sbjct: 516 SLNVIYRDLKPENILLDYQG-----HIALCDFGLCKLNMQDQDKTN-------TFCGTPE 563

Query: 204 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 253
           Y++    LG+  S+  D   LG + +  L G  P+     P   + Y+KI
Sbjct: 564 YLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVP---KMYKKI 610

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 105/237 (44%), Gaps = 28/237 (11%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPV-AIKFEPRKSEAPQLKDEYRTYK------ILAG 84
           ++ G  +G+GS+  +F  T+  +     A+K   ++    Q K +Y   +      + + 
Sbjct: 118 FKFGDMLGDGSYSQVFLATSKTDSSKTYAVKVLNKEYLIKQKKVKYVNIEKTALQNLKSV 177

Query: 85  TAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSV---KTVVQVAVQMITLIED 141
           T  I  ++ F  E   N+  +    P+ +  F    ++F     +  +  + Q+I  I  
Sbjct: 178 TGVINLSFTFQDEA--NLYFLLEYAPNGD--FLSLIKKFGTLNEECTIYYSAQIIDAIGS 233

Query: 142 LHTHDLIYRDIKPDNFLIGRPGTPDEN-KVHLIDFGMAKQYRDPKTKQHIPY----REKK 196
           +H+H +I+RDIKP+N L+      D N K+ L DFG AK  +    K   P+        
Sbjct: 234 MHSHGIIHRDIKPENILL------DGNMKIKLTDFGTAKLLQKKSDKNGKPHYNLLTRSS 287

Query: 197 SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 253
           S  GTA Y+S           + D+ A G + +  + G+ P+   KA N    ++K+
Sbjct: 288 SFVGTAEYVSPELLSDNYTDYKCDIWAFGCLVYQMIAGKPPF---KATNEYLTFQKV 341

>Scas_613.5
          Length = 517

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 102/233 (43%), Gaps = 37/233 (15%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKSEAPQLKDEYRTYKILAGTAGIPQ 90
           Y +GK +G G +  + EG N + G  VA+K F P++++  +   ++R    +      P 
Sbjct: 204 YVLGKDLGSGHYATVKEGINKVTGQTVAVKIFHPQQNDDEKKSKQFREETNILMRIHHPN 263

Query: 91  AY----YF----GQEGLHNILVIDLL--GPSLEDLF-DWCGRRFSVKTVVQVAVQMITLI 139
                 +F     +  +   LV+D +  G   E +    C R+   K +     Q++  +
Sbjct: 264 IVNLLDFFIEPVSKSQIQKYLVLDKIDDGELFERIVKKTCLRQDETKAIFN---QILMGL 320

Query: 140 EDLHTHDLIYRDIKPDNFL--IGRPGTPDEN------------KVHLIDFGMAKQYRDPK 185
           + LH  ++I+RDIKP+N L  I R   P++             +V + DFG+AK   +  
Sbjct: 321 KHLHQQNIIHRDIKPENILLNITRRTNPEQKQLGPWDEDEIDIQVKIADFGLAKFTGE-- 378

Query: 186 TKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 238
                  +   +L GT  Y++      +  + + DM + G + +  L G  P+
Sbjct: 379 ------MQFTNTLCGTPSYVAPEVLTKKGYTSKVDMWSAGVILYVCLCGFPPF 425

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 101/229 (44%), Gaps = 28/229 (12%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLK------DEYRTYKILAGT 85
           ++I + +G GSFG +    +  NG   A+K   +K    +LK      DE R   I++  
Sbjct: 152 FQILRTLGTGSFGRVHLIRSNHNGRFYALK-ALKKHTVVKLKQVEHTNDERRMLSIVSHP 210

Query: 86  AGIPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHT 144
             I     F Q+  H  +V+D + G  L  L     +RF        A ++   +E LH+
Sbjct: 211 FIIRMWGTF-QDSQHVFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVCLALEYLHS 268

Query: 145 HDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 204
            ++IYRD+KP+N L+ + G      + + DFG AK   D      + Y    +L GT  Y
Sbjct: 269 KEIIYRDLKPENILLDKNG-----HIKITDFGFAKYVPD------VTY----TLCGTPDY 313

Query: 205 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 253
           ++      +  ++  D  + G + +  L G  P+      N  + YE I
Sbjct: 314 IAPEVVSTKPYNKSVDWWSFGILIYEMLAGYTPFYD---ANTMKTYEHI 359

>Scas_673.20*
          Length = 758

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 92/217 (42%), Gaps = 32/217 (14%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTAGIPQA 91
           YR  K+IGEG+ G+++    +   + VAIK    K + P+L+  +    +L         
Sbjct: 481 YRKLKRIGEGASGIVYTAYEIGTDISVAIKQIDLKIQ-PRLQMIWTEMLVLKEYQHPNII 539

Query: 92  YYFGQEGLHNILVIDLL---GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED------- 141
            +     LH+ L I +    G SL D+         V        QM T+  +       
Sbjct: 540 NFINSYLLHDTLWIVMEYMDGGSLADI---------VSFFTPTEEQMATICRETLFGLNF 590

Query: 142 LHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 201
           LH+  +++RDIK DN L+   G      + + DFG   Q  +  TK       + ++ GT
Sbjct: 591 LHSRGIVHRDIKSDNILLSMNG-----DIKITDFGFCGQLTESNTK-------RTTMVGT 638

Query: 202 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 238
             +M+      +E   + D+ +LG +    + G+ P+
Sbjct: 639 PYWMAPEVIASKEYGPKVDVWSLGIMIIEMIEGEPPY 675

>YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic
           subunit of cAMP-dependent protein kinase 1, protein
           kinase A or PKA [1194 bp, 397 aa]
          Length = 397

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 100/234 (42%), Gaps = 26/234 (11%)

Query: 26  TIVGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIK-----FEPRKSEAPQLKDEYRTYK 80
           +IV  +++I + +G GSFG +    +  NG   A+K        R  +     DE     
Sbjct: 81  SIVYKNFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLS 140

Query: 81  ILAGTAGIPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLI 139
           I+     I     F Q+     +++D + G  L  L     +RF        A ++   +
Sbjct: 141 IVTHPFIIRMWGTF-QDAQQIFMIMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVCLAL 198

Query: 140 EDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLS 199
           E LH+ D+IYRD+KP+N L+ + G      + + DFG AK   D      + Y    +L 
Sbjct: 199 EYLHSKDIIYRDLKPENILLDKNG-----HIKITDFGFAKYVPD------VTY----TLC 243

Query: 200 GTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 253
           GT  Y++      +  ++  D  + G + +  L G  P+      N  + YEKI
Sbjct: 244 GTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYD---SNTMKTYEKI 294

>YPL141C (YPL141C) [5305] chr16 complement(283463..286060)
           Serine/threonine protein kinase with similarity to Kin4p
           [2598 bp, 865 aa]
          Length = 865

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/269 (23%), Positives = 112/269 (41%), Gaps = 50/269 (18%)

Query: 32  YRIGKKIGEGSFGVLFEG-----TNMINGV-----PVAIKFEPRKSEAPQLKDEYRTYKI 81
           Y +G  +GEG FG +  G     +N  N        VAIK   R S +   + E + Y+ 
Sbjct: 41  YILGSTLGEGEFGKVKLGWPKNFSNSSNSTFDFPKQVAIKLIKRDSISNDYRKEVKIYRE 100

Query: 82  LAGTAGIPQAYYFG-QEGLHNILVIDLLGPSLEDLFDWCG----------RRFSVKTVVQ 130
           +     +        +E L N   I ++      L   CG          RR       +
Sbjct: 101 INALKHLSHPNIVKLEEVLQNSRYIGIV------LEYACGGEFYKYIQKKRRLKEMNACR 154

Query: 131 VAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHI 190
           +  Q+I+ +  +H+  L++RD+K +N L+ +    +EN V + DFG   ++    ++  +
Sbjct: 155 LFSQLISGVHYIHSKGLVHRDLKLENLLLDK----NENLV-ITDFGFVNEF---CSRNEL 206

Query: 191 PYREKKSLSGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQ 248
                K+  G+  Y +    +  E  ++R+ D+ + G + +  L G LPW     PNN  
Sbjct: 207 ----MKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAILAGYLPWDD--DPNN-- 258

Query: 249 KYEKIGEKKRVTNVYDLAQGLPVQFGRYL 277
                 E   +  +Y+     P++F  Y+
Sbjct: 259 -----PEGSDIGRLYNYINSTPLKFPDYI 282

>CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces
           cerevisiae YBR028c, start by similarity
          Length = 542

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 67/139 (48%), Gaps = 14/139 (10%)

Query: 127 TVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKT 186
           TV   A ++   ++ LH+  ++YRD+KP+N L+ + G      + L DFG++K      +
Sbjct: 271 TVAFYAAEISCALKFLHSKGVVYRDLKPENCLLNQNG-----HLVLTDFGLSKSSASNAS 325

Query: 187 KQHI-------PYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 239
           ++ +          E  S+ GT  Y +    LG+  +   D  +LG + +  L G+ P+ 
Sbjct: 326 QEDLGAGNEGEDVNELHSIIGTPEYCAPEILLGQPYTANCDWYSLGCLLYDMLTGKPPYT 385

Query: 240 GL--KAPNNKQKYEKIGEK 256
           G   K   NK K +K G K
Sbjct: 386 GANHKVIANKIKNDKQGPK 404

>KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, start by similarity
          Length = 427

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 96/214 (44%), Gaps = 18/214 (8%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKS---EAPQLKDEYRTYKILAGTAGI 88
           Y  GK +G G+FGV+ +   + +G  VA+K   +K+   ++ QL+  Y    IL      
Sbjct: 46  YIFGKTLGAGTFGVVRQARCISSGENVAVKILLKKALKGQSVQLQMLYDELSILQ-QLNH 104

Query: 89  PQAYYFGQ--EGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDLHT 144
           P    F    E      ++  L    E LFD    +  F     V +  Q++  ++ LH 
Sbjct: 105 PNIVRFKDWFESKEKFYIVTQLATGGE-LFDRILEKGKFCEVDAVFIVKQILQGVQYLHQ 163

Query: 145 HDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 204
            ++++RD+KP+N L       D++ + + DFG+AK+ +D     H         +G+  Y
Sbjct: 164 RNIVHRDLKPENIL--YLNKSDDSPLVIGDFGIAKELKDDNELIH-------KAAGSMGY 214

Query: 205 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 238
           ++          +  D+ ++G + +  L G  P+
Sbjct: 215 VAPEVLTSSGHGKPCDIWSIGVITYTLLCGYSPF 248

>YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic
           subunit of cAMP-dependent protein kinase 3, protein
           kinase A or PKA [1197 bp, 398 aa]
          Length = 398

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 98/228 (42%), Gaps = 26/228 (11%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKS-----EAPQLKDEYRTYKILAGTA 86
           ++I + +G GSFG +    +  NG   A+K   + +     +     DE R   I++   
Sbjct: 88  FQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPF 147

Query: 87  GIPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTH 145
            I     F Q+     +V+D + G  L  L     +RF        A ++   +E LH+ 
Sbjct: 148 IIRMWGTF-QDSQQVFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVCLALEYLHSK 205

Query: 146 DLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 205
           D+IYRD+KP+N L+ + G      + + DFG AK   D      + Y    +L GT  Y+
Sbjct: 206 DIIYRDLKPENILLDKNG-----HIKITDFGFAKYVPD------VTY----TLCGTPDYI 250

Query: 206 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 253
           +      +  ++  D  + G + +  L G  P+      N  + YE I
Sbjct: 251 APEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYN---SNTMKTYENI 295

>Scas_580.6
          Length = 1015

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 99/228 (43%), Gaps = 33/228 (14%)

Query: 28  VGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTAG 87
           V   +R  + IG G FG++++G ++      AIK     S+  +++D  R  + L+    
Sbjct: 33  VNSMFRRTEVIGRGKFGIVYKGYHVRTKQIYAIKVLNLDSDEDEVEDVQREVQFLSSLKQ 92

Query: 88  IPQ-AYYFGQEGLHNILVIDLLGPSLEDLFDWCG----------RRFSVKTVVQVAVQMI 136
           IP    Y+G           L   SL  + ++C            +   K +  +  +++
Sbjct: 93  IPNITRYYGSY---------LKDTSLWIIMEYCAGGSLRSLLRPGKIDEKYIGVIMRELL 143

Query: 137 TLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKK 196
             ++ +H  ++I+RDIK  N LI      +E  V L DFG+A Q      +       ++
Sbjct: 144 VALKYIHKDNVIHRDIKAANVLIT-----NEGSVKLCDFGVAAQLNQSTLR-------RQ 191

Query: 197 SLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 243
           +++GT  +M+    + G     + D+ +LG   +    G  P+  ++A
Sbjct: 192 TMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEA 239

>YBR028C (YBR028C) [220] chr2 complement(294387..295964)
           Serine/threonine protein kinase with similarity to
           Ypk2p/Ykr2p and Ypk1p [1578 bp, 525 aa]
          Length = 525

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 66/135 (48%), Gaps = 11/135 (8%)

Query: 127 TVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQ-YRDPK 185
           TV   A ++   +  LHT  ++YRD+KP+N L+ + G      + L DFG++K+   D  
Sbjct: 253 TVSFYAAEISCALRFLHTKGVVYRDLKPENCLLNQRG-----HLVLTDFGLSKKSANDSA 307

Query: 186 TKQHIPYREKK--SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 243
             +  P       S+ GT  Y +    LG+  S+  D  +LG + +  L G+ P+ G   
Sbjct: 308 VDEEDPENVNALYSIIGTPEYCAPEILLGKAYSQNCDWYSLGCLLYDMLVGKPPYTG--- 364

Query: 244 PNNKQKYEKIGEKKR 258
            N+K    KI + K+
Sbjct: 365 SNHKVIINKIQQNKQ 379

>Scas_703.5
          Length = 749

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 103/237 (43%), Gaps = 37/237 (15%)

Query: 32  YRIGKKIGEGSFGVLFE----GTNMINGVPV-AIKFEPRKSEAPQLKDEYRTYKILAGTA 86
           + + + +G+G+FG +++     T  I  + V + K   +K+E      E     IL  TA
Sbjct: 344 FEVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLSKKVIVKKNEVAHTIGERN---ILVTTA 400

Query: 87  GIPQAYYFG-----QEGLHNILVIDLLGPSLEDLFDWCGR---RFSVKTVVQVAVQMITL 138
                +  G     Q      LV D +  S  +LF W  +   RF+ +       +++  
Sbjct: 401 TKASPFIVGLKFSFQTPTDLYLVTDFM--SGGELF-WHLQKEGRFTEERAKFYIAELVLA 457

Query: 139 IEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSL 198
           +E LH +D++YRD+KP+N L+   G      + L DFG++K     +T          + 
Sbjct: 458 LEYLHDNDIVYRDLKPENILLDANG-----NIALCDFGLSKADLKDRT---------NTF 503

Query: 199 SGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 254
            GT  Y++    L     ++  D  +LG + F    G   W    A +N++ Y+KI 
Sbjct: 504 CGTTEYLAPELLLDEAGYTKMVDFWSLGVLIFEMCCG---WSPFFAEDNQKMYQKIA 557

>Scas_660.28
          Length = 623

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 80/161 (49%), Gaps = 18/161 (11%)

Query: 31  HYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAP-----QLKDEYRTYKILAGT 85
           +Y+I K +GEGSFG +    +M  G  VA+K   +K  A      +++ E  +Y  L   
Sbjct: 45  NYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGRIEREI-SYLRLLRH 103

Query: 86  AGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDLH 143
             I + Y   +     I+V++  G    +LFD+  +R   S     +   Q+I+ +E  H
Sbjct: 104 PHIIKLYDVIKSKDEIIMVMEYAG---NELFDYIVQRDKMSEDEARRFFQQIISAVEYCH 160

Query: 144 THDLIYRDIKPDNFLIGRPGTPDEN-KVHLIDFGMAKQYRD 183
            H +++RD+KP+N L+      DE+  V + DFG++    D
Sbjct: 161 RHKIVHRDLKPENLLL------DEHLNVKIADFGLSNIMTD 195

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 85/168 (50%), Gaps = 19/168 (11%)

Query: 24  DSTIVGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAP-----QLKDEYRT 78
           D + VG +Y+I K +GEGSFG +    ++  G  VA+K   +K  A      +++ E  +
Sbjct: 32  DGSRVG-NYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREI-S 89

Query: 79  YKILAGTAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMI 136
           Y  L     I + Y   +     I+VI+  G    +LFD+  +R   S +   +   Q+I
Sbjct: 90  YLRLLRHPHIIKLYDVIKSKDEIIMVIEYAG---NELFDYIVQRNKMSEQEARRFFQQII 146

Query: 137 TLIEDLHTHDLIYRDIKPDNFLIGRPGTPDEN-KVHLIDFGMAKQYRD 183
           + +E  H H +++RD+KP+N L+      DE+  V + DFG++    D
Sbjct: 147 SAVEYCHRHKIVHRDLKPENLLL------DEHLNVKIADFGLSNIMTD 188

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 61/134 (45%), Gaps = 18/134 (13%)

Query: 122 RFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQY 181
           RF+         +++  +E LH +D++YRD+KP+N L+   G      + L DFG++K  
Sbjct: 437 RFTEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILLDANG-----NIALCDFGLSKAD 491

Query: 182 RDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQG 240
              +T          +  GT  Y++    L     ++  D  +LG + F    G   W  
Sbjct: 492 LKDRT---------NTFCGTTEYLAPELLLDESGYTKMVDFWSLGVLIFEMCCG---WSP 539

Query: 241 LKAPNNKQKYEKIG 254
             A +N++ Y+KI 
Sbjct: 540 FYAEDNQKMYQKIA 553

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 103/237 (43%), Gaps = 37/237 (15%)

Query: 32  YRIGKKIGEGSFGVLFE----GTNMINGVPV-AIKFEPRKSEAPQLKDEYRTYKILAGTA 86
           + + + +G+G+FG +++     T  I  + V + K   +K+E      E     IL  TA
Sbjct: 304 FEVLRLLGKGTFGQVYQVRKKDTKRIYAMKVLSKKVIVKKNEIAHTIGER---NILVRTA 360

Query: 87  GIPQAYYFG-----QEGLHNILVIDLLGPSLEDLFDWCGR---RFSVKTVVQVAVQMITL 138
                +  G     Q      LV D L  S  +LF W  +   RF+ +       +++  
Sbjct: 361 SKSCPFIVGLKFSFQTPTDLYLVTDFL--SGGELF-WHLQKEGRFTEERAKFYIAELVLA 417

Query: 139 IEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSL 198
           +E LH +D++YRD+KP+N L+   G      + L DFG++K     +T          + 
Sbjct: 418 LEYLHDNDIVYRDLKPENILLDANG-----NIALCDFGLSKADLKDRT---------NTF 463

Query: 199 SGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 254
            GT  Y++    L     ++  D  +LG + F    G   W    A +N++ Y+KI 
Sbjct: 464 CGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCG---WSPFFAEDNQKMYQKIA 517

>Scas_648.17
          Length = 340

 Score = 51.6 bits (122), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 76/163 (46%), Gaps = 32/163 (19%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKSEAPQLKDEYRTYKILAGTAGIPQ 90
           Y I  KIG G +  +F G  + N  P  IK  +P K     +K  YR  KIL    G P 
Sbjct: 50  YEIITKIGRGKYSEVFSGECVNNETPCVIKVLKPVK-----MKKIYRELKILTNLTGGPN 104

Query: 91  AYYFGQEGLHNILVIDLLG------PSL--EDLFDWCGRR----FSVKTVVQVAVQMITL 138
                      I ++D++       P+L  E++ +   R+    F++  +     Q++  
Sbjct: 105 V----------IELLDIVQDPGSKIPALIFEEVKNMDFRQLYPTFTLPDIQFYFTQLLIA 154

Query: 139 IEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQY 181
           +   H+  +++RD+KP N +I     P E K+ LID+G+A+ Y
Sbjct: 155 LNYCHSMGIMHRDVKPQNVMID----PKERKLRLIDWGLAEFY 193

>KLLA0E01584g 149713..150960 highly similar to sp|P39009
           Saccharomyces cerevisiae YDL101c DUN1 protein kinase,
           start by similarity
          Length = 415

 Score = 51.6 bits (122), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 108/243 (44%), Gaps = 45/243 (18%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKSEAPQLKDEYRTYKILAGTAGIPQ 90
           Y  GK++G G + ++ E  N   G  VA+K F P++++     D+ RT K    T  +  
Sbjct: 101 YLAGKELGTGHYAIVKEARNKETGETVAVKIFHPQQND-----DDKRTKKFTEETKILLS 155

Query: 91  AYY-------------FGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAV--QM 135
             +               +  +   LV++ +     +LF+   R+ +++     A+  Q+
Sbjct: 156 IQHPNIVKLIDRFVEPVSKTQIQTYLVLEKINDG--ELFERIVRKNNLREDETKALFRQL 213

Query: 136 ITLIEDLHTHDLIYRDIKPDNFL--IGRPGTPDE------------NKVHLIDFGMAKQY 181
           +  ++ LH+ ++I+RDIKP+N L  I +  +P+E             +V + DFG+AK  
Sbjct: 214 LNGLKYLHSRNIIHRDIKPENILLSISKRRSPEEIALGPWDDDELDIQVKIADFGLAKFT 273

Query: 182 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGL 241
            + K           +L GT  Y++    +    + R DM + G + +  L G  P+   
Sbjct: 274 GEMKFTN--------TLCGTPSYVAPEVLVKTGYTSRVDMWSAGVLLYVCLCGFPPFSEQ 325

Query: 242 KAP 244
            AP
Sbjct: 326 LAP 328

>CAGL0K07458g complement(736336..738450) similar to sp|P12688
           Saccharomyces cerevisiae YKL126w or sp|P18961
           Saccharomyces cerevisiae YMR104c ser/thr-specific
           protein kinases, start by similarity
          Length = 704

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 62/141 (43%), Gaps = 22/141 (15%)

Query: 113 EDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHL 172
           E +FD    RF        A +++  ++ LH  D++YRD+KP+N L+   G      + L
Sbjct: 469 EGIFDISRARF-------YASELLLALDSLHKMDVVYRDLKPENILLDSQG-----HIAL 516

Query: 173 IDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFL 232
            DFG+ K       K         +  GT  Y++    LG+  ++  D   LG + +  L
Sbjct: 517 CDFGLCKLNMKDNEKT-------STFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEML 569

Query: 233 RGQLPWQGLKAPNNKQKYEKI 253
            G  P+      N  + Y+KI
Sbjct: 570 TGLPPYYD---ENVSEMYKKI 587

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 80/161 (49%), Gaps = 18/161 (11%)

Query: 31  HYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAP-----QLKDEYRTYKILAGT 85
           +Y+I K +GEGSFG +    +   G  VA+K   +K  A      +++ E  +Y  L   
Sbjct: 54  NYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREI-SYLRLLRH 112

Query: 86  AGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDLH 143
             I + Y   +     I+VI+  G    +LFD+  +R   S +   +   Q+I+ +E  H
Sbjct: 113 PHIIKLYDVIKSKDEIIMVIEYAG---NELFDYIVQRDKMSEQEARRFFQQIISAVEYCH 169

Query: 144 THDLIYRDIKPDNFLIGRPGTPDEN-KVHLIDFGMAKQYRD 183
            H +++RD+KP+N L+      DE+  V + DFG++    D
Sbjct: 170 RHKIVHRDLKPENLLL------DEHLNVKIADFGLSNIMTD 204

>YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinase
            kinase kinase (MAPKKK) involved in the high-osmolarity
            signal transduction pathway [4740 bp, 1579 aa]
          Length = 1579

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 67/258 (25%), Positives = 110/258 (42%), Gaps = 52/258 (20%)

Query: 25   STIVGLHYRIGKK--IGEGSFGVLFEGTNMINGVPVAIK---FEPRKSEA---PQLKDEY 76
            S+I  +  R  K+  IG G+FG ++   ++ NG  +A+K    +  KS     P +K+E 
Sbjct: 1257 SSISNVSMRWQKRNFIGGGTFGRVYSAVDLDNGEILAVKEINIQDSKSMQKIFPLIKEEM 1316

Query: 77   RTYKILAGTAGIPQAYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRRFSVKTVVQV- 131
               +IL     +    Y+G E +H    NI +    G SL  L +    R   + V QV 
Sbjct: 1317 SVLEILNHPNIVS---YYGVE-VHRDKVNIFMEYCEGGSLAALLE--HGRIEDEMVTQVY 1370

Query: 132  AVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTK---- 187
             +Q++  +  LH   +++RD+KP+N L+   G      +  +DFG AK+  +  T+    
Sbjct: 1371 TLQLLEGLAYLHESGIVHRDVKPENILLDFNGV-----IKYVDFGAAKKIANNGTRLASM 1425

Query: 188  -------------------QHIPYREKKSLS--GTARYM---SINTHLGREQSRRDDMEA 223
                               + +   E   L   GT  YM   SI     + +   DD+ +
Sbjct: 1426 NKIENADGEHEDVTHVSDSKAVKNNENALLDMMGTPMYMAPESITGSTTKGKLGADDVWS 1485

Query: 224  LGHVFFYFLRGQLPWQGL 241
            LG V    + G+ PW  L
Sbjct: 1486 LGCVVLEMITGRRPWANL 1503

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 92/226 (40%), Gaps = 40/226 (17%)

Query: 29  GLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTAGI 88
            + Y++ + IG GS+GV+++ TN      VAIK E    +  +L D      +L     I
Sbjct: 19  SVQYQLRQIIGRGSYGVVYKATNKKTAQEVAIK-EVNYQDDDELVDIMSEIDLLKNLNHI 77

Query: 89  PQAYYFG-QEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQ------------VAVQM 135
               Y G  +  HN+ +I           ++C +  S+K ++                Q 
Sbjct: 78  NIVKYHGFIQKQHNLYII----------LEYCAKG-SLKNLISRNRPMSEHEAKPYVRQT 126

Query: 136 ITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREK 195
           +  +  LH   +I+RDIK  N L+       EN V L DFG++ +  +            
Sbjct: 127 LNGLNYLHEQGVIHRDIKAANILLD-----SENVVKLADFGVSTKVNNTAM--------- 172

Query: 196 KSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGL 241
            +L+G+  +M+      R  S   D+ +LG      L G  P+  L
Sbjct: 173 -TLAGSLNWMAPEIIGNRGASTLSDIWSLGATVVELLTGNPPFHNL 217

>Scas_721.124
          Length = 684

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 95/235 (40%), Gaps = 37/235 (15%)

Query: 32  YRIGKKIGEGSFGVLFE----GTNMINGVPVAIK-FEPRKSEAPQLKDEYRTYKILAGTA 86
           + + K IG+GSFG + +     T  I  +    K +   KSE      E      +    
Sbjct: 351 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKAIRKAYIVSKSEVTHTLAERTVLARIDCPF 410

Query: 87  GIPQAYYFGQEGLHNILVIDLLGPSL------EDLFDWCGRRFSVKTVVQVAVQMITLIE 140
            +P  + F       +++  + G  L      E  FD    RF        A +++  +E
Sbjct: 411 IVPLKFSFQSPDKLYLVLACINGGELFYHLQKEGRFDLSRSRF-------YAAELLCALE 463

Query: 141 DLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAK--QYRDPKTKQHIPYREKKSL 198
            LH  ++IYRD+KP+N L+   G      + L DFG+ K     D KT          + 
Sbjct: 464 TLHNLNVIYRDLKPENILLDYQG-----HIALCDFGLCKLNMKDDDKT---------DTF 509

Query: 199 SGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 253
            GT  Y++    LG+  ++  D   LG + +  L G  P+     P   + Y+KI
Sbjct: 510 CGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVP---KMYKKI 561

>Kwal_47.16761
          Length = 744

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 58/123 (47%), Gaps = 18/123 (14%)

Query: 133 VQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPY 192
            +++  +E LH +D++YRD+KP+N L+   G      + L DFG++K     +T      
Sbjct: 442 AELVLALEYLHENDIVYRDLKPENILLDANG-----NIALCDFGLSKADLKDRT------ 490

Query: 193 REKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYE 251
               +  GT  Y++    L     ++  D  +LG + F    G   W    A +N++ Y+
Sbjct: 491 ---NTFCGTTEYLAPELLLDESGYTKMVDFWSLGVLIFEMCCG---WSPFFAEDNQKMYQ 544

Query: 252 KIG 254
           KI 
Sbjct: 545 KIA 547

>YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine
           protein kinase related to Kin1p and Kin2p, catalytic
           domain is highly related to Snf1p [2403 bp, 800 aa]
          Length = 800

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 99/220 (45%), Gaps = 26/220 (11%)

Query: 32  YRIGKKIGEGSFGVLFEG---TNMINGVP--VAIKFEPRKSEAPQLKDEYRTYKILAGTA 86
           Y IG  +GEG FG +  G    +  N VP  VAIK   R +       E + Y+ +    
Sbjct: 46  YIIGSTLGEGEFGKVKLGWTKASSSNEVPKQVAIKLIRRDTIKKDADKEIKIYREINALK 105

Query: 87  GI--PQAYYFGQEGLHNILVIDLLGPSLE--DLFDWCGRRFSVK--TVVQVAVQMITLIE 140
            +  P   Y  +E L N   I ++   +   + + +  R+  +K  +  ++  Q+I+ + 
Sbjct: 106 HLTHPNIIYL-EEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSACRLFAQLISGVN 164

Query: 141 DLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSG 200
            +H   L++RD+K +N L+ +     EN V + DFG   ++ +            K+  G
Sbjct: 165 YMHYKGLVHRDLKLENLLLDK----HENLV-ITDFGFVNEFFEDNELM-------KTSCG 212

Query: 201 TARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLPW 238
           +  Y +    +  +  ++R+ D+ + G + +  L G LPW
Sbjct: 213 SPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPW 252

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/252 (22%), Positives = 104/252 (41%), Gaps = 62/252 (24%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEY--------------- 76
           +++GK +G+GS G +    N+ NG   AIK  P+++   +++D+                
Sbjct: 93  WKLGKTLGKGSSGRVRLAKNIENGTLAAIKIVPKRTYNRRMRDQKMKTAGGVSSGTDSKD 152

Query: 77  ---RTYKILAGTAGIPQAYYFGQEGLHNILVIDLLG-PSLE------------------- 113
              R   I  GT      Y   +E    I+++ L+  P++                    
Sbjct: 153 SSNREDPIKNGTDSALNPYGIERE----IVIMKLISHPNVMGLLEVWENKSELYLVLEYV 208

Query: 114 ---DLFDWCGRR--FSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDEN 168
              +LFD+   +   S    V    Q+I  +   H+ ++ +RD+KP+N L+ +     +N
Sbjct: 209 DGGELFDYLVSKGKLSEPEAVHYFTQIIQGVSYCHSFNICHRDLKPENLLLDK-----KN 263

Query: 169 KV-HLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGH 226
           KV  + DFGMA           +P +  ++  G+  Y S    +G+       D+ + G 
Sbjct: 264 KVIKIADFGMA--------ALELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGI 315

Query: 227 VFFYFLRGQLPW 238
           + F  L G LP+
Sbjct: 316 ILFALLTGHLPF 327

>Kwal_47.18233
          Length = 598

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 79/160 (49%), Gaps = 18/160 (11%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAP-----QLKDEYRTYKILAGTA 86
           Y+I K +GEGSFG +    ++  G  VA+K   +K  A      +++ E  +Y  L    
Sbjct: 31  YQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREI-SYLRLLRHP 89

Query: 87  GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDLHT 144
            I + Y   +     ++VI+  G    +LFD+  +R   S     +   Q+I+ +E  H 
Sbjct: 90  HIIKLYDVVKSKDEIVMVIEYAG---NELFDYIVQRDKMSENEARRFFQQIISAVEYCHR 146

Query: 145 HDLIYRDIKPDNFLIGRPGTPDEN-KVHLIDFGMAKQYRD 183
           H +++RD+KP+N L+      DE+  V + DFG++    D
Sbjct: 147 HKIVHRDLKPENLLL------DEHLNVKIADFGLSNIMTD 180

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 61/134 (45%), Gaps = 18/134 (13%)

Query: 122 RFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQY 181
           RF+         +++  +E LH +D++YRD+KP+N L+   G      + L DFG++K  
Sbjct: 422 RFTEDRAKFYIAELVLALEYLHDNDIVYRDLKPENILLDANG-----NIALCDFGLSKAD 476

Query: 182 RDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQG 240
              +T          +  GT  Y++    +     ++  D  +LG + F    G   W  
Sbjct: 477 LKDRT---------NTFCGTTEYLAPELLMDETGYTKMVDFWSLGVLIFEMCCG---WSP 524

Query: 241 LKAPNNKQKYEKIG 254
             A +N++ Y+KI 
Sbjct: 525 FFASDNQKMYQKIA 538

>KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces
           cerevisiae YNL183c NPR1 ser/thr protein kinase, start by
           similarity
          Length = 774

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 66/139 (47%), Gaps = 10/139 (7%)

Query: 114 DLFDWC-GRRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHL 172
           DLF      + S + +     Q++T +E LH+  L +RD+K DN +I   G      V L
Sbjct: 508 DLFAIVMSNKMSYEEICCCFKQILTGVEYLHSIGLAHRDMKLDNCVINNQGI-----VKL 562

Query: 173 IDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYF 231
           IDFG A+ +  P +K  I   E   + G+  Y++    +  +   R  D+ ++  +F   
Sbjct: 563 IDFGAAEVFSYPHSKTLI---ESSGIVGSDPYLAPEVCIFTKYDPRPVDIWSVAILFACM 619

Query: 232 LRGQLPWQGLKAPNNKQKY 250
           +  + PW+  K  +N  K+
Sbjct: 620 VLKKFPWKIPKLKDNSFKF 638

>KLLA0F24618g complement(2288943..2290613) similar to sp|P38070
           Saccharomyces cerevisiae YBR028c, start by similarity
          Length = 556

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 67/135 (49%), Gaps = 10/135 (7%)

Query: 127 TVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQ--YRDP 184
           TV   A ++   ++ LH+  ++YRD+KP+N L+   G      + L DFG++K+  + D 
Sbjct: 282 TVAFYAAELSCALKFLHSKGIVYRDLKPENCLLNERG-----HLVLTDFGLSKKSVFDDA 336

Query: 185 KTKQHIP-YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGL-- 241
            T +      +  S+ GT  Y +     G   ++  D  +LG + +  L G+ P+ G+  
Sbjct: 337 ATPEEGENVNQLYSIIGTPEYCAPEILAGEPYTQNCDWYSLGCLVYDMLIGKPPFTGVNH 396

Query: 242 KAPNNKQKYEKIGEK 256
           K   NK K EK G +
Sbjct: 397 KIILNKIKQEKTGAR 411

>Kwal_56.24091
          Length = 381

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 58/117 (49%), Gaps = 13/117 (11%)

Query: 123 FSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYR 182
           F+  T      QM   +  +H+ ++++RDIKP+N L+G      +N + L DFG +    
Sbjct: 218 FNDITASHFVHQMADALNYMHSKNILHRDIKPENILLGF-----QNTLKLTDFGWS---- 268

Query: 183 DPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 239
                 ++   ++K+L GT  Y+S      RE   + D+ ALG + +  L G  P++
Sbjct: 269 ----VSNVGNSKRKTLCGTMDYLSPELIKSREYDNKVDVWALGVLTYELLVGSPPFE 321

>Kwal_14.1273
          Length = 415

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/258 (22%), Positives = 103/258 (39%), Gaps = 41/258 (15%)

Query: 37  KIGEGSFGVLFEGTNMINGVPVAIKFEPRKSE-------APQLKDEYRTYKIL-AGTAGI 88
           KI  GSF  ++   +      VA+K   + SE       A  +  E    ++L  G   +
Sbjct: 7   KIQSGSFSTVYRAYDTERARDVALKILKKPSEPAMASKLATLVGSELEVLRVLGTGHPNV 66

Query: 89  PQAYYFGQEGLHNILVIDLLGPSLEDLFD----WCGRRFSVKTV----VQVAVQMITLIE 140
                F +     + V++       DL+D    W  +R S + V     +V +Q+ + IE
Sbjct: 67  CALLDFYERETCYVFVMEYAARG--DLYDVIRGW--KRHSAERVPVELARVVLQLCSAIE 122

Query: 141 DLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSG 200
             H+  + +RDIKP+N L+   G      V L D+G++ + R              +  G
Sbjct: 123 YAHSCGIAHRDIKPENVLLDSAG-----NVKLADWGLSTRMR----------VSCDTRIG 167

Query: 201 TARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG---LKAPNNKQKYEKIGEKK 257
           T +Y++   +     +   D  +LG    + + G  P++     K+PNN      +    
Sbjct: 168 TEKYLAPEAYASPHDTFLADFWSLGVTLLFVMFGACPFKNACLTKSPNNPNFAHFVASPH 227

Query: 258 RVTNVYDLAQGLPVQFGR 275
           R  + Y     LP++  R
Sbjct: 228 RFISEYYF---LPLRAAR 242

>AEL083W [2423] [Homologous to ScYBR028C - SH]
           complement(470964..472574) [1611 bp, 536 aa]
          Length = 536

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 72/147 (48%), Gaps = 14/147 (9%)

Query: 127 TVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAK----QYR 182
           TV   A ++   ++ LH+  ++YRD+KP+N L+      D+  + L DFG++K    Q  
Sbjct: 265 TVSFYAAEISCALKFLHSKGIVYRDLKPENCLLD-----DKGHLVLTDFGLSKRGVNQAD 319

Query: 183 DPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLK 242
            P   + +   E  S+ GT  Y +     G+  ++  D  +LG + +  L G+ P+ G  
Sbjct: 320 SPLGGEQV--EELYSIIGTPEYCAPEILCGQPYTQNCDWYSLGSLTYDMLIGKPPFTG-- 375

Query: 243 APNNKQKYEKIGEKKRVTNVYDLAQGL 269
             N+K    KI + K +   + L+ G+
Sbjct: 376 -ANHKVILSKIKQDKGIKIPHYLSDGM 401

>YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase,
           required for metaphase DNA-damage checkpoint [1584 bp,
           527 aa]
          Length = 527

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 54/109 (49%), Gaps = 12/109 (11%)

Query: 134 QMITLIEDLHTHD-LIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPY 192
           Q+++ I  LH    + +RDIKP+N L+ + G      + L DFG+A Q+R       +  
Sbjct: 124 QLVSAINYLHVECGVAHRDIKPENILLDKNGN-----LKLADFGLASQFRRKDGTLRVSM 178

Query: 193 REKKSLSGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLPWQ 239
            ++    G+  YM+       E   + R D+ ++G + F  L GQ PW+
Sbjct: 179 DQR----GSPPYMAPEVLYSEEGYYADRTDIWSIGILLFVLLTGQTPWE 223

>CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces
           cerevisiae YBR274w CHK1 regulats inhibitory Cdk
           phosphorylation of PDS1, start by similarity
          Length = 528

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 57/222 (25%), Positives = 92/222 (41%), Gaps = 35/222 (15%)

Query: 34  IGKKIGEGSFGVLFEG-TNMINGVPVAIKFE--PRKSEA----PQLKDEYRTYKILAGTA 86
           +G  IGEGSFG +        + V VA+KF   P  +E+      +  E   +   +  A
Sbjct: 16  LGGTIGEGSFGCVRSARLKFDSSVVVAVKFVHLPTCAESGLSQKDVSREVVLHSKCSKHA 75

Query: 87  GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVK-TVVQVAVQ-MITLIEDLHT 144
            + +       G +  +++++      DLFD       V   V Q   Q +I  +  LH 
Sbjct: 76  NVLRVIDCNVGGEYLWIMLEMADGG--DLFDKIEPDVGVDPDVAQFYFQQLIRALNYLHD 133

Query: 145 HDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHI--------PYREKK 196
             + +RDIKP+N L+ + G      + L DFG+A Q+R       +        PY   +
Sbjct: 134 VGVAHRDIKPENILLDKKGN-----LKLADFGLASQFRRKDGTLRVSTDQRGSPPYMAPE 188

Query: 197 SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 238
            LS    Y +I            D+ + G + F  L G++PW
Sbjct: 189 ILSSQGYYANIT-----------DIWSAGVLLFVLLTGEIPW 219

>Kwal_26.7788
          Length = 1267

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 91/216 (42%), Gaps = 24/216 (11%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQ------LKDEYRTYKILAGT 85
           +++GK +G+GS G +    NM  G   AIK  P+   +        ++ E    K+++  
Sbjct: 58  WKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKTKSSRTGSLPYGIEREIIIMKLISH- 116

Query: 86  AGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKTVVQVAVQMITLIEDLH 143
             +   Y   +  L   LV++ +     +LFD+     R   K  +    Q+I      H
Sbjct: 117 PNVMGLYEVWENKLELFLVLEYVDGG--ELFDYLVSRGRLPEKEAIHYFRQIIEGTAYCH 174

Query: 144 THDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 203
             ++ +RD+KP+N L+ +       ++ + DFGMA      K  +        +  G+  
Sbjct: 175 GFNICHRDLKPENLLLDK----KNKRIKIADFGMAALQTSNKLLE--------TSCGSPH 222

Query: 204 YMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPW 238
           Y S    +G+       D+ + G + F  L G LP+
Sbjct: 223 YASPEIVMGKNYNGGPSDVWSCGIILFALLTGHLPF 258

>Scas_717.69
          Length = 674

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 57/132 (43%), Gaps = 15/132 (11%)

Query: 122 RFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQY 181
           RF +        +++  +E LH  D+IYRD+KP+N L+   G      + L DFG+ K  
Sbjct: 439 RFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQG-----HIALCDFGLCKLN 493

Query: 182 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGL 241
              + K         +  GT  Y++    L +  S+  D   LG + +  L G  P+   
Sbjct: 494 MKDQDKT-------DTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDE 546

Query: 242 KAPNNKQKYEKI 253
             P   + Y KI
Sbjct: 547 DVP---KMYRKI 555

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 79/160 (49%), Gaps = 18/160 (11%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAP-----QLKDEYRTYKILAGTA 86
           Y++ K +GEGSFG +    ++  G  VA+K   +K  A      +++ E  +Y  L    
Sbjct: 39  YQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKKVLAKSDMQGRIEREI-SYLRLLRHP 97

Query: 87  GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDLHT 144
            I + Y   +     I+VI+  G    +LFD+  +R   S     +   Q+I+ +E  H 
Sbjct: 98  HIIKLYDVIKSKDEIIMVIEYAG---NELFDYIVQRDKMSENEARRFFQQIISAVEYCHR 154

Query: 145 HDLIYRDIKPDNFLIGRPGTPDEN-KVHLIDFGMAKQYRD 183
           H +++RD+KP+N L+      DE+  V + DFG++    D
Sbjct: 155 HKIVHRDLKPENLLL------DEHLNVKIADFGLSNIMTD 188

>CAGL0K10604g complement(1029226..1030566) similar to sp|P27466
           Saccharomyces cerevisiae YFR014c CMK1
           Ca2+/calmodulin-dependent ser/thr protein kinase type I,
           hypothetical start
          Length = 446

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/214 (22%), Positives = 96/214 (44%), Gaps = 15/214 (7%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQ-----LKDEYRTYKILAGTA 86
           Y   + +G GSFGV+     + +   VA+K   +++         + DE    + L    
Sbjct: 65  YLFQRTLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKNGGLEPIYDELNIIQHLDHPN 124

Query: 87  GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHD 146
            +    +F  E    I+     G  L D     G+ ++ +  V + VQ++  +E LH+ +
Sbjct: 125 IVKFKDWFETESKFYIVTQLASGGELFDRIMHDGK-YTEEDAVNIVVQILKAVEYLHSQN 183

Query: 147 LIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 206
           +I+RD+KP+N L        ++++ L DFG+A+Q  +      + YR     +G+  Y++
Sbjct: 184 IIHRDLKPENLL--YLDKSKDSRIVLADFGIARQLEND---DDVIYRP----AGSLGYVA 234

Query: 207 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG 240
                     +  D+ ++G + +  L G  P++ 
Sbjct: 235 PEVFTSDGHGKPSDIWSVGVITYTLLCGYSPFKA 268

>YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine
           protein kinase involved in the cell integrity signaling
           pathway and required for endocytosis, possibly involved
           in a sphingolipid-mediated signaling pathway, has
           similarity to protein kinase C [2043 bp, 680 aa]
          Length = 680

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 63/140 (45%), Gaps = 19/140 (13%)

Query: 122 RFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAK-- 179
           RF +        +++  +++LH  D++YRD+KP+N L+   G      + L DFG+ K  
Sbjct: 441 RFDLSRARFYTAELLCALDNLHKLDVVYRDLKPENILLDYQG-----HIALCDFGLCKLN 495

Query: 180 QYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 239
              D KT          +  GT  Y++    LG   ++  D   LG + +  L G  P+ 
Sbjct: 496 MKDDDKT---------DTFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLPPYY 546

Query: 240 GLKAPNNKQKYEKIGEKKRV 259
               P   + Y+KI ++  V
Sbjct: 547 DEDVP---KMYKKILQEPLV 563

>KLLA0F01507g 144356..145774 some similarities with sp|P47042
           Saccharomyces cerevisiae YJL057c IKS1 singleton,
           hypothetical start
          Length = 472

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 59/120 (49%), Gaps = 12/120 (10%)

Query: 123 FSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLI----GRPGTPDENKVHLIDFGMA 178
            + + +V +A  + T ++ LH+  +I+RD+KP N L+     R  T    K  + DFG +
Sbjct: 211 LTTRQIVSIANDIATGLKQLHSLRIIHRDLKPSNCLLLEEFDRSDTDKFPKCVIGDFGES 270

Query: 179 KQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 238
           + Y           R+    +GT  +++     G + S + D+ A G + ++ + GQLP+
Sbjct: 271 QLYGQ--------LRDATGSTGTVEFVAPELTKGAQFSFKSDIYAFGMILYFVIMGQLPF 322

>YKL171W (YKL171W) [3100] chr11 (127480..130266) Serine/threonine
           protein kinase of unknown function [2787 bp, 928 aa]
          Length = 928

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 85/173 (49%), Gaps = 16/173 (9%)

Query: 23  EDSTIVGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIK---FEPRKSEAPQLKDEYRTY 79
           +D  +  L +R+GK IG G++G++ E  ++  GV   IK   F+  ++    +  E   +
Sbjct: 440 DDKGMEILGHRLGKIIGFGAWGIIRECFDIETGVGRVIKIVKFKGHQNIKKHVLREVAIW 499

Query: 80  KILAGTAGIPQ---------AYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFS--VKTV 128
           + L     +P          A Y   E +++  + DL+     D F      F+   +  
Sbjct: 500 RTLKHNRILPLLDWKLDDNYAMYCLTERINDGTLYDLVIS--WDEFKRSKIPFAERCRLT 557

Query: 129 VQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQY 181
           + +++Q+++ ++ +H+  +++ DIK +N L+ + G   + KV L DFGM+  +
Sbjct: 558 IFLSLQLLSALKYMHSKTIVHGDIKLENCLLQKEGKKSDWKVFLCDFGMSCHF 610

>YPL153C (RAD53) [5294] chr16 complement(261726..264191)
           Serine/threonine/tyrosine protein kinase with a
           checkpoint function in S and G2 phases, contains
           forkhead associated (FHA) domain [2466 bp, 821 aa]
          Length = 821

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 101/238 (42%), Gaps = 33/238 (13%)

Query: 34  IGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGT--AGIPQA 91
           I + +G+G+F  + +      G   A+K   ++     +    R  ++L       I + 
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMDGVTRELEVLQKLNHPRIVRL 259

Query: 92  YYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVV--QVAVQMITLIEDLHTHDLIY 149
             F ++     +V++ +     DL D+     +V      +++ Q++T I+ +H+  + +
Sbjct: 260 KGFYEDTESYYMVMEFVSGG--DLMDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISH 317

Query: 150 RDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINT 209
           RD+KPDN LI +    D   V + DFG+AK   +            K+  GT  Y++   
Sbjct: 318 RDLKPDNILIEQ---DDPVLVKITDFGLAKVQGNGSF--------MKTFCGTLAYVAPEV 366

Query: 210 HLGR-------------EQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 254
             G+             E S   DM ++G + +  L G LP+ G       Q Y++IG
Sbjct: 367 IRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPFSG---STQDQLYKQIG 421

>YPL209C (IPL1) [5240] chr16 complement(156489..157592)
           Serine/threonine protein kinase of the mitotic spindle,
           involved in chromosome segregation and activation of the
           spindle checkpoint by detection of kinetochore tension,
           required for proper spindle disassembly and orientation
           [1104 bp, 367 aa]
          Length = 367

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 68/145 (46%), Gaps = 18/145 (12%)

Query: 134 QMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYR 193
           Q+   ++ +H  ++I+RDIKP+N LIG       N + L DFG +    +P      P  
Sbjct: 210 QIANALDYMHKKNIIHRDIKPENILIGF-----NNVIKLTDFGWS--IINP------PEN 256

Query: 194 EKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 253
            +K++ GT  Y+S      RE     D  ALG + F  L G  P++          Y++I
Sbjct: 257 RRKTVCGTIDYLSPEMVESREYDHTIDAWALGVLAFELLTGAPPFE---EEMKDTTYKRI 313

Query: 254 G--EKKRVTNVYDLAQGLPVQFGRY 276
              + K  +N+   AQ L ++  +Y
Sbjct: 314 AALDIKMPSNISQDAQDLILKLLKY 338

>Kwal_33.13984
          Length = 649

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 80/182 (43%), Gaps = 24/182 (13%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSE-APQLKDEYRTYKILAGTAGIPQ 90
           Y +   +G+G+FG + +  N++    +A+K    KSE   Q   E +  ++L G      
Sbjct: 278 YLVLDILGQGTFGQVVKCQNLLTKEILAVKVVKSKSEYLNQSITEAKILELLNGKIDPQG 337

Query: 91  AYYFGQ------EGLHNILVIDLLGPSLEDLFDWCGRR-FSVKTVVQVAVQMITLIEDLH 143
            ++F +         H  LV +LL  +L +L         S+  +   A Q++  +  L 
Sbjct: 338 EHHFLRMHETFVHKNHLCLVFELLSSNLYELLKQNQFHGLSISLIRTFARQLLDSLCVLK 397

Query: 144 THDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQ-------------YRDPKTKQHI 190
            H LI+ D+KP+N L+     P+   + +IDFG A +             YR P+    I
Sbjct: 398 EHKLIHCDLKPENILLVSLDRPE---LKVIDFGSACEETRTLYTYIQSRFYRAPEVILGI 454

Query: 191 PY 192
           PY
Sbjct: 455 PY 456

>YMR104C (YPK2) [4061] chr13 complement(473419..475452)
           Serine/threonine protein kinase with similarity to
           Ypk1p, involved in the cell integrity signaling pathway
           [2034 bp, 677 aa]
          Length = 677

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 54/123 (43%), Gaps = 12/123 (9%)

Query: 122 RFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQY 181
           RFS+        +++  ++ LH  D+IYRD+KP+N L+   G      + L DFG+ K  
Sbjct: 438 RFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQG-----HIALCDFGLCKLN 492

Query: 182 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGL 241
                K         +  GT  Y++    LG+  ++  D   LG + +  + G  P+   
Sbjct: 493 MKDNDKT-------DTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDE 545

Query: 242 KAP 244
             P
Sbjct: 546 NVP 548

>ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C
           (PRR2) - SH] (128217..130394) [2178 bp, 725 aa]
          Length = 725

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 95/223 (42%), Gaps = 21/223 (9%)

Query: 31  HYRIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKSEAPQLKDEYRTYKILAGTAGIP 89
           + R G+K+G G+ G +     + + V  A+K F P+     + K +Y           I 
Sbjct: 389 YSRTGEKLGAGAGGSVKLVRRLKDNVVFAVKEFRPKHEN--ETKRDY--------IKKIT 438

Query: 90  QAYYFGQEGLHNILVIDLLGPSLEDLFDWC-GRRFSVKTVVQVAVQMITLIEDLHTHDLI 148
             Y  G    H+ +++ ++     DLF      R S + +     Q++  I  LH+  L 
Sbjct: 439 SEYCIGSTLRHSNIILQVMEYCDYDLFAIVMSNRMSYEEICCCLKQILIGIGYLHSLGLA 498

Query: 149 YRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSIN 208
           +RD+K DN ++   G      V +IDFG A  +  P +   +   E   + G+  Y++  
Sbjct: 499 HRDLKLDNCVLNSQGI-----VKIIDFGAAVVFTYPHSGTLV---EASGIVGSDPYLAPE 550

Query: 209 THL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKY 250
             +  +   R  D+ +   ++   +  + PW+  K  +N  K+
Sbjct: 551 VCIFSKYDPRPVDIWSAAIIYACMILKKFPWKIPKLKDNSFKF 593

>YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine
           protein kinase of unknown function [1110 bp, 369 aa]
          Length = 369

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 52/220 (23%), Positives = 91/220 (41%), Gaps = 28/220 (12%)

Query: 36  KKIGEGSFGVLFEGTNMINGVPVAIKFEPR-KSEAPQLKDEYRTYKILAGT---AGIPQA 91
           + I  G+F  +++  +  +   VA+K  P+ K+    +K+EY   KIL+       I   
Sbjct: 6   RSIQSGTFSTVYKAWSTTHNRYVALKITPKYKTSEANMKNEYDVMKILSSCNPHPNICSM 65

Query: 92  YYFGQEGLHNILVIDLLGP-SLEDLFDWCGRRFSVKTVVQVAVQMITLIEDL-------H 143
             F  +  + I+V++      L D  D    + S  +   + + M  +I+ L       H
Sbjct: 66  LDFYTDDSYYIMVLEYCECGDLYDFLDIAKSQGSPSSPSLIQIDMQKIIKQLCSAISFAH 125

Query: 144 THDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIP----YREKKSLS 199
           +  + +RDIKP+N L+   G      + L D+G A Q   PK+         YR  ++ S
Sbjct: 126 SLGIAHRDIKPENILLTING-----DIKLADWGHAIQ--SPKSNDFQIGTDNYRAPETFS 178

Query: 200 GTARYMSINTHLGREQ-----SRRDDMEALGHVFFYFLRG 234
           G         +  R       + + D  +LG   FY + G
Sbjct: 179 GRVSNSCFKKNFDRSSAPLYNTYQADYWSLGATIFYLMFG 218

>Kwal_33.14434
          Length = 759

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 65/138 (47%), Gaps = 10/138 (7%)

Query: 114 DLFDWC-GRRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHL 172
           DLF      + S + +     Q++T ++ LH+  L +RD+K DN +I + G      V L
Sbjct: 489 DLFAIVMSNKMSYEEICCCFKQILTGVQYLHSMGLAHRDLKLDNCVINKHGV-----VKL 543

Query: 173 IDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYF 231
           IDFG A  +  P +K  +   E   + G+  Y++    +  +   R  D+ ++  +F   
Sbjct: 544 IDFGAAAVFSYPFSKTLV---ESSGIVGSDPYLAPEVCIFSKYDPRPVDVWSVAIIFACM 600

Query: 232 LRGQLPWQGLKAPNNKQK 249
           +  + PW+  K  +N  K
Sbjct: 601 VLKKFPWKIPKLKDNSFK 618

>CAGL0J06072g complement(572377..574698) similar to sp|P53894
           Saccharomyces cerevisiae YNL161w CBK1, hypothetical
           start
          Length = 773

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 67/149 (44%), Gaps = 17/149 (11%)

Query: 38  IGEGSFG----VLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTAG--IPQA 91
           IG+G+FG    V  + T  I  +   +K E  K +  QL        +LAGT    I   
Sbjct: 376 IGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGTDSPWIVSL 433

Query: 92  YYFGQEGLHNILVIDLL--GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDLIY 149
           YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H    I+
Sbjct: 434 YYSFQDAQYLYLIMEFLPGGDLMTMLIRW--QLFTEDVTRFYMAECILAIETIHKLGFIH 491

Query: 150 RDIKPDNFLIGRPGTPDENKVHLIDFGMA 178
           RDIKPDN LI   G      + L DFG++
Sbjct: 492 RDIKPDNILIDIRG-----HIKLSDFGLS 515

>CAGL0I05896g 560169..562505 some similarities with sp|P14680
           Saccharomyces cerevisiae YJL141c YAK1 ser/thr protein
           kinase, hypothetical start
          Length = 778

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 81/184 (44%), Gaps = 28/184 (15%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSE-APQLKDEYRTYKILAGTAGIPQ 90
           Y +   +G+G+FG + +  N+     +A+K    +SE   Q   E +  ++L        
Sbjct: 361 YLVLDILGQGTFGQVVKCQNLQTKEIIAVKVVKSRSEYLNQSISEAKILELLNEKIDPNN 420

Query: 91  AYYFGQ------EGLHNILVIDLLGPSLEDLFDWCGRRF---SVKTVVQVAVQMITLIED 141
            ++F +         H  LV +LL  +L +L      +F   S++ +    +Q++  +  
Sbjct: 421 KHHFLRMHDSFVHKNHLCLVFELLSNNLYELLK--QNKFHGLSIQLIRTFTIQILDSLCV 478

Query: 142 LHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQ-------------YRDPKTKQ 188
           L    LI+ D+KP+N L+  P  PD   + +IDFG + +             YR P+   
Sbjct: 479 LKDSKLIHCDLKPENILLCSPDKPD---LKVIDFGSSCEETRTVYTYIQSRFYRAPEIIL 535

Query: 189 HIPY 192
            IPY
Sbjct: 536 GIPY 539

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 101/228 (44%), Gaps = 37/228 (16%)

Query: 32  YRIGKKIGEGSFGVLFEG-TNMINGVP---------VAIKFEPRKSEAPQLKDEYRTYKI 81
           Y +G  +GEG FG +  G T   +  P         VAIK   R +     + E + Y+ 
Sbjct: 44  YIVGSTLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRDTIVKNSEKEIKIYRE 103

Query: 82  LAGTAGIPQAYYFG-QEGLHNILVIDLLGPSLE-----DLFDWCGRRFSVK--TVVQVAV 133
           +     +        +E L N   I ++   LE     + + +  R+  +K  T  ++  
Sbjct: 104 INALKHLTHPNVVRLEEVLQNSKYIGIV---LEYASGGEFYKYIQRKRRLKESTACRLFA 160

Query: 134 QMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYR 193
           Q+I+ +  +H+ +L++RD+K +N L+ +    +EN V + DFG   ++        +P  
Sbjct: 161 QLISGVTYMHSKNLVHRDLKLENLLLDK----NENLV-ITDFGFVNEF--------LPDN 207

Query: 194 E-KKSLSGTARYMSINTHLGREQ--SRRDDMEALGHVFFYFLRGQLPW 238
           E  K+  G+  Y +    +      +R+ D+ + G + +  L G LPW
Sbjct: 208 EYMKTSCGSPCYAAPELVISTRPYVARKADVWSCGIILYAMLAGYLPW 255

>ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH]
           complement(205175..205199,205252..206147) [921 bp, 306
           aa]
          Length = 306

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 77/167 (46%), Gaps = 20/167 (11%)

Query: 27  IVGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKD-----EYRTYKI 81
           +  ++Y   KK+GEG++ V++ G    +G  +AIK    + +  Q KD       R  K 
Sbjct: 1   MTAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIK----EIKTSQFKDGLDMSAIREVKY 56

Query: 82  LAGT--AGIPQA--YYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMIT 137
           L     A + +    +  QE L+  LV++ L   LE L       F+   +    +  + 
Sbjct: 57  LQEIRHANVIELVDLFMAQENLN--LVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLR 114

Query: 138 LIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDP 184
            +   H   +++RD+KP+N L+     PD  ++ + DFG+A+    P
Sbjct: 115 GVHHCHRSFILHRDLKPNNLLLA----PD-GQLKIADFGLARTLAAP 156

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 97/224 (43%), Gaps = 36/224 (16%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTAGIPQA 91
           +++GK +G+GS G +    NM +G   AIK  P+++        +   ++ A   GI + 
Sbjct: 61  WKLGKTLGKGSSGRVRLAKNMQSGKLAAIKIVPKRNV------RHNQKQVTALPYGIERE 114

Query: 92  YYFGQEGLH-NILVI-------DLLGPSLE-----DLFDWCGRR--FSVKTVVQVAVQMI 136
               +   H NI+ +         L   LE     +LFD+   R     +  +    Q++
Sbjct: 115 IIIMKLITHPNIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEAIHYFKQIV 174

Query: 137 TLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENK-VHLIDFGMAKQYRDPKTKQHIPYREK 195
             +   H  ++ +RD+KP+N L+ +     +NK V + DFGMA              R  
Sbjct: 175 QGVSYCHNFNICHRDLKPENLLLDK-----KNKTVKIADFGMA--------ALETTNRLL 221

Query: 196 KSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPW 238
           ++  G+  Y S    +G++      D+ + G + F  L G LP+
Sbjct: 222 ETSCGSPHYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPF 265

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 95/218 (43%), Gaps = 26/218 (11%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRK-SEAPQLKD-------EYRTYKILA 83
           +++GK +G+GS G +    NM  G   AIK  P+K  ++ Q+K        E    K+++
Sbjct: 73  WKLGKTLGKGSSGRVRLAKNMETGKLSAIKIVPKKFVKSNQIKQLPYGIEREIIIMKLIS 132

Query: 84  GTAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSV--KTVVQVAVQMITLIED 141
               +   Y   +      LV++ +     +LFD+   +  +     +    Q++  +  
Sbjct: 133 H-PNVMGLYEVWENKSELYLVLEYVEGG--ELFDYLVSKGKLPESEAIHYFKQIVQAVAY 189

Query: 142 LHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 201
            H  ++ +RD+KP+N L+ +     +  + + DFGMA      K  +        +  G+
Sbjct: 190 CHGFNICHRDLKPENLLLDK----KKRSIKIADFGMAALETSDKLLE--------TSCGS 237

Query: 202 ARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPW 238
             Y S    LGR+      D+ + G + F  L G LP+
Sbjct: 238 PHYASPEIVLGRKYHGSPSDVWSCGIILFALLTGHLPF 275

>YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine
           protein kinase that genetically interacts with histone
           mutants and negatively regulates Swe1p protein kinase
           [4557 bp, 1518 aa]
          Length = 1518

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 54/249 (21%), Positives = 100/249 (40%), Gaps = 56/249 (22%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRK------SEAPQLKDEYRTYKILAGT 85
           +++GK +G+GS G +    NM  G   AIK  P+K      S    + + Y +  + +  
Sbjct: 81  WKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHCSNNGTVPNSYSSSMVTSNV 140

Query: 86  AGIP----------QAYYFGQEGLHNILVIDLLGPS------------------LE---- 113
           +             Q   +G E    I+++ L+  +                  LE    
Sbjct: 141 SSPSIASREHSNHSQTNPYGIE--REIVIMKLISHTNVMALFEVWENKSELYLVLEYVDG 198

Query: 114 -DLFDWCGRR--FSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKV 170
            +LFD+   +     +  +    Q++  +   H+ ++ +RD+KP+N L+ +       ++
Sbjct: 199 GELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKN----RRI 254

Query: 171 HLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFF 229
            + DFGMA           +P +  K+  G+  Y S    +GR       D+ + G V F
Sbjct: 255 KIADFGMA--------ALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLF 306

Query: 230 YFLRGQLPW 238
             L G LP+
Sbjct: 307 ALLTGHLPF 315

>Scas_698.37
          Length = 347

 Score = 48.1 bits (113), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 72/158 (45%), Gaps = 22/158 (13%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKSEAPQLKDEYRTYKILAGTAGIPQ 90
           Y I  KIG G +  +F G +++N V   IK  +P K     L+  +R  KIL    G P 
Sbjct: 58  YEIINKIGRGKYSEVFRGKHILNDVSCVIKVLKPVK-----LRKIHRELKILWNLTGGPN 112

Query: 91  AYYFGQEGLHN-------ILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLH 143
                 + +H+        +  D+      +L+      F +  V     Q++  +   H
Sbjct: 113 IVEL-LDVVHDEKTRVPAFIFEDVKNVDFRELYP----TFKLSDVQYYFKQLLIALNYAH 167

Query: 144 THDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQY 181
           +  +++RD+KP N +I     P + K+ LID+G+A+ Y
Sbjct: 168 SMGIMHRDVKPQNVMID----PVQRKLRLIDWGLAEFY 201

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score = 48.5 bits (114), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 80/160 (50%), Gaps = 18/160 (11%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAP-----QLKDEYRTYKILAGTA 86
           Y+I K +GEGSFG +    ++  G  VA+K   +K  A      +++ E  +Y  L    
Sbjct: 35  YQIIKTLGEGSFGKVKLAYHISTGQKVALKIINKKVLAKSDMQGRIEREI-SYLRLLRHP 93

Query: 87  GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSV--KTVVQVAVQMITLIEDLHT 144
            I + Y   +     I+VI+  G    +LFD+  +R  +  +   +   Q+I+ ++  H 
Sbjct: 94  HIIKLYDVIKSKDEIIMVIEYAG---NELFDYIVQRDKMPEQEARRFFQQIISAVDYCHR 150

Query: 145 HDLIYRDIKPDNFLIGRPGTPDEN-KVHLIDFGMAKQYRD 183
           H +++RD+KP+N L+      DE+  V + DFG++    D
Sbjct: 151 HKIVHRDLKPENLLL------DEHLNVKIADFGLSNIMTD 184

>Sklu_2392.6 YNL161W, Contig c2392 12867-15293 reverse complement
          Length = 808

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 70/155 (45%), Gaps = 17/155 (10%)

Query: 32  YRIGKKIGEGSFG----VLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTAG 87
           ++  K IG+G+FG    V  + T  I  +   +K E  K +  QL        +LAG+  
Sbjct: 401 FQTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDS 458

Query: 88  --IPQAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLH 143
             +   YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H
Sbjct: 459 PWVVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRW--QIFTEDVTRFYMAECILAIEAIH 516

Query: 144 THDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMA 178
               I+RDIKPDN LI   G      V L DFG++
Sbjct: 517 KLGFIHRDIKPDNILIDIRG-----HVKLSDFGLS 546

>Kwal_55.21709
          Length = 340

 Score = 48.1 bits (113), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 74/163 (45%), Gaps = 30/163 (18%)

Query: 31  HYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTAGIPQ 90
           HY I  KIG G +  +F G  ++N     IK      +  +LK  YR  KIL    G P 
Sbjct: 49  HYEIVNKIGRGKYSEVFRGKCVVNDEYCVIK----VLKPVKLKKIYRELKILTNLTGGPN 104

Query: 91  AYYFGQEGLHNILVIDLLGPS--------LEDL----FDWCGRRFSVKTVVQVAVQMITL 138
                      I ++D++  S         E++    F     +F++  +     Q++  
Sbjct: 105 V----------IALLDIVQDSGSKIPALIFEEVKNVDFRTLYLKFTLPDIQYYFSQLLIA 154

Query: 139 IEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQY 181
           ++  H+  +++RD+KP N +I     P E K+ LID+G+A+ Y
Sbjct: 155 LDYCHSMGIMHRDVKPQNVMID----PVERKLRLIDWGLAEFY 193

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score = 48.1 bits (113), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 99/229 (43%), Gaps = 28/229 (12%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLK------DEYRTYKILAGT 85
           ++I + +G GSFG +    +  NG   A+K   +K+   +LK      DE     I++  
Sbjct: 145 FQILRTLGTGSFGRVHLVRSNHNGRFYAMKVL-KKNTVVKLKQVEHTNDERNMLSIVSHP 203

Query: 86  AGIPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHT 144
             I     F Q+     +++D + G  L  L     +RF        A ++   +E LH+
Sbjct: 204 FIIRMWGTF-QDSQQLFMIMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVCLALEYLHS 261

Query: 145 HDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 204
             +IYRD+KP+N L+ + G      + L DFG AK   D      + Y    +L GT  Y
Sbjct: 262 KGIIYRDLKPENILLDKNG-----HIKLTDFGFAKYVPD------VTY----TLCGTPDY 306

Query: 205 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 253
           ++      +  ++  D  + G + +  L G  P+      N  + YE I
Sbjct: 307 IAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYD---SNTIKTYENI 352

>YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine
           protein kinase required for sporulation and production
           of daughter specific proteins [2271 bp, 756 aa]
          Length = 756

 Score = 48.5 bits (114), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 68/151 (45%), Gaps = 17/151 (11%)

Query: 36  KKIGEGSFG----VLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTAG--IP 89
           K IG+G+FG    V  + T  I  +   +K E  K +  QL        +LAG+    + 
Sbjct: 356 KVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDSPWVV 413

Query: 90  QAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDL 147
             YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H    
Sbjct: 414 SLYYSFQDAQYLYLIMEFLPGGDLMTMLIRW--QLFTEDVTRFYMAECILAIETIHKLGF 471

Query: 148 IYRDIKPDNFLIGRPGTPDENKVHLIDFGMA 178
           I+RDIKPDN LI   G      + L DFG++
Sbjct: 472 IHRDIKPDNILIDIRG-----HIKLSDFGLS 497

>Scas_651.18
          Length = 371

 Score = 48.1 bits (113), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 60/134 (44%), Gaps = 18/134 (13%)

Query: 120 GRRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAK 179
            +RF        A ++   +E LH+ D+IYRD+KP+N L+ + G      + + DFG AK
Sbjct: 151 SQRFPNPVAKFYAAEVCLALEYLHSMDIIYRDLKPENILLDKNG-----HIKITDFGFAK 205

Query: 180 QYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 239
              D      I Y    +L GT  Y++      +  ++  D  + G + +  L G  P+ 
Sbjct: 206 YVPD------ITY----TLCGTPDYIAPEVVSTKPYNKSVDWWSFGILIYEMLAGYTPFY 255

Query: 240 GLKAPNNKQKYEKI 253
                N  + YE I
Sbjct: 256 D---SNTMKTYENI 266

>CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 1682

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 85/185 (45%), Gaps = 15/185 (8%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPR-----KSEAPQLKDEYRTYKILAGTA 86
           Y I K I +G++G ++     + G   AIK   +     K++   +K E     + +   
Sbjct: 782 YDIIKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMVQSDKP 841

Query: 87  GIPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTH 145
            + + Y   Q   +  LV++ L G  L  L    G     + V Q   ++I  +ED+H +
Sbjct: 842 YVARLYATFQNKDNLFLVMEYLPGGDLATLLKMMGC-LPDEWVKQYLSEIIIGVEDMHNN 900

Query: 146 DLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 205
            +I+ D+KP+N LI   G      + L DFG+++     K  +HIP  +  SLS      
Sbjct: 901 GIIHHDLKPENLLIDVSG-----HLKLTDFGLSRAGL-VKRHRHIP--KPISLSNADTRS 952

Query: 206 SINTH 210
           +I++H
Sbjct: 953 NIDSH 957

>YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine
           protein kinase of the MAP kinase kinase (MEK) family
           involved in cell wall integrity (low-osmolarity) pathway
           [1527 bp, 508 aa]
          Length = 508

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 58/132 (43%), Gaps = 14/132 (10%)

Query: 120 GRRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAK 179
           G R S K + ++A  ++  +  LH   +I+RDIKP N L+   G     +V L DFG++ 
Sbjct: 318 GGRISEKVLGKIAEAVLRGLSYLHEKKVIHRDIKPQNILLNENG-----QVKLCDFGVSG 372

Query: 180 QYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 239
           +  +             + +GT+ YM+     G+  S   D+ +LG        G+ P  
Sbjct: 373 EAVNSLA---------TTFTGTSFYMAPERIQGQPYSVTSDVWSLGLTILEVANGKFPCS 423

Query: 240 GLKAPNNKQKYE 251
             K   N   +E
Sbjct: 424 SEKMAANIAPFE 435

>Kwal_55.21545
          Length = 865

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/229 (21%), Positives = 99/229 (43%), Gaps = 35/229 (15%)

Query: 28  VGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTAG 87
           V   ++  + IG G FGV+++G         AIK     S   +++D  +  + L+    
Sbjct: 15  VSTLFKRTEVIGRGKFGVVYKGYYTKTKQVCAIKVLNLDSADDEVEDVQKEIQFLSSLKQ 74

Query: 88  IPQ-AYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQ-----------VAVQM 135
           +P   +Y+G           L    L  + ++C    S++T+++           +  ++
Sbjct: 75  VPNITHYYGSY---------LNDTKLWVIMEYCAGG-SLRTLLRPGKIGEQYIGVIMREL 124

Query: 136 ITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREK 195
           +T +  +H   +I+RDIK  N LI   G      + L DFG+A Q    K +       +
Sbjct: 125 LTALMHIHKDGVIHRDIKAANVLITNDG-----HIKLCDFGVAAQLSQTKIR-------R 172

Query: 196 KSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 243
           ++++GT  +M+    + G     + D+ +LG   +    G  P+  ++A
Sbjct: 173 QTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEA 221

>Kwal_14.1159
          Length = 1521

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 71/154 (46%), Gaps = 12/154 (7%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPR-----KSEAPQLKDEYRTYKILAGTA 86
           Y + K I +G++G +F     I G   AIK   +     K++   +K E     + +   
Sbjct: 677 YDVIKPISKGAYGSVFLAKRRITGEYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQSNKP 736

Query: 87  GIPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTH 145
            + + Y   Q   +  LV++ L G  L  L    G     + V Q   ++I  +ED+H  
Sbjct: 737 YVAKLYATFQNRGNLFLVMEYLSGGDLGTLIKMMGS-LPDQWVKQYISEVIYGVEDMHQS 795

Query: 146 DLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAK 179
            +I+ D+KPDN LI + G      + L DFG+++
Sbjct: 796 GIIHHDLKPDNLLIDQRG-----HLKLTDFGLSR 824

>Kwal_27.11919
          Length = 209

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 89/207 (42%), Gaps = 24/207 (11%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVA----IKFEPRKSEAPQLKDEYRTYKILAGTA- 86
           Y+  +K+GEG++GV+++  ++ +G  V     I+ E      P      R   +L     
Sbjct: 7   YKRLEKVGEGTYGVVYKALDLRHGQRVVALKKIRLESEDEGVPS--TAIREISLLKELKD 64

Query: 87  -GIPQAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDL 142
             I + Y       H + LV + L   L+   +   +        + +  +Q+   I   
Sbjct: 65  DNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEAIPKEQPLGDNIIKKFMMQLCKGIAYC 124

Query: 143 HTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 202
           H+H +++RD+KP N LI R G      + L DFG+A+ +        +P R       T 
Sbjct: 125 HSHRILHRDLKPQNLLINRDGN-----MKLADFGLARAF-------GVPLRAYTHEIVTL 172

Query: 203 RYMSINTHLGREQ-SRRDDMEALGHVF 228
            Y +    LG +Q S   D+ ++G +F
Sbjct: 173 WYRAPEVLLGGKQYSTGVDIWSIGCIF 199

>ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH]
           complement(731433..736142) [4710 bp, 1569 aa]
          Length = 1569

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 69/154 (44%), Gaps = 12/154 (7%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPR-----KSEAPQLKDEYRTYKILAGTA 86
           Y I K I +G++G ++     I G   AIK   +     K++   +K E     + +   
Sbjct: 682 YDIIKPISKGAYGSVYLAYKRITGEYFAIKVLRKSDMIAKNQVTNVKSERVIMMVQSEKP 741

Query: 87  GIPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTH 145
            + + Y   Q   +  LV++ L G  L  L    G     K   Q   ++I  ++D+H  
Sbjct: 742 YVAKLYATFQNKENLFLVMEYLSGGDLATLIKMMGN-LPDKWAKQYITEVIIGVDDMHMS 800

Query: 146 DLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAK 179
            +I+ D+KPDN LI   G      V L DFG+++
Sbjct: 801 GIIHHDLKPDNLLIDSNG-----HVKLTDFGLSR 829

>AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C
           (TPK1) - SH] (405062..406222) [1161 bp, 386 aa]
          Length = 386

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 55/119 (46%), Gaps = 15/119 (12%)

Query: 120 GRRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAK 179
            +RF        A ++   +E LH+ D+IYRD+KP+N L+ + G      + L DFG AK
Sbjct: 168 SQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNG-----HIKLTDFGFAK 222

Query: 180 QYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 238
              D      + Y    +L GT  Y++      +  ++  D  + G + +  L G  P+
Sbjct: 223 YVPD------VTY----TLCGTPDYIAPEVVSTKPYNKSVDWWSFGILIYEMLAGYTPF 271

>ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH]
           (810941..811828) [888 bp, 295 aa]
          Length = 295

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 90/208 (43%), Gaps = 24/208 (11%)

Query: 31  HYRIGKKIGEGSFGVLFEGTNMINGVPVA----IKFEPRKSEAPQLKDEYRTYKILAGTA 86
           +Y+  +K+GEG++GV+++  ++ +G  +     I+ E      P      R   +L    
Sbjct: 6   NYKRLEKVGEGTYGVVYKAVDLRHGQRIVALKKIRLESEDEGVPS--TAIREISLLKELK 63

Query: 87  --GIPQAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIED 141
              I + Y       H + LV + L   L+   +   +      K + +  +Q+   I  
Sbjct: 64  DDNIVRLYDIVHSDAHKLYLVFEFLELDLKRYMESVPKDQPLGDKIIKKFMMQLCKGIAY 123

Query: 142 LHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 201
            H H +I+RD+KP N LI R G      + L DFG+A+ +        +P R       T
Sbjct: 124 CHAHRIIHRDLKPQNLLINRNGN-----LKLGDFGLARAF-------GVPLRAYTHEIVT 171

Query: 202 ARYMSINTHLGREQ-SRRDDMEALGHVF 228
             Y +    LG +Q S   D+ ++G +F
Sbjct: 172 LWYRAPEVLLGGKQYSTGVDVWSIGCIF 199

>AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH]
           complement(564252..566714) [2463 bp, 820 aa]
          Length = 820

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 82/196 (41%), Gaps = 47/196 (23%)

Query: 32  YRIGKKIGEGSFGVLF--------------EGTNMINGVPVAIKFE-------------P 64
           Y++ +++G GSFG +               EGT M   +   I+ E              
Sbjct: 38  YKLIQELGNGSFGSVTLAKAQFEISQINGKEGTLMDQSIIPTIREENWNNKNKGLVAIKT 97

Query: 65  RKSEAPQLKDEYRTYKI-----LAGTAGIPQAY-YFGQEGLHNI-LVIDLLGPSLEDLFD 117
             +  P L D  R  +I     +   A + Q Y  F  + L+ + +V++ +  ++  L  
Sbjct: 98  MMTRLPTLNDYTRVREIKFILQIPAHAHLVQIYELFIDDSLYQLHIVMECMEQNIYQLMK 157

Query: 118 WCGRR-FSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGT------------ 164
              RR FS+ T+  +  Q+++ I  +H H+  +RDIKP+N LI                 
Sbjct: 158 CRKRRVFSLPTLRSILSQILSGIRHIHAHNFYHRDIKPENILISPANRYYSKEWISAGHY 217

Query: 165 PDENKVHLIDFGMAKQ 180
           PD   V + D+G+A+ 
Sbjct: 218 PDNYVVKIADYGLARH 233

>KLLA0F09020g 836287..839073 weakly similar to sp|P43565
           Saccharomyces cerevisiae YFL033c RIM15 protein kinase
           involved in expression of meiotic genes, start by
           similarity
          Length = 928

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 89/201 (44%), Gaps = 18/201 (8%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPR-----KSEAPQLKDEYRTYKILAGTA 86
           Y + K I +G++G ++     + G   AIK   +     K++   +K E     + +   
Sbjct: 702 YDVIKPISKGAYGSVYLAKKRVTGEYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQSDKP 761

Query: 87  GIPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTH 145
            + + Y   Q   +  LV+  L G  +  L    G     K   Q   ++I+ ++D+H +
Sbjct: 762 YVARLYATFQNKENLFLVMQYLSGGDMATLIKMMGN-LPEKWAKQYICEVISGVDDMHQN 820

Query: 146 DLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQ--YRDPKTKQHIPYREKKSLSGTAR 203
            +I+ D+KPDN LI   G      + L DFG+++    R  K K+    R  +  S    
Sbjct: 821 GIIHHDLKPDNLLIDSLG-----HIKLTDFGLSRMGLLRRHKEKR----RNSQIQSSRNP 871

Query: 204 YMSINTHLGREQSRRDDMEAL 224
             + ++ + R+ S  D ++++
Sbjct: 872 SFTCDSSVTRKNSVTDSLQSV 892

>Sklu_1843.3 YOR231W, Contig c1843 2632-4092 reverse complement
          Length = 486

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 57/127 (44%), Gaps = 14/127 (11%)

Query: 120 GRRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAK 179
           G R S K + ++A  ++  +  LH   +I+RDIKP N L+   G     +V L DFG++ 
Sbjct: 295 GGRISEKVLGKIAESVLRGLSYLHERRIIHRDIKPQNILLNEIG-----QVKLCDFGVSG 349

Query: 180 QYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 239
           +  +             + +GT+ YM+     G+  S   D+ +LG       +G  P+ 
Sbjct: 350 EAVNSLA---------TTFTGTSYYMAPERIQGQPYSVTSDVWSLGLTLLEVAQGHFPFN 400

Query: 240 GLKAPNN 246
             K   N
Sbjct: 401 SDKMAIN 407

>Kwal_26.8796
          Length = 796

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/215 (22%), Positives = 92/215 (42%), Gaps = 25/215 (11%)

Query: 38  IGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGT--AGIPQAYYFG 95
           +G+G+F  + +      G   A+K   ++     +    R  ++L       I     F 
Sbjct: 194 VGQGAFATVKKAIERKTGKTHAVKIISKRKVVGVMDGVARELEVLQRLDHPRIVSLKGFY 253

Query: 96  QEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVV--QVAVQMITLIEDLHTHDLIYRDIK 153
           ++   + LV++ +  S  DL D+     SV      ++  Q++  ++ +H+  + +RD+K
Sbjct: 254 EDKDSHYLVMEFV--SGGDLMDFVAAHGSVGEDAGREITRQILEAVKYIHSMGISHRDLK 311

Query: 154 PDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGR 213
           PDN LI R    D   V + DFG+AK   +            K+  GT  Y++     G+
Sbjct: 312 PDNILIER---DDPVLVKITDFGLAKIQGNGTF--------MKTFCGTLAYVAPEVISGK 360

Query: 214 EQSRRD--------DMEALGHVFFYFLRGQLPWQG 240
               ++        DM ++G + +  L G LP+ G
Sbjct: 361 NSGEKEGNTYSSLVDMWSIGCLVYVILTGHLPFSG 395

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 98/238 (41%), Gaps = 36/238 (15%)

Query: 31  HYRIGKKIGEGSFGVLFEGTNMINGVPVAIK----FEPRKSEAPQLKDEYRTYKILAGTA 86
           ++ I   +G G +G +    ++  G  VAIK    FE R   + QLK E    ++     
Sbjct: 49  NFEILATLGNGQYGKVKLARDLGTGALVAIKILNRFEKRSGYSLQLKVE--NPRVNQEIE 106

Query: 87  GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR---------RFSVKTV--------- 128
            + + ++     L+ IL  D     +  + ++C R         +  +K V         
Sbjct: 107 VMKRCHHENVVELYEILN-DPESTKVYLVLEYCSRGPVKWCPENKMEIKAVGPSILTFQQ 165

Query: 129 -VQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTK 187
             +V + +++ +E LH+  + +RDIKP N LI   GT     V + DFG+A       T 
Sbjct: 166 SRKVVLDVVSGLEYLHSQGITHRDIKPSNLLISSNGT-----VKISDFGVAMSTATGSTN 220

Query: 188 QHIPYRE--KKSLSGTARYMS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG 240
               + +  K    GT  + +    +T      S   D+ +LG   +  L G+LP+  
Sbjct: 221 IQSSHEQLLKSRALGTPAFFAPELCSTEKEYSCSSAIDIWSLGVTIYCLLFGKLPFNA 278

>Scas_707.3
          Length = 1598

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 71/154 (46%), Gaps = 12/154 (7%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPR-----KSEAPQLKDEYRTYKILAGTA 86
           Y I K I +G++G ++     I G   AIK   +     K++   +K E     + +   
Sbjct: 699 YTILKPISKGAYGSVYLARKKITGDYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQSDKP 758

Query: 87  GIPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTH 145
            + + +   Q   +  LV++ L G  L  L    G     + V Q   ++I  ++D+H +
Sbjct: 759 YVARLFATFQNKENLFLVMEYLPGGDLATLIKMMGY-LPDQWVKQYLTEIIVGVDDMHRN 817

Query: 146 DLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAK 179
            +I+ D+KPDN LI   G      V L DFG+++
Sbjct: 818 WIIHHDLKPDNLLIDNLG-----HVKLTDFGLSR 846

>AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH]
           complement(498529..500688) [2160 bp, 719 aa]
          Length = 719

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 68/151 (45%), Gaps = 17/151 (11%)

Query: 36  KKIGEGSFG----VLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTAG--IP 89
           K IG+G+FG    V  + T  I  +   +K E  K +  QL        +LAG+    + 
Sbjct: 314 KVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDSPWVV 371

Query: 90  QAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDL 147
             YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H    
Sbjct: 372 SLYYSFQDAQYLYLIMEFLPGGDLMTMLIRW--QIFTEDVTRFYMAECILAIEAIHKLGF 429

Query: 148 IYRDIKPDNFLIGRPGTPDENKVHLIDFGMA 178
           I+RDIKPDN LI   G      + L DFG++
Sbjct: 430 IHRDIKPDNILIDIRG-----HIKLSDFGLS 455

>ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..27572)
           [1098 bp, 365 aa]
          Length = 365

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 71/160 (44%), Gaps = 19/160 (11%)

Query: 31  HYRIGKKIGEGSFGVLFEGTNMINGVPVAIK---------FEPRKSEAPQLKDEYRTYKI 81
           HY++   IGEG++G++    +   G  VAIK         F  R     +L   + +++ 
Sbjct: 12  HYKLVDLIGEGAYGIVCSAIHKPTGTKVAIKKIQPFTRPMFVTRTLRELKLLKFFHSHEN 71

Query: 82  LAGTAGI--PQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLI 139
           +     I  P +Y   Q+     LV +L+   L+ +        S   +     Q++  +
Sbjct: 72  IISVLDIVRPTSY---QDFEAVYLVQELMETDLQRIISQPNSFLSDDHIQYFTYQILRAL 128

Query: 140 EDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAK 179
           + LH+  +I+RD+KP N L+          + L DFG+++
Sbjct: 129 KSLHSAQVIHRDLKPSNLLLNSSC-----DLKLCDFGLSR 163

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 99/225 (44%), Gaps = 49/225 (21%)

Query: 31  HYRIGKKIGEGSFGVLFEGTNMINGVPVAIK-------------FEPRKSEAPQLKDEYR 77
           +YRI K++GEGSFG ++  T+ +    V +K             F  R+ E P +    +
Sbjct: 36  NYRIVKQVGEGSFGKVYLATHKLTHQKVVLKTGAKSDPNVVREVFYHRQFEYPFIT---K 92

Query: 78  TYKILAGTAGIPQA--YYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQM 135
            Y+++     +  A  Y  G E L++ L++    P      D   R F+         Q+
Sbjct: 93  LYEVIVTETRVWMALEYCPGNE-LYDYLLLKQRIP-----LDETRRLFA---------QI 137

Query: 136 ITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREK 195
           ++ +   H+   ++RD+K +N L+ + G        L DFG     R+  TK  +     
Sbjct: 138 VSAVFYAHSLQCVHRDLKLENILLDKNG-----YAMLTDFGFT---RECATKTQL----- 184

Query: 196 KSLSGTARYMSINTHLGREQ--SRRDDMEALGHVFFYFLRGQLPW 238
           +++ GT  YM+    + RE     + D  +LG + +  L G +P+
Sbjct: 185 ETVCGTTVYMAPEL-IKREAYDGYKVDTWSLGIILYTMLHGYMPF 228

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 90/214 (42%), Gaps = 26/214 (12%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILA-------G 84
           YR   KIG+G+ G ++    +     VAIK   + +   Q K E    +IL         
Sbjct: 683 YRNLVKIGQGASGGVYTAYEIGTNASVAIK---QMNLEKQPKKELIINEILVMKGSRHNN 739

Query: 85  TAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHT 144
                 +Y    +G   +++  + G SL D+   C    +   +  V+ + +  +  LH+
Sbjct: 740 IVNFIDSYLL--KGDLWVIMEYMEGGSLTDVVTHC--ILTEGQIAAVSRETLRGLHFLHS 795

Query: 145 HDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 204
             +I+RDIK DN L+   G      + L DFG   Q  +   K       + ++ GT  +
Sbjct: 796 KGVIHRDIKSDNILLSMDG-----NIKLTDFGFCAQINETNLK-------RTTMVGTPYW 843

Query: 205 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 238
           M+      +E   + D+ +LG +    + G+ P+
Sbjct: 844 MAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPY 877

>YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threonine
           protein kinase potentially involved in pheromone
           response [2100 bp, 699 aa]
          Length = 699

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 60/128 (46%), Gaps = 10/128 (7%)

Query: 114 DLFDWC-GRRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHL 172
           DLF      +   + +  +  Q+I  ++ LH   L +RD+K DN ++ R G      + L
Sbjct: 446 DLFSLVMSEKMHYEEICCLFKQLINGVKYLHDIGLSHRDLKLDNCVVTRRGI-----LKL 500

Query: 173 IDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQS-RRDDMEALGHVFFYF 231
           IDFG +  +  P + Q I   E   + G+  Y+S       E   R  D+ ++G +FF  
Sbjct: 501 IDFGASSVFHYPLSSQMI---EANGIVGSDPYLSPEVFYFNEYDPRALDVWSVGIIFFCM 557

Query: 232 LRGQLPWQ 239
           +  + PW+
Sbjct: 558 ITRRFPWK 565

>CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent or
           sp|P38622 Saccharomyces cerevisiae YGL158w RCK1,
           hypothetical start
          Length = 514

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 78/182 (42%), Gaps = 39/182 (21%)

Query: 31  HYRIGKKIGEGSFGVLFEGTNMINGVP----VAIKFEPR---------KSEAPQLKDEYR 77
           +YRI  KIGEG+F  +F+   + N +     VAIK  P+         K+   Q  +E  
Sbjct: 66  NYRIISKIGEGAFSRVFKAVPLHNNLALPKFVAIKVVPKEDFHDHNLKKTSKLQTLNELN 125

Query: 78  TYKILAGTAGIPQA------------YYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSV 125
            +  L   A +P              YYF QE +         G     +  +    FS 
Sbjct: 126 IHLKLTK-ANVPNVVKLLEFQVSKKYYYFIQEYIEG-------GEIFNQIVKYT--YFSE 175

Query: 126 KTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPK 185
                V  Q+ T ++ LH +++I+RDIKP+N LI  P    E  +H   +   ++  DPK
Sbjct: 176 DLTRHVIRQVATAVKGLHENNIIHRDIKPEN-LIFEPIIK-EQTIH--RYQKLRKSDDPK 231

Query: 186 TK 187
           TK
Sbjct: 232 TK 233

>ABL011C [581] [Homologous to ScYLR362W (STE11) - SH]
           (378259..380364) [2106 bp, 701 aa]
          Length = 701

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/255 (24%), Positives = 106/255 (41%), Gaps = 51/255 (20%)

Query: 23  EDSTIVGLHYRI--------GKKIGEGSFGVLFEGTNMINGVPVAIK---FEPRKSEAPQ 71
           +D  IV L  ++        G +IG GSFG ++ G N   G  +A+K    EP    A  
Sbjct: 398 DDDNIVSLPTKVVTPKSWLKGARIGSGSFGSVYLGMNAHTGELMAVKQVELEPTTVMASS 457

Query: 72  LKDEYRTY----KILAGTAGIPQ---------------------AYYFG--QEGLH-NIL 103
             D+ +++     ++      PQ                       Y+G  QEG + NI 
Sbjct: 458 --DDKKSHPSSNAVVKKLTDPPQDGGRASSTKMNLLKELHHENIVTYYGSSQEGGNLNIF 515

Query: 104 VIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPG 163
           +  + G S+  + +  G  F    V     Q +  +  LH  ++I+RDIK  N LI   G
Sbjct: 516 LEYVPGGSVSSMLNSYGP-FEEPLVKNFTRQTLVGLTYLHRKNIIHRDIKGANLLIDIKG 574

Query: 164 TPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEA 223
           +     V + DFG++K+      KQ+    ++ SL G+  +M+         + + D+ +
Sbjct: 575 S-----VKITDFGISKKLSPLNKKQN----KRASLQGSVYWMAPEVVKQVVTTEKADIWS 625

Query: 224 LGHVFFYFLRGQLPW 238
           +G V      G+ P+
Sbjct: 626 VGCVVVEMFTGKHPF 640

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 100/229 (43%), Gaps = 48/229 (20%)

Query: 26  TIVGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIK-------------FEPRKSEAPQL 72
           T VG +Y+I K+IGEGSFG ++  T+      V +K             F  R+ + P +
Sbjct: 37  TEVG-NYKIQKQIGEGSFGKVYLATHRPTKQKVVLKTGDKSDPNVVREVFYHRQFDYPYI 95

Query: 73  KDEYRTYKILAGTAGIPQA--YYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQ 130
               + Y+++     +  A  Y  G+E   ++L    L P+LE     C   F+      
Sbjct: 96  T---KLYEVIVTETKVWMALEYCPGKELYDHLLSKSRL-PTLE-----CAELFA------ 140

Query: 131 VAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHI 190
              Q+   +   HT + ++RD+K +N L+ + G        L DFG     R+  TK  +
Sbjct: 141 ---QITGAVHYAHTLNCVHRDLKLENVLLDKNG-----NAKLTDFGFT---RESMTKAVL 189

Query: 191 PYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPW 238
                +++ GT  YM+      +     + D+ +LG + +  L G LP+
Sbjct: 190 -----ETVCGTTVYMAPEMIQHKPYDGFKVDIWSLGVILYTLLCGCLPF 233

>KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces
           cerevisiae YPR161c SGV1 ser/thr protein kinase,
           hypothetical start
          Length = 645

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 81/203 (39%), Gaps = 52/203 (25%)

Query: 22  REDSTIVGL-----HYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEY 76
           RE+  + G+     +YR  +K+G+G+FG +F+G ++     VAIK    ++E    KD +
Sbjct: 40  RENEKVYGVTKFLNNYREEEKLGQGTFGEVFKGIHLGTNRKVAIKRILVRAE----KDLF 95

Query: 77  -----RTYKILA------------------------GTAGIPQAYYFGQE---------G 98
                R   IL                          T+  P   Y G           G
Sbjct: 96  PITAQREITILKRMNHKNIVKLIEIVYDESPTPKTDSTSPRPVGNYHGNNTANQQKLITG 155

Query: 99  LHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFL 158
            H  +++  +   L  L       F +  V  + +Q++  I  +H +  ++RDIK  N L
Sbjct: 156 KHFFMILPYMVSDLTGLLHNPRVEFGMADVKNIMLQLLEGINYIHCNKFLHRDIKTANIL 215

Query: 159 IGRPGTPDENKVHLIDFGMAKQY 181
           I   G      V + DFG+A+ Y
Sbjct: 216 IDHKGV-----VKIADFGLARNY 233

>Kwal_33.14554
          Length = 714

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 70/155 (45%), Gaps = 17/155 (10%)

Query: 32  YRIGKKIGEGSFG----VLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTAG 87
           ++  K IG+G+FG    V  + T  I  +   +K E  K +  QL        +LAG+  
Sbjct: 303 FQTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDS 360

Query: 88  --IPQAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLH 143
             +   YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H
Sbjct: 361 PWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRW--QIFTEDVTRFYMAECILAIEAIH 418

Query: 144 THDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMA 178
               I+RDIKPDN LI   G      + L DFG++
Sbjct: 419 KLGFIHRDIKPDNILIDIRG-----HIKLSDFGLS 448

>Scas_201.1*
          Length = 274

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 63/117 (53%), Gaps = 9/117 (7%)

Query: 122 RFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQY 181
           +F+    V + VQ++  ++ +H+ ++++RD+KP+N L   P   DE+++ + DFG+AK+ 
Sbjct: 130 KFTEVDAVNIMVQLLDAVKYIHSQNIVHRDLKPENVLYLDPS--DESQLVIADFGIAKEL 187

Query: 182 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 238
              K+   + ++     +G+  Y++          +  D+ +LG + +  L G  P+
Sbjct: 188 ---KSNDDLIFKG----AGSLGYVAPEVLTKEGHGKPCDIWSLGVITYTLLSGYSPF 237

>Kwal_26.8709
          Length = 829

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 100/226 (44%), Gaps = 37/226 (16%)

Query: 32  YRIGKKIGEGSFGVLFEG----TNMINGVP--VAIKFEPRKSEAPQLKDEYRTYKILAGT 85
           Y +G  +GEG FG +  G    +N    VP  VAIK   R +     + E + Y+ +   
Sbjct: 40  YIVGSTLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRRDTIPKNSEKEIKIYREINAL 99

Query: 86  AGI--PQAYYFGQEGLHNILVIDLLGPSLE-----DLFDWC--GRRFSVKTVVQVAVQMI 136
             +  P      +E L N   I ++   LE     + + +    RR       ++  Q+I
Sbjct: 100 KHLNHPNIVRL-EEVLQNSKYIGIV---LEYASGGEFYKYIQKKRRLKEGPACRLFAQLI 155

Query: 137 TLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLI-DFGMAKQYRDPKTKQHIPYRE- 194
           + +  +H+  L++RD+K +N L+      D+N+  LI DFG   ++        +P  E 
Sbjct: 156 SGVYYMHSKGLVHRDLKLENLLL------DKNENLLITDFGFVNEF--------LPENEL 201

Query: 195 KKSLSGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLPW 238
            K+  G+  Y +    +     ++R+ D+ + G + +  L G LPW
Sbjct: 202 MKTSCGSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPW 247

>Sklu_2104.1 YBR160W, Contig c2104 694-1593
          Length = 299

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 89/207 (42%), Gaps = 24/207 (11%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVA----IKFEPRKSEAPQLKDEYRTYKILAGTA- 86
           Y+  +K+GEG++GV+++  ++ +G  +     I+ E      P      R   +L     
Sbjct: 7   YKRLEKVGEGTYGVVYKALDLRHGNRIVALKKIRLESEDEGVPS--TAIREISLLKELRD 64

Query: 87  -GIPQAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDL 142
             I + Y       H + LV + L   L+   +   +      K + +  +Q+   I   
Sbjct: 65  DNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESVPKEQPLGNKIIKKFMMQLCKGIAYC 124

Query: 143 HTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 202
           H H +++RD+KP N LI R G      + L DFG+A+ +        +P R       T 
Sbjct: 125 HAHRILHRDLKPQNLLINRDGN-----LKLGDFGLARAF-------GVPLRAYTHEIVTL 172

Query: 203 RYMSINTHLGREQ-SRRDDMEALGHVF 228
            Y +    LG +Q S   D+ ++G +F
Sbjct: 173 WYRAPEVLLGGKQYSTGVDIWSIGCIF 199

>Kwal_55.20326
          Length = 750

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 61/260 (23%), Positives = 108/260 (41%), Gaps = 54/260 (20%)

Query: 23  EDSTIVGLHYRI--------GKKIGEGSFGVLFEGTNMINGVPVAIK---FEPRKSEA-- 69
           ED  ++ L  +I        G +IG GSFG ++ G N   G  +A+K    +P    A  
Sbjct: 441 EDEDVISLPTKIATPKNWLKGARIGSGSFGSVYLGMNAQTGELMAVKQVELQPTAVAAGV 500

Query: 70  ----PQLKDEY-----------------RTYKILAGTAGIPQ-------AYYFG--QEGL 99
                ++K +Y                 +    L    G+ +         Y+G  QEG 
Sbjct: 501 VSVPDEVKKQYNQNANGSAVKNSSQVHRKMVDALQHEMGLLKELQHENIVTYYGSSQEGG 560

Query: 100 H-NILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFL 158
           + NI +  + G S+  + +  G  F    +     Q++  +  LH  D+I+RDIK  N L
Sbjct: 561 NLNIFLEYVPGGSVSSMLNSYGP-FEEPLIRNFTRQILIGLSYLHRKDIIHRDIKGANIL 619

Query: 159 IGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRR 218
           I   G      V + DFG++K+      +Q+    ++ SL G+  +M+         +++
Sbjct: 620 IDIKGC-----VKITDFGISKKLSPLNQQQN----KRASLQGSVYWMAPEVVKQVVTTKK 670

Query: 219 DDMEALGHVFFYFLRGQLPW 238
            D+ ++G V      G+ P+
Sbjct: 671 ADIWSVGCVIIEMFTGKHPF 690

>YJL141C (YAK1) [2777] chr10 complement(147885..150308)
           Serine/threonine protein kinase, negative regulator of
           cell growth acting in opposition to cAMP-dependent
           protein kinase A [2424 bp, 807 aa]
          Length = 807

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 81/184 (44%), Gaps = 28/184 (15%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSE-APQLKDEYRTYKILAGTAGIPQ 90
           Y +   +G+G+FG + +  N++    +A+K    ++E   Q   E +  ++L        
Sbjct: 369 YLVLDILGQGTFGQVVKCQNLLTKEILAVKVVKSRTEYLTQSITEAKILELLNQKIDPTN 428

Query: 91  AYYFGQ------EGLHNILVIDLLGPSLEDLFDWCGRRF---SVKTVVQVAVQMITLIED 141
            ++F +         H  LV +LL  +L +L      +F   S++ +     Q++  +  
Sbjct: 429 KHHFLRMYDSFVHKNHLCLVFELLSNNLYELLK--QNKFHGLSIQLIRTFTTQILDSLCV 486

Query: 142 LHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQ-------------YRDPKTKQ 188
           L    LI+ D+KP+N L+  P  P+   + +IDFG + +             YR P+   
Sbjct: 487 LKESKLIHCDLKPENILLCAPDKPE---LKIIDFGSSCEEARTVYTYIQSRFYRAPEIIL 543

Query: 189 HIPY 192
            IPY
Sbjct: 544 GIPY 547

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/219 (21%), Positives = 96/219 (43%), Gaps = 35/219 (15%)

Query: 38  IGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTAGIPQ-AYYFGQ 96
           IG G FGV+++  ++      AIK     +   +++D  +  + L+     P   +Y+G 
Sbjct: 22  IGRGKFGVVYKAFHVKTQQVYAIKVLNLDNTEDEVEDIRKEIQFLSSLKQTPNITHYYGS 81

Query: 97  EGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAV-----------QMITLIEDLHTH 145
                     L+   L  + ++C    S++T+++  +           +++  +  +H  
Sbjct: 82  Y---------LIDTKLWVIMEYCAGG-SLRTLLRPGIIEEKYIGVIMREILVALISIHRD 131

Query: 146 DLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 205
           ++I+RDIK  N LI   G+     V L DFG+A Q      K       +++++GT  +M
Sbjct: 132 NVIHRDIKAANILIANNGS-----VKLCDFGVAAQLSQSMLK-------RQTMAGTPYWM 179

Query: 206 SINTHL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 243
           +    + G     + D+ +LG   +    G  P+  ++A
Sbjct: 180 APEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCHMEA 218

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 57/214 (26%), Positives = 96/214 (44%), Gaps = 21/214 (9%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQ---LKDEYRTYKILAGT--A 86
           + +G+K+G+G FG ++   +  +G   A+K    K+E  Q   LK   R   I  G    
Sbjct: 100 FEVGRKLGKGKFGKVYCVRHKKSGFICALK-AIEKNEILQFNLLKQLKREVDIQLGMDHP 158

Query: 87  GIPQAY-YFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTH 145
            I + Y +F  E    +L+   +   L       G  F+         Q+   +  +H  
Sbjct: 159 NIIKLYAHFHDEKRVYLLMEHSINGELYKSLKNNGP-FNDVLASHYIYQIADALHYMHKK 217

Query: 146 DLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 205
            +I+RD+KP+N LIG      +N V L DFG +    +P+  +      +K+L GT  Y+
Sbjct: 218 RIIHRDVKPENVLIGF-----DNVVKLADFGWS--ILNPEGSK------RKTLCGTIDYL 264

Query: 206 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 239
           S      RE   + D+ ALG + +  + G  P++
Sbjct: 265 SPEMITPREYDEQVDVWALGVLAYELVVGVPPFE 298

>KLLA0F01276g complement(120001..121560) similar to sp|P38147
           Saccharomyces cerevisiae YBR274w CHK1 regulats
           inhibitory Cdk phosphorylation of PDS1, start by
           similarity
          Length = 519

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 52/230 (22%), Positives = 95/230 (41%), Gaps = 46/230 (20%)

Query: 33  RIGKKIGEGSFGVLFEGTNMIN-GVPVAIKFEPRKSEAPQLKDEYRTYKILAGTAGIPQA 91
           ++G+ IG+GSF  +   +  ++    +A+KF    S   Q               G+ Q 
Sbjct: 16  QLGRTIGKGSFAFVKRASLEVDPSTVIAVKFIHLPSCEKQ---------------GMSQE 60

Query: 92  YYFGQEGLHN-----ILVIDLLGPSLEDLFDWCGRRFS------------VKTVVQVA-- 132
               +  LH+     + V+ ++  +L D F W     +            +    +VA  
Sbjct: 61  DVLREVKLHSRCSNFVNVLKVIDCNLSDPFLWIAMELAEGGDLFDKIEPDIGVDSEVAQF 120

Query: 133 --VQMITLIEDLH-THDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQH 189
              Q+I  I  LH T  + +RDIKP+N L+ + G      + L DFG+A  ++     + 
Sbjct: 121 YYKQLIKAISYLHDTCGVAHRDIKPENILLDKDGN-----LKLADFGLASLFKRKDGSKR 175

Query: 190 IPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 239
           I   ++ SL   A  +    +     +   D+ ++G + F  L G+ PW+
Sbjct: 176 ISRDQRGSLPYMAPEI---IYCDGYYADMTDIWSIGVLLFVLLTGETPWE 222

>YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kinase
           required for induction of Rnr3p and DNA repair genes
           after DNA damage [1542 bp, 513 aa]
          Length = 513

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 104/238 (43%), Gaps = 35/238 (14%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKSEAPQLKDEYRTYKILAGTAGIPQ 90
           Y +GK++G G + ++ E  N   G  VA+K F  ++++  +   ++R    +      P 
Sbjct: 200 YLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQFREETNILMRVQHPN 259

Query: 91  AYYF--------GQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAV--QMITLIE 140
                        +  +   LV++ +     +LF+   R+  ++     A+  Q++T ++
Sbjct: 260 IVNLLDSFVEPISKSQIQKYLVLEKIDDG--ELFERIVRKTCLRQDESKALFKQLLTGLK 317

Query: 141 DLHTHDLIYRDIKPDNFL--IGRPGTP--------DEN----KVHLIDFGMAKQYRDPKT 186
            LH  ++I+RDIKP+N L  I R   P        DE+    +V + DFG+AK   +   
Sbjct: 318 YLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGLAKFTGE--- 374

Query: 187 KQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAP 244
                 +   +L GT  Y++      +  + + D+ + G + +  L G  P+     P
Sbjct: 375 -----MQFTNTLCGTPSYVAPEVLTKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGP 427

>Scas_654.12
          Length = 737

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 67/151 (44%), Gaps = 17/151 (11%)

Query: 36  KKIGEGSFG----VLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTAG--IP 89
           K IG+G+FG    V    T  I  +   +K E  K +  QL        +LAG+    + 
Sbjct: 323 KVIGKGAFGEVRLVQKIDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDSPWVV 380

Query: 90  QAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDL 147
             YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H    
Sbjct: 381 SLYYSFQDTQYLYLIMEFLPGGDLMTMLIRW--QLFTEDVTRFYMAECILAIETIHKLGF 438

Query: 148 IYRDIKPDNFLIGRPGTPDENKVHLIDFGMA 178
           I+RDIKPDN LI   G      + L DFG++
Sbjct: 439 IHRDIKPDNILIDIRG-----HIKLSDFGLS 464

>YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinase
           kinase (MEK) serine/threonine protein kinase, involved
           in cell wall integrity (low-osmolarity) pathway [1521
           bp, 506 aa]
          Length = 506

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 58/127 (45%), Gaps = 14/127 (11%)

Query: 120 GRRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAK 179
           G R S + + ++A  ++  +  LH   +I+RDIKP N L+   G     ++ L DFG++ 
Sbjct: 311 GGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKG-----EIKLCDFGVSG 365

Query: 180 QYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 239
           +  +             + +GT+ YM+     G+  S   D+ +LG        G+ P++
Sbjct: 366 EAVNSLA---------MTFTGTSFYMAPERIQGQPYSVTCDVWSLGLTLLEVAGGRFPFE 416

Query: 240 GLKAPNN 246
             K   N
Sbjct: 417 SDKITQN 423

>Scas_700.54
          Length = 698

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 50/228 (21%), Positives = 100/228 (43%), Gaps = 28/228 (12%)

Query: 38  IGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGT--AGIPQAYYFG 95
           +G+G+F  + +      G   A+K   ++     ++   R  ++L       I +   F 
Sbjct: 229 VGQGAFATVKKAVERSTGKTFAVKIISKRKVMGNMEGVSRELEVLQQLDHPRIVRLKGFY 288

Query: 96  QEGLHNILVIDLLGPSLEDLFDWCGRRFSV--KTVVQVAVQMITLIEDLHTHDLIYRDIK 153
           ++     +V++ +     DL D+     +V  +   +++ Q++  ++ +H+  + +RD+K
Sbjct: 289 EDKDSYYMVMEFVSGG--DLMDFVAAHGAVGEEAGKEISRQILEAVKYIHSKGISHRDLK 346

Query: 154 PDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGR 213
           PDN LI +    D   V + DFG+AK   +            K+  GT  Y++     G+
Sbjct: 347 PDNILIEQ---DDPVLVKITDFGLAKVQGNGSF--------MKTFCGTLAYVAPEVIGGK 395

Query: 214 --------EQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 253
                   E S   DM ++G + +  L G LP+ G      +Q Y++I
Sbjct: 396 GETNEERNEYSSLVDMWSMGCLVYVILTGHLPFSG---STQEQLYKQI 440

>CAGL0L06820g 767038..768138 highly similar to sp|P38615
           Saccharomyces cerevisiae YMR139w MDS1
           Serine/threonine-protein kinase, start by similarity
          Length = 366

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 74/164 (45%), Gaps = 16/164 (9%)

Query: 28  VGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKD-EYRTYKILAGTA 86
           + + +   + +G GSFGV+F          VAIK   +  +  + K+ E    K+L    
Sbjct: 33  ITISFPATEVVGHGSFGVVFTTVIQETNEKVAIK---KVLQDKRFKNRELEIMKMLQHRN 89

Query: 87  GIPQAYYFGQ----EGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDL 142
            I   YYF +    E +   L++D +  SL         + +    +++ + M  L + L
Sbjct: 90  IIDLKYYFYEIDEREDVFLNLILDYMPQSLYQRLRHFVHQRTPMPRLEIKIYMYQLFKAL 149

Query: 143 ----HTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYR 182
               HT ++ +RDIKP N L+     P+   + L DFG AKQ +
Sbjct: 150 NYLHHTANVCHRDIKPQNLLVD----PNSWCLRLCDFGSAKQLK 189

>Scas_616.10
          Length = 1461

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 61/129 (47%), Gaps = 17/129 (13%)

Query: 114 DLFDWCGRR--FSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENK-V 170
           +LFD+   +   S K  V    Q+I  +   H+ ++ +RD+KP+N L+ +     +NK +
Sbjct: 222 ELFDYLVSKGKLSEKEAVHYFKQIIQGVSYCHSFNICHRDLKPENLLLDK-----KNKSI 276

Query: 171 HLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFF 229
            + DFGMA           +P +  ++  G+  Y S    +G+       D+ + G + F
Sbjct: 277 KIADFGMA--------ALELPNKLLQTSCGSPHYASPEIVMGKSYHGGPSDVWSCGIILF 328

Query: 230 YFLRGQLPW 238
             L G LP+
Sbjct: 329 ALLTGHLPF 337

>Kwal_26.7861
          Length = 955

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 90/209 (43%), Gaps = 26/209 (12%)

Query: 37  KIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKIL-------AGTAGIP 89
           KIG+G+ G ++    +     VAIK   + +   Q K E    +IL       A      
Sbjct: 672 KIGQGASGGVYTAYEVGTNASVAIK---QMNLEKQPKKELIINEILVMKASKHANIVNFI 728

Query: 90  QAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDLIY 149
            +Y     G   +++  + G SL D+   C    +   +  V+ + +  ++ LH+  +I+
Sbjct: 729 DSYLL--RGDLWVVMEYMEGGSLTDVVTHC--ILTEGQIGAVSRETLKGLQFLHSKGVIH 784

Query: 150 RDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINT 209
           RDIK DN L+   G     ++ L DFG   Q  +   K       + ++ GT  +M+   
Sbjct: 785 RDIKSDNVLLSMSG-----EIKLTDFGFCAQINEINLK-------RTTMVGTPYWMAPEV 832

Query: 210 HLGREQSRRDDMEALGHVFFYFLRGQLPW 238
              +E   + D+ +LG +    + G+ P+
Sbjct: 833 VSRKEYGPKVDIWSLGIMIIEMIEGEPPY 861

>Kwal_27.9804
          Length = 473

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 74/172 (43%), Gaps = 21/172 (12%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQ----LKDEYRT--------- 78
           Y++  KIGEG+F  +++  ++   V  A      KS   +    LK  Y T         
Sbjct: 26  YKLLDKIGEGTFSSVYKAEDLTGSVTSAFSSHFWKSAGKKRYVALKRIYVTSSPQRIYNE 85

Query: 79  YKILAGTAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITL 138
             +L    G  +         H   VI +L     + F    R   +K + +   +++  
Sbjct: 86  LNLLYMLCGSTRVAPLCDALRHQDQVIAVLPWYPHEEFRNFYRDLPIKGIKKYMSELLQA 145

Query: 139 IEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAK----QYRDPKT 186
           +  +H+  +I+RDIKP NFL     +P   +  L+DFG+A+      RDP+T
Sbjct: 146 LSFVHSKAIIHRDIKPTNFLY----SPQLGRGVLVDFGLAETEVSHARDPET 193

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 90/207 (43%), Gaps = 22/207 (10%)

Query: 37  KIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTAGI-PQAYYFG 95
           KIG+G+ G ++    +   V VAIK   + +   Q K E    +IL       P    F 
Sbjct: 625 KIGQGASGGVYTAYEIGTNVSVAIK---QMNLEKQPKKELIINEILVMKGSKHPNIVNFI 681

Query: 96  Q----EGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDLIYRD 151
                +G   +++  + G SL D+   C    +   +  V  + ++ +E LH+  +++RD
Sbjct: 682 DSYVLKGDLWVIMEYMEGGSLTDVVTHC--ILTEGQIGAVCRETLSGLEFLHSKGVLHRD 739

Query: 152 IKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHL 211
           IK DN L+   G      + L DFG   Q  +   K       + ++ GT  +M+     
Sbjct: 740 IKSDNILLSMEG-----DIKLTDFGFCAQINELNLK-------RTTMVGTPYWMAPEVVS 787

Query: 212 GREQSRRDDMEALGHVFFYFLRGQLPW 238
            +E   + D+ +LG +    + G+ P+
Sbjct: 788 RKEYGPKVDIWSLGIMIIEMIEGEPPY 814

>KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces
           cerevisiae YJL141c YAK1 ser/thr protein kinase, start by
           similarity
          Length = 704

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 81/184 (44%), Gaps = 28/184 (15%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSE-APQLKDEYRTYKILAGTAGIPQ 90
           Y +   +G+G+FG + +  N+I    +A+K    KSE   Q   E +  ++L        
Sbjct: 332 YLVLDLLGQGTFGQVVKCQNLITKEILAVKVVKSKSEYLNQSVTEAKVLELLNRQIDPNN 391

Query: 91  AYYFGQ------EGLHNILVIDLLGPSLEDLF---DWCGRRFSVKTVVQVAVQMITLIED 141
            ++F +         H  LV +LL  +L +L    ++ G   S+  +   + Q++  +  
Sbjct: 392 EHHFLRLHDTFVHKHHLCLVFELLSNNLYELLKLNEFHG--LSMTLIKTFSKQLLDSLCV 449

Query: 142 LHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQ-------------YRDPKTKQ 188
           L    LI+ D+KP+N L+     PD   + +IDFG A +             YR P+   
Sbjct: 450 LKDSKLIHCDLKPENILLVSNDRPD---LKVIDFGSACEETRTIYTYIQSRFYRAPEVLL 506

Query: 189 HIPY 192
            IPY
Sbjct: 507 GIPY 510

>YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3
           subfamily of protein kinases, required for induction of
           IME2 by Ime1p [1113 bp, 370 aa]
          Length = 370

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 75/164 (45%), Gaps = 16/164 (9%)

Query: 28  VGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKD-EYRTYKILAGTA 86
           V + +   + +G GSFGV+F          VAIK   +  +  + K+ E    K+L+   
Sbjct: 35  VQISFPTTEVVGHGSFGVVFATVIQETNEKVAIK---KVLQDKRFKNRELEIMKMLSHIN 91

Query: 87  GIPQAYYF----GQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDL 142
            I   Y+F     Q+ ++  L+++ +  SL         + +  + +++   M  L + L
Sbjct: 92  IIDLKYFFYERDSQDEIYLNLILEYMPQSLYQRLRHFVHQRTPMSRLEIKYYMFQLFKSL 151

Query: 143 ----HTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYR 182
               H  ++ +RDIKP N L+     P+   + L DFG AKQ +
Sbjct: 152 NYLHHFANVCHRDIKPQNLLVD----PETWSLKLCDFGSAKQLK 191

>AEL120W [2386] [Homologous to ScYKL171W - SH]
           complement(396394..398715) [2322 bp, 773 aa]
          Length = 773

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 40/61 (65%), Gaps = 1/61 (1%)

Query: 125 VKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDP 184
            K  + +A+Q+I+ ++ +H+  +++ D+K +N L+ + G+    K++L DFGM+ QY  P
Sbjct: 477 CKLTIALALQLISALKYMHSKYIVHADVKLENCLLEKTGS-QSWKLYLCDFGMSCQYGKP 535

Query: 185 K 185
           +
Sbjct: 536 R 536

>CAGL0B02739g complement(262590..264620) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, hypothetical start
          Length = 676

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 96/235 (40%), Gaps = 41/235 (17%)

Query: 35  GKKIGEGSFGVLFEGTNMINGVPVAIK--------------------FEPRKSEAPQ--- 71
           G +IG GSFG ++ G N   G  +A+K                     E   ++AP    
Sbjct: 392 GARIGSGSFGTVYLGMNAQTGELMAVKQVEIKPAIAATADANVEDKNAEKNVAKAPSTNL 451

Query: 72  -------LKDEYRTYKILAGTAGIPQAYYFGQEGLH-NILVIDLLGPSLEDLFDWCGRRF 123
                  L+ E    K L     I   Y   QEG + NI +  + G S+  +    G  F
Sbjct: 452 HRKMIDALQHEMSLLKELQH-ENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLSNYGP-F 509

Query: 124 SVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRD 183
               +V    Q++  +  LH  ++I+RDIK  N LI   G      V + DFG++K+   
Sbjct: 510 EEPLIVNFTRQILIGVAYLHRKNIIHRDIKGANILIDIKGC-----VKITDFGISKKL-S 563

Query: 184 PKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 238
           P  +++    ++ SL G+  +MS         + + D+ + G V      G+ P+
Sbjct: 564 PLNQEN--QDKRTSLQGSVYWMSPEVVKQTATTSKADIWSTGCVVIEMFTGKHPY 616

>Scas_655.2
          Length = 800

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 63/138 (45%), Gaps = 10/138 (7%)

Query: 114 DLFDWC-GRRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHL 172
           DLF      + S + +     Q++T ++ LH+  L +RD+K DN +I   G      V L
Sbjct: 528 DLFAIVMSNKMSYEEICCCFKQILTGVQYLHSIGLAHRDLKLDNCVINEKGI-----VKL 582

Query: 173 IDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYF 231
           IDFG A  +  P +K  +   E   + G+  Y++    +  +   R  D+ +   +F   
Sbjct: 583 IDFGAAVVFSYPFSKTLV---EASGIVGSDPYLAPEVCIFSKYDPRPVDIWSTAIIFACM 639

Query: 232 LRGQLPWQGLKAPNNKQK 249
           +  + PW+  K  +N  K
Sbjct: 640 ILKKFPWKIPKLRDNSFK 657

>YNL183C (NPR1) [4417] chr14 complement(293137..295509)
           Serine/threonine protein kinase involved in regulating
           transport systems for nitrogen source nutrients [2373
           bp, 790 aa]
          Length = 790

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 63/138 (45%), Gaps = 10/138 (7%)

Query: 114 DLFDWC-GRRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHL 172
           DLF      + S + +     Q++T ++ LH+  L +RD+K DN +I   G      V L
Sbjct: 523 DLFAIVMSNKMSYEEICCCFKQILTGVQYLHSIGLAHRDLKLDNCVINEKGI-----VKL 577

Query: 173 IDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYF 231
           IDFG A  +  P +K  +   E   + G+  Y++    +  +   R  D+ +   +F   
Sbjct: 578 IDFGAAVVFSYPFSKNLV---EASGIVGSDPYLAPEVCIFAKYDPRPVDIWSSAIIFACM 634

Query: 232 LRGQLPWQGLKAPNNKQK 249
           +  + PW+  K  +N  K
Sbjct: 635 ILKKFPWKIPKLRDNSFK 652

>CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces
           cerevisiae YGR052w, hypothetical start
          Length = 355

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 96/232 (41%), Gaps = 33/232 (14%)

Query: 38  IGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQ--LKDEYRTYKILAGTAGIPQAY--- 92
           I  GSF  +++G N      VA+K  P KS+  Q  + +EY   K+L+   G P      
Sbjct: 14  IQSGSFSTVYKGYNTETDDFVALKVIP-KSKFSQRGMANEYNVGKLLSKDEGCPFICSFV 72

Query: 93  -YFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITL-----IEDLHT 144
            ++  E  + ++          D  +   ++   +  +++++  Q + L     I+  H+
Sbjct: 73  DFYEDETNYTLVQEYCECGDFYDFLELSKKKGDLNAPSIIKLNFQKVVLQLSYAIKYAHS 132

Query: 145 HDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHI---PYREKKSLSGT 201
             + +RDIKP+N LI   G      + L D+G A          +I    YR  ++ S  
Sbjct: 133 MGIAHRDIKPENILINYHG-----DIKLADWGHAIS-ASSSNDNNIGTDNYRGPETFSAK 186

Query: 202 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 253
             Y   NT+       R D  ++G    Y L    P++     N K  Y+++
Sbjct: 187 VSY---NTY-------RSDYWSMGVTLLYLLFSHCPFRCSNIKNEKIVYKRL 228

>Sklu_2361.3 YPL150W, Contig c2361 3677-6331
          Length = 884

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 53/244 (21%), Positives = 109/244 (44%), Gaps = 53/244 (21%)

Query: 31  HYRIGKKIGEGSFGVLFEGTNMINGVPVAIK-------------FEPRKSEAPQLKDEYR 77
           +Y+I K IGEGSFG ++   + +    V +K             F  R+ + P +    +
Sbjct: 36  NYKIVKLIGEGSFGKVYLANHRLTHQKVVLKTGNKNDPNVVREVFYHRQFDFPHIT---K 92

Query: 78  TYKILAGTAGIPQA--YYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQM 135
            Y+++   + +  A  Y  G+E L+  L++                R S++   ++  Q+
Sbjct: 93  LYEVIVTESKVWMALEYCPGKE-LYEYLLMQ--------------HRISLEESGKLFAQI 137

Query: 136 ITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREK 195
           ++ +   H+   ++RD+K +N L+ + G     +  + DFG     R+  TK  +     
Sbjct: 138 VSAVYYAHSLQCVHRDLKLENILLDKKG-----RAKITDFGFT---RECATKTML----- 184

Query: 196 KSLSGTARYMSINTHLGREQSR---RDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEK 252
           +++ GT  YM+    L   +S    + D+ +LG + +  + G +P+   +    K K++ 
Sbjct: 185 ETVCGTTVYMA--PELIERKSYDGFKIDIWSLGVILYTMIHGTMPFD--EEDETKTKWKI 240

Query: 253 IGEK 256
           I E+
Sbjct: 241 INEE 244

>ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH]
           (797020..798951) [1932 bp, 643 aa]
          Length = 643

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 80/184 (43%), Gaps = 28/184 (15%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSE-APQLKDEYRTYKILAGTAGIPQ 90
           Y I   +G+G+FG + +  NM     VA+K    K+E   Q   E +  ++L        
Sbjct: 273 YLILDILGQGTFGQVVKCQNMQTKEIVAVKVVKSKTEYLNQSIMEAKILELLNKRIDPLN 332

Query: 91  AYYFGQ------EGLHNILVIDLLGPSLEDLFDWCGRRF---SVKTVVQVAVQMITLIED 141
            ++F +         H  LV +LL  +L +L      +F   S+  +     Q++  +  
Sbjct: 333 QHHFLRLHDSFVHKNHLCLVFELLSNNLYELLK--QNKFHGLSMNLIKNFCKQLLDSLCV 390

Query: 142 LHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQ-------------YRDPKTKQ 188
           L    LI+ D+KP+N L+    +PD  ++ +IDFG A +             YR P+   
Sbjct: 391 LKESKLIHCDLKPENVLL---VSPDRPELKVIDFGSACEEARTVYTYIQSRFYRAPEVLM 447

Query: 189 HIPY 192
            IPY
Sbjct: 448 GIPY 451

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 91/214 (42%), Gaps = 26/214 (12%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILA-------G 84
           Y+   KIG+G+ G ++    +     VAIK   + +   Q K E    +IL         
Sbjct: 698 YKNLIKIGQGASGGVYTAYELGTNASVAIK---QMNLEKQPKKELIVNEILVMKGSKHNN 754

Query: 85  TAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHT 144
                 +Y F   G   +++  + G SL D+   C    +   +  V+ + +  ++ LH+
Sbjct: 755 IVNFIDSYLF--RGDLWVVMEYMEGGSLTDVVTHC--ILTEGQIGAVSRETLKGLQFLHS 810

Query: 145 HDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 204
             +I+RDIK DN L+   G      + L DFG   Q  +   K       + ++ GT  +
Sbjct: 811 KGVIHRDIKSDNILLSMNG-----DIKLTDFGFCAQINEVNLK-------RTTMVGTPYW 858

Query: 205 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 238
           M+      +E   + D+ +LG +    + G+ P+
Sbjct: 859 MAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPY 892

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 66/142 (46%), Gaps = 15/142 (10%)

Query: 98  GLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDN 156
           GL   +V++ + G  L D+  +C    +   +  V  +++  +E LH+  +++RDIK DN
Sbjct: 634 GLDLWVVMEYMEGGCLTDVVTYCV--LTEGQIGAVCREVLQGLEFLHSKGVLHRDIKSDN 691

Query: 157 FLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQS 216
            L+   G      + L DFG   Q  D   K       + ++ GT  +M+      +E  
Sbjct: 692 VLLSMNG-----DIKLTDFGFCAQVNDTVIK-------RTTMVGTPYWMAPEIVSRKEYG 739

Query: 217 RRDDMEALGHVFFYFLRGQLPW 238
            + D+ +LG +    + G+ P+
Sbjct: 740 PKVDIWSLGIMIIEMIEGEPPY 761

>Scas_675.2
          Length = 527

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 91/219 (41%), Gaps = 26/219 (11%)

Query: 34  IGKKIGEGSFGVLFEGTNMIN-GVPVAIKF---EPRKSEAPQLKDEYRTYKILAGTAGIP 89
           +G  IG+GSFG +      ++  V +A+K+      K      KD  R   + +  +  P
Sbjct: 17  LGDTIGQGSFGCVMNAHLAVDPSVIIAVKYVHIPTCKKNGLTEKDISREVLLHSRCSKNP 76

Query: 90  QAYYFGQEGLHNILVIDLLGPSLE-----DLFDWCGRRFSVKT-VVQVAVQ-MITLIEDL 142
                    +      D +   +E     DLFD       V + V Q   Q ++  I  L
Sbjct: 77  NVLRLIDCNIAK----DYMWMIMEMADGGDLFDKIEPDVGVDSEVAQFYFQQLVRAISYL 132

Query: 143 HTHD-LIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 201
           H    + +RDIKP+N L+ + G      + L DFG++ QYR       I   ++    G+
Sbjct: 133 HEECGVAHRDIKPENILLDKNG-----NLKLADFGLSSQYRRKDGTLRISTDQR----GS 183

Query: 202 ARYMSINTHLGR-EQSRRDDMEALGHVFFYFLRGQLPWQ 239
             YM+      R   +   D+ ++G + F  L G+ PW+
Sbjct: 184 PPYMAPEILHSRGYYAHSTDIWSIGILLFVLLTGETPWE 222

>CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces
           cerevisiae YOR231w MKK1 ser/thr protein kinase or
           sp|P32491 Saccharomyces cerevisiae YPL140c MKK2, start
           by similarity
          Length = 467

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 92/221 (41%), Gaps = 40/221 (18%)

Query: 26  TIVGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGT 85
           ++     R GKK+         +  N++NG P   +F+ +     Q    +++  I+   
Sbjct: 193 SVAKCKLRTGKKV------FALKTINILNGDP---EFQKQLLRELQFNKSFKSEYIV--- 240

Query: 86  AGIPQAYYFG-----QEGLHNILVIDLLGPSLEDLFDWC---GRRFSVKTVVQVAVQMIT 137
                  YFG     Q     I +  + G SLE ++      G R S K + +++  ++ 
Sbjct: 241 ------RYFGMFTDEQNSSIYIAMEYMGGKSLEAIYKELLSRGGRISEKVLGKISEAVLR 294

Query: 138 LIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKS 197
            +  LH   +I+RDIKP N L+   G     +V L DFG++ +  +             +
Sbjct: 295 GLSYLHEKKVIHRDIKPQNILLNEDG-----QVKLCDFGVSGEAVNSLA---------TT 340

Query: 198 LSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 238
            +GT+ YM+     G+  S   D+ +LG       +G  P+
Sbjct: 341 FTGTSYYMAPERIQGQPYSVTCDVWSLGLTILEVAQGHFPF 381

>KLLA0D07810g complement(669095..671251)
           gi|401646|sp|P31034|YL44_KLULA Kluyveromyces lactis
           Hypothetical 31.8 kDa protein in L44/L41 3 region, start
           by similarity
          Length = 718

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 69/152 (45%), Gaps = 19/152 (12%)

Query: 36  KKIGEGSFG----VLFEGTNMINGVPVAIKFEP-RKSEAPQLKDEYRTYKILAGTAG--I 88
           K IG+G+FG    V  + T  I  +   +K E   K +   +K E     +LAG+    +
Sbjct: 307 KVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYNKDQLAHVKAER---DVLAGSDSPWV 363

Query: 89  PQAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHD 146
              YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H   
Sbjct: 364 VSLYYSFQDSQYLYLIMEFLPGGDLMTMLIRW--QIFTEDVTRFYMAECILAIEVIHKLG 421

Query: 147 LIYRDIKPDNFLIGRPGTPDENKVHLIDFGMA 178
            I+RDIKPDN LI   G      + L DFG++
Sbjct: 422 FIHRDIKPDNILIDIRG-----HIKLSDFGLS 448

>CAGL0F03245g complement(316924..320034) similar to sp|P32361
           Saccharomyces cerevisiae YHR079c IRE1, hypothetical
           start
          Length = 1036

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 59/250 (23%), Positives = 106/250 (42%), Gaps = 67/250 (26%)

Query: 36  KKIGEGSFG-VLFEGTNMINGVPVAIKFEPRKSEAPQLKDEY-----RTYKILAGTAGIP 89
           K +G GS G V++EG           KF+ R     ++  ++     +  ++L+ +   P
Sbjct: 605 KVLGYGSSGTVVYEG-----------KFQERSVAVKRMLVDFYDIASKEIELLSESDEHP 653

Query: 90  QA--YYFGQEGLHNI-LVIDLLGPSLEDLFDWCG-----RRFSVKTVVQVAVQMITLIED 141
               YY  +E    + + ++L   +LE L +        +R     +V +  Q+   I  
Sbjct: 654 NVVRYYCSEETSKFLYIALELCDSNLEQLIETNNVMRHEQRLKDYELVDILAQITQGIAY 713

Query: 142 LHTHDLIYRDIKPDNFLIG-------RPGTPDEN---KVHLIDFGMAKQ--YRDPKTKQH 189
           LH+ ++I+RDIKP N LI        +P T + N   ++ L DFG+ K+  +     K +
Sbjct: 714 LHSLNIIHRDIKPQNILISKSKKRLQKPTTGNGNNKTRIMLSDFGLCKKLDFEQSSFKTN 773

Query: 190 IPYREKKSLSGTARYMS-------------------------INTHLGREQSRRDDMEAL 224
           I     K+ +GT  +M+                          + +L R  ++  D+ +L
Sbjct: 774 I-----KNAAGTVGWMAPELLIEDENSNKISVSQEIEKIDEVYDPYLRRRLTKAIDIFSL 828

Query: 225 GHVFFYFLRG 234
           G VF+Y L G
Sbjct: 829 GCVFYYVLSG 838

>KLLA0E14828g complement(1323743..1324675)
           gi|27526973|emb|CAD36964.1 Kluyveromyces lactis
           serine/threonine-protein kinase KIN28, start by
           similarity
          Length = 310

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 80/189 (42%), Gaps = 25/189 (13%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKD-----EYRTYKILAGTA 86
           Y   KK GEG++ V++ GT    G  +A+K    + +  Q KD       R  K L    
Sbjct: 10  YTKEKKAGEGTYAVVYLGTKKSTGRSIAVK----EIKTSQFKDGLDMSALREVKFLQELK 65

Query: 87  GIPQA----YYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDL 142
            +        +   + L+  LV++ L   LE +       FS   +    +  +  +   
Sbjct: 66  HVNVIELVDVFMANDNLN--LVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHC 123

Query: 143 HTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPK---TKQHIP--YREKKS 197
           H + +++RD+KP+N L+   G     ++ + DFG+A+    P+   T   +   YR  + 
Sbjct: 124 HRNFILHRDLKPNNLLLAPDG-----QLKIADFGLARLMASPQEILTSNVVTRWYRAPEL 178

Query: 198 LSGTARYMS 206
           L G   Y S
Sbjct: 179 LFGAKHYTS 187

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 47/97 (48%), Gaps = 12/97 (12%)

Query: 142 LHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 201
           LH   +I+RDIK DN L+   G     +V + DFG   +  D ++K       + ++ GT
Sbjct: 635 LHDKHIIHRDIKSDNVLLDTHG-----RVKITDFGFCAKLTDKRSK-------RATMVGT 682

Query: 202 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 238
             +M+      RE   + D+ +LG +    L G+ P+
Sbjct: 683 PYWMAPEVVKQREYDEKVDVWSLGIMTIEMLEGEPPY 719

>YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK),
           principal component of the high-osmolarity signal
           transduction pathway [1308 bp, 435 aa]
          Length = 435

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 75/163 (46%), Gaps = 18/163 (11%)

Query: 38  IGEGSFGVLFEGTNMINGVPVAIK--FEPRKSEAPQLKDEYRTYKIL-----AGTAGIPQ 90
           +G G+FG++   T+ +   PVAIK   +P  S A   K  YR  K+L          +  
Sbjct: 29  VGMGAFGLVCSATDTLTSQPVAIKKIMKPF-STAVLAKRTYRELKLLKHLRHENLICLQD 87

Query: 91  AYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDLIYR 150
            +    E ++   V +L G  L  L     R    + V     Q++  ++ +H+  +I+R
Sbjct: 88  IFLSPLEDIY--FVTELQGTDLHRLLQ--TRPLEKQFVQYFLYQILRGLKYVHSAGVIHR 143

Query: 151 DIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYR 193
           D+KP N LI      +   + + DFG+A+  +DP+   ++  R
Sbjct: 144 DLKPSNILIN-----ENCDLKICDFGLAR-IQDPQMTGYVSTR 180

>Scas_593.14d
          Length = 495

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 74/154 (48%), Gaps = 19/154 (12%)

Query: 127 TVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQ-----Y 181
           TV   A ++   ++ LH   ++YRD+KP+N L+      D+  + L DFG++K+      
Sbjct: 249 TVAFYAAEISCALKFLHDKGIVYRDLKPENCLLN-----DKGHLVLTDFGLSKKSVTQNS 303

Query: 182 RDPK--TKQHIPYREKKSLS---GTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQL 236
            +P   T  + P  +  +L    GT  Y +     G   ++  D  +LG + +  L G+ 
Sbjct: 304 ANPSEVTSLNEPSEDLSTLHSIIGTPEYCAPEILQGLPYNKNCDWYSLGCLIYDMLSGKP 363

Query: 237 PWQGLKAPNNKQKYEKIGEKKRVTNV-YDLAQGL 269
           P+ G    N+K    KI + K+   + Y L++G+
Sbjct: 364 PYTG---ANHKVILNKIQKDKQGPKIPYYLSEGM 394

>CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces
           cerevisiae YDL159w STE7 ser/thr/tyr protein kinase of
           MAP kinase kinase family, hypothetical start
          Length = 451

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 45/94 (47%), Gaps = 14/94 (14%)

Query: 147 LIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 206
           +I+RDIKP N LI   G     ++ L DFG++++  +      +         GT+ YMS
Sbjct: 250 IIHRDIKPSNVLINSKG-----RIKLCDFGVSRKLNNSIADTFV---------GTSTYMS 295

Query: 207 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG 240
                G + + + D+ +LG +    L G+ P  G
Sbjct: 296 PERIQGNKYTTKGDVWSLGLMLIELLTGEFPLGG 329

>Sklu_2417.13 YMR139W, Contig c2417 24824-25915 reverse complement
          Length = 363

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/166 (29%), Positives = 77/166 (46%), Gaps = 19/166 (11%)

Query: 28  VGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKD-EYRTYKILAGTA 86
           + + Y   + +G GSFGV+F  T       VAIK   +  +  + K+ E    K+L+   
Sbjct: 28  INISYPATEVVGHGSFGVVFTTTICETDQVVAIK---KVLQDKRFKNRELEIMKLLSHPQ 84

Query: 87  GIPQAYYFGQ-----EGLHNILVIDLLGPSL-EDLFDWCGRRFSVKTVVQVAVQMITLIE 140
            I   YYF +       ++  LV++ +  SL + L  +   R S    ++V + M  L +
Sbjct: 85  IIGLKYYFYETDSTTSDVYLNLVLEYMPSSLYQRLRHFVTHR-SNMPAIEVKLYMYQLFK 143

Query: 141 D---LHTHD-LIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYR 182
               LHT   + +RDIKP N L+     P    + L DFG AKQ +
Sbjct: 144 SLNYLHTCARVCHRDIKPQNLLVD----PTTFSLKLCDFGSAKQLK 185

>CAGL0H10318g complement(1006299..1007222) highly similar to
           sp|P06242 Saccharomyces cerevisiae YDL108w KIN28
           cyclin-dependent ser/thr protein kinase, hypothetical
           start
          Length = 307

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 81/185 (43%), Gaps = 17/185 (9%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKD-----EYRTYKILAGTA 86
           Y   KK+GEG++ V++ GT    G  +A+K E + SE     D     E +  + +    
Sbjct: 6   YTKEKKVGEGTYAVVYVGTKQSTGRRIAVK-EIKTSEFKDGLDMSAIREVKYLQEMQHVN 64

Query: 87  GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHD 146
            I     F   G  N LV++ L   LE +       F+   +    +  +  +   H + 
Sbjct: 65  VIELVDIFMSYGNLN-LVLEYLPTDLEVVIKDKSILFTPADIKSWMLMSVRGVHHCHRNF 123

Query: 147 LIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPK---TKQHIP--YREKKSLSGT 201
           +++RD+KP+N LI     PD  ++ + DFG+A+    P    T   +   YR  + L G 
Sbjct: 124 ILHRDLKPNNLLIA----PD-GQIKVADFGLARAVPSPHEVLTSNVVTRWYRAPELLFGA 178

Query: 202 ARYMS 206
             Y S
Sbjct: 179 KHYTS 183

>Scas_651.3
          Length = 793

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 79/182 (43%), Gaps = 24/182 (13%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSE-APQLKDEYRTYKILAGTAGIPQ 90
           Y +   +G+G+FG + +  N+     +A+K    +SE   Q   E +  +++        
Sbjct: 380 YLVLDILGQGTFGQVVKCQNLTTKEILAVKVIKSRSEYLNQSITEAKILELINNKIDPEN 439

Query: 91  AYYFGQ------EGLHNILVIDLLGPSLEDLFDWCGRR-FSVKTVVQVAVQMITLIEDLH 143
            ++F +         H  LV +LL  +L +L         S++ +     QM+  +  L 
Sbjct: 440 KHHFLRMYDSFIHKNHLCLVFELLSNNLYELLKQNQFHGLSIQLIRIFTKQMLESLCVLK 499

Query: 144 THDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQ-------------YRDPKTKQHI 190
              LI+ D+KP+N L+    +PD+  + +IDFG + +             YR P+    I
Sbjct: 500 DSKLIHCDLKPENILL---CSPDKPALKIIDFGSSCEETRTVYTYIQSRFYRAPEIILGI 556

Query: 191 PY 192
           PY
Sbjct: 557 PY 558

>Scas_613.13*
          Length = 312

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 81/199 (40%), Gaps = 35/199 (17%)

Query: 27  IVGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTA 86
           I    Y  GKK+GEG++ V++ GT    G  +A+K E + SE          +K     +
Sbjct: 9   ITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVK-EIKTSE----------FKDGLDMS 57

Query: 87  GIPQAYYFGQEGLHNI--------------LVIDLLGPSLEDLFDWCGRRFSVKTVVQVA 132
            I +  Y  +    N+              LV++ L   LE +       F+   +    
Sbjct: 58  AIREVKYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWM 117

Query: 133 VQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPK---TKQH 189
           +  +  +   H + +++RD+KP+N L+   G      + + DFG+A+    P    T   
Sbjct: 118 LMTLRGVHHCHRNFILHRDLKPNNLLLSPDGV-----IKVADFGLARAVPSPHEMLTSNV 172

Query: 190 IP--YREKKSLSGTARYMS 206
           +   YR  + L G   Y S
Sbjct: 173 VTRWYRAPELLFGAKHYTS 191

>Scas_627.7
          Length = 349

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 54/110 (49%), Gaps = 13/110 (11%)

Query: 130 QVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQH 189
           +   Q+   +  LH   +I+RD+KP+N LIG       N + L DFG +    +P+  + 
Sbjct: 193 RFVFQIADALNYLHDKQIIHRDLKPENILIGF-----NNVIKLTDFGWS--IINPRGVK- 244

Query: 190 IPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 239
                +K+L GT  Y+S      RE   + D+ ALG + +  + G  P++
Sbjct: 245 -----RKTLCGTIDYLSPEMIRSREYDDKVDVWALGVLTYELIVGSPPFE 289

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 96/234 (41%), Gaps = 34/234 (14%)

Query: 38  IGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTAG--IPQAYYFG 95
           +G G+F  + +      G   A+K   ++     +    R  ++L       I     F 
Sbjct: 194 VGTGAFATVKKAVERNTGKTFAVKIINKRKVVGNMDGVSRELEVLQKLNHPRIVSLKAFY 253

Query: 96  QEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVV--QVAVQMITLIEDLHTHDLIYRDIK 153
           ++  +  +V++ +     DL D+     +V      +++ Q++  I+ +H+  + +RD+K
Sbjct: 254 EDEANYYMVMEFISGG--DLMDFVAAHGAVGEEAGREISRQILEAIQYIHSKGISHRDLK 311

Query: 154 PDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLG- 212
           PDN LI +    D   V + DFG+AK   +            K+  GT  Y++     G 
Sbjct: 312 PDNILIEQ---DDPVLVKITDFGLAKVQGNGSI--------MKTFCGTLAYVAPEVIGGF 360

Query: 213 -------------REQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 253
                         E S   DM ++G + F  L G LP+ G      +Q YE+I
Sbjct: 361 TGATGEEETEEERIEYSSLVDMWSMGCLVFVILTGHLPFSG---STQEQLYEQI 411

>Scas_721.46
          Length = 296

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 89/208 (42%), Gaps = 24/208 (11%)

Query: 31  HYRIGKKIGEGSFGVLFEGTNMINGVPVA----IKFEPRKSEAPQLKDEYRTYKILAGTA 86
           +Y+  +K+GEG++GV+++  +M  G  V     I+ E      P      R   +L    
Sbjct: 7   NYKRLEKVGEGTYGVVYKALDMRQGQRVVALKKIRLESEDEGVPS--TAIREISLLKELK 64

Query: 87  --GIPQAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRRFSVKT--VVQVAVQMITLIED 141
              I + Y       H + LV + L   L+   +   +  S+ +  + +   Q+   I  
Sbjct: 65  DDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESIPKDQSLGSDIIKKFMRQLCKGIAY 124

Query: 142 LHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 201
            H H +++RD+KP N LI + G      + L DFG+A+ +        +P R       T
Sbjct: 125 CHAHRILHRDLKPQNLLINKEGN-----LKLGDFGLARAF-------GVPLRAYTHEIVT 172

Query: 202 ARYMSINTHLGREQ-SRRDDMEALGHVF 228
             Y +    LG +Q S   D  ++G +F
Sbjct: 173 LWYRAPEVLLGGKQYSTGVDTWSIGCIF 200

>Scas_640.16
          Length = 505

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 61/133 (45%), Gaps = 17/133 (12%)

Query: 109 GPSLEDLFDWC---GRRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTP 165
           G SLE ++      G R S K + +++  ++  +  LH   +I+RDIKP N L    G  
Sbjct: 293 GKSLEAVYKNLLSRGGRISEKVLGKISESVLRGLSYLHEQKVIHRDIKPQNILFNEKG-- 350

Query: 166 DENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALG 225
              +V L DFG++ +  +             + +GT+ YM+     G+  S   D+ +LG
Sbjct: 351 ---QVKLCDFGVSGEAVNSLA---------TTFTGTSFYMAPERIQGQPYSVTCDIWSLG 398

Query: 226 HVFFYFLRGQLPW 238
                  +G+ P+
Sbjct: 399 LTILEVAQGRFPF 411

>Scas_689.22
          Length = 901

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/166 (21%), Positives = 80/166 (48%), Gaps = 12/166 (7%)

Query: 28  VGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIK---FEPRKSEAPQLKDEYRTYKILAG 84
           V L +++G+ IG G++G + E +++ +G   A+K   F+   +    ++ E   ++ L  
Sbjct: 434 VILDHKLGRAIGAGAWGSIRECSDIQSGTRRAMKIVRFKENLNVKKHVRREVSIWEQLKH 493

Query: 85  TAGIPQAYYFGQEGLHNILVIDLLGP-SLEDL-FDWC---GRRFSVKTVVQVAV----QM 135
              +P   Y  +E      + + +   +L DL   W      + S+    ++ +    Q+
Sbjct: 494 ENILPLLNYKFEESYAMYCLTEFINDGNLYDLAVSWSHMSNSKISLSKRCELTIFLGLQV 553

Query: 136 ITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQY 181
           ++ ++ +H+  + + D+K +N L+ +       KV L DFGM++ +
Sbjct: 554 VSALQYMHSKSICHGDVKLENCLLKKDKAVGNWKVLLCDFGMSRNF 599

>YDL159W (STE7) [712] chr4 (172482..174029)
           Serine/threonine/tyrosine protein kinase of MAP kinase
           kinase (MAPKK or MEK) family, component of pheromone
           response, filamentous growth, and STE vegetative growth
           pathways [1548 bp, 515 aa]
          Length = 515

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 58/119 (48%), Gaps = 15/119 (12%)

Query: 123 FSVKTVVQVAVQMITLIEDLH-THDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQY 181
           F+  T+ ++A  ++  ++ L+  + +I+RDIKP N LI   G     ++ L DFG++K+ 
Sbjct: 302 FNELTISKIAYGVLNGLDHLYRQYKIIHRDIKPSNVLINSKG-----QIKLCDFGVSKKL 356

Query: 182 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG 240
            +      +         GT+ YMS     G   S + D+ +LG +    + G+ P  G
Sbjct: 357 INSIADTFV---------GTSTYMSPERIQGNVYSIKGDVWSLGLMIIELVTGEFPLGG 406

>Kwal_26.8703
          Length = 444

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 53/119 (44%), Gaps = 14/119 (11%)

Query: 120 GRRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAK 179
           G R   K + ++A  ++  +  L    +I+RDIKP N L+   G     +V L DFG++ 
Sbjct: 254 GGRIGEKVLGKIAESVLKGLSYLQERKIIHRDIKPQNILLNEAG-----QVKLCDFGVSG 308

Query: 180 QYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 238
              +             + +GT+ YM+     G+  S   D+ +LG       +GQ P+
Sbjct: 309 VAVN---------SLATTFTGTSFYMAPERIQGQPYSVTSDVWSLGLTLLEVAQGQFPF 358

>Kwal_14.2497
          Length = 418

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 58/123 (47%), Gaps = 12/123 (9%)

Query: 134 QMITLIEDLHTHD-LIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPY 192
           Q+I  I+ LH    + +RDIKP+N L+   G      + L DFG+A Q++     + I  
Sbjct: 30  QLINAIDHLHNRCGVAHRDIKPENLLLDERG-----NLKLADFGLASQFKRKDGSKRIMS 84

Query: 193 REKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEK 252
             + SL   A  +  +     + +   D+ + G + F  L G+ PW    +P++  +++ 
Sbjct: 85  DTRGSLPYMAPEIVYSKSYYADST---DIWSCGVLVFVLLTGETPWD---SPSDDSRFDD 138

Query: 253 IGE 255
             E
Sbjct: 139 FLE 141

>Sklu_2323.3 YPL209C, Contig c2323 5241-6443
          Length = 400

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 52/106 (49%), Gaps = 13/106 (12%)

Query: 134 QMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYR 193
           QM   +  +H  ++++RDIKP+N LIG      +N + L DFG +               
Sbjct: 246 QMADALNYMHDRNVLHRDIKPENILIGF-----QNTLKLTDFGWSVISTTGA-------- 292

Query: 194 EKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 239
           ++K+L GT  Y+S      RE   + D+ ALG + +  L G  P++
Sbjct: 293 KRKTLCGTLDYLSPELVKYREYDEKVDVWALGVLAYELLVGTPPFE 338

>Scas_653.25
          Length = 666

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 96/229 (41%), Gaps = 40/229 (17%)

Query: 34  IGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKSEAPQLKDEYRTYK--ILAGTAGIPQ 90
           + +K+G G+ G + +  N  N    A+K F+P  +     + + R  K  IL+     P 
Sbjct: 271 VTQKLGSGANGCVVQLQNHSNDKRFAMKTFKPNPNGETTKQYQKRCIKEFILSSHLSHPN 330

Query: 91  AYYFGQEGLHNILVIDLL-GPS--LEDLFDWCGRRFSVKTVVQVAVQMITLIED------ 141
                      I  +D+   PS  + ++ +WC   F    +V     ++T  E       
Sbjct: 331 I----------IETLDIFYNPSGQISEIMEWCPHDFF--NIVMSRTHLLTRRETFCYFKQ 378

Query: 142 -------LHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIP-YR 193
                  LHT  + +RD+K DN +I   G      + LIDFG A  ++  K+ +  P   
Sbjct: 379 LCNGVRYLHTLGIAHRDLKLDNCVITYNGI-----LKLIDFGSATIFQLNKSTEEKPELI 433

Query: 194 EKKSLSGTARYMSINTHLGRE---QSRRDDMEALGHVFFYFLRGQLPWQ 239
             + + G+  Y++    L +E    +   D+ +LG +F   +  + PW+
Sbjct: 434 PSRGIVGSDPYLAPEVLLSKEIPYDASLADVWSLGIIFCAIMLKRFPWR 482

>Kwal_23.5290
          Length = 819

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 53/111 (47%), Gaps = 15/111 (13%)

Query: 128 VVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTK 187
           +V+   Q +  + D H   +I+RDIK DN L+      +  +V + DFG   +  D ++K
Sbjct: 650 IVRETCQGLKFLHDKH---IIHRDIKSDNVLLD-----NRARVKITDFGFCAKLTDKRSK 701

Query: 188 QHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 238
                  + ++ GT  +M+      RE   + D+ +LG +    L G+ P+
Sbjct: 702 -------RATMVGTPYWMAPEVVKQREYDEKVDVWSLGIMTIEMLEGEPPY 745

>Scas_713.38
          Length = 432

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 75/163 (46%), Gaps = 18/163 (11%)

Query: 38  IGEGSFGVLFEGTNMINGVPVAIK--FEPRKSEAPQLKDEYRTYKIL-----AGTAGIPQ 90
           +G G+FG++   T+ +   PVAIK   +P  S A   K  YR  K+L          +  
Sbjct: 29  VGMGAFGLVCSATDTLTSQPVAIKKIMKPF-STAVLAKRTYRELKLLKHLRHENLICLQD 87

Query: 91  AYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDLIYR 150
            +    E ++   V +L G  L  L     R    + V     Q++  ++ +H+  +I+R
Sbjct: 88  IFLSPLEDIY--FVTELQGTDLHRLLQ--TRPLEKQFVQYFLYQILRGLKYVHSVGVIHR 143

Query: 151 DIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYR 193
           D+KP N LI      +   + + DFG+A+  +DP+   ++  R
Sbjct: 144 DLKPSNILIN-----ENCDLKICDFGLAR-IQDPQMTGYVSTR 180

>KLLA0A06776g 612115..614517 some similarities with sp|P36003
           Saccharomyces cerevisiae YKL171w singleton, hypothetical
           start
          Length = 800

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 82/180 (45%), Gaps = 20/180 (11%)

Query: 22  REDSTIVGLHYRIGKKIGEGSFGVLFEG----------TNMINGVPVAIKFEPRKSEAPQ 71
           R+D     L +R+GK IG G++G++ E            N        IKF+  +S   Q
Sbjct: 400 RDDKGSFILGHRLGKIIGFGAWGMIRECFPSTDESQNQNNTCCKAMKIIKFKDNRSVKRQ 459

Query: 72  LKDEYRTYKILAGTAGIPQAYYFGQEGLHNILVIDLL--GPSLEDLFDW--CGR-RFSVK 126
           +  E   +  L+    +P   +   + L    + D +  G   + +  W  CG  + S++
Sbjct: 460 VLREISIWSKLSHNNILPLTKWKLDDDLVAYCLTDKIDHGTLYDLVVSWGECGNSKISLR 519

Query: 127 TVVQ----VAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDEN-KVHLIDFGMAKQY 181
              Q    +A+Q+I  ++ +H+  + + DIK +N L+ +     ++ K+ L DFGM+  Y
Sbjct: 520 ERCQATSALALQLIDAVQYMHSKFIAHGDIKLENCLLEKKSENYKDWKLVLCDFGMSHFY 579

>CAGL0H07535g 736241..737137 highly similar to sp|P00546
           Saccharomyces cerevisiae YBR160w CDC28, start by
           similarity
          Length = 298

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 92/208 (44%), Gaps = 22/208 (10%)

Query: 31  HYRIGKKIGEGSFGVLFEGTNMINGV---PVAIKFEPRKSEAPQL-KDEYRTYKILAGTA 86
           +Y+  +K+GEG++GV+++  ++  G     VA+K    +SE   +     R   +L    
Sbjct: 7   NYKRLEKVGEGTYGVVYKALDLRPGKGQRVVALKKIRLESEDEGVPSTAIREISLLKELK 66

Query: 87  --GIPQAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIED 141
              I + Y       H + LV++ L   L+   +   +     V  + +  VQ+   I  
Sbjct: 67  DDNIVRLYDIVHSDAHKLYLVLEFLDLDLKRYMESIPKDQPLGVNIIKKFMVQLCKGIAY 126

Query: 142 LHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 201
            H H +++RD+KP N LI + G      + L DFG+A+ +        +P R       T
Sbjct: 127 CHAHRILHRDLKPQNLLIDKEGN-----LKLGDFGLARAF-------GVPLRAYTHEIVT 174

Query: 202 ARYMSINTHLGREQ-SRRDDMEALGHVF 228
             Y +    LG +Q S   D  ++G +F
Sbjct: 175 LWYRAPEVLLGGKQYSTGVDTWSIGCIF 202

>YFL033C (RIM15) [1651] chr6 complement(69113..74425)
           Serine/threonine protein kinase, positive regulator of
           IME2 expression and of sporulation [5313 bp, 1770 aa]
          Length = 1770

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 80/178 (44%), Gaps = 17/178 (9%)

Query: 32  YRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPR-----KSEAPQLKDEYRTYKILAGTA 86
           Y I K I +G++G ++     + G   AIK   +     K++   +K E     + +   
Sbjct: 794 YDILKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMVQSDKP 853

Query: 87  GIPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTH 145
            + + +   Q   +  LV++ L G  L  L    G     +   Q   +++  + D+H +
Sbjct: 854 YVARLFASFQNKDNLFLVMEYLPGGDLATLIKMMGY-LPDQWAKQYLTEIVVGVNDMHQN 912

Query: 146 DLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQH--IPYREKKSLSGT 201
            +I+ D+KP+N LI   G      V L DFG++   R    ++H  +P++   S+S T
Sbjct: 913 GIIHHDLKPENLLIDNAG-----HVKLTDFGLS---RAGLIRRHKFVPHKSSLSISST 962

>Scas_716.33
          Length = 573

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/230 (21%), Positives = 86/230 (37%), Gaps = 58/230 (25%)

Query: 134 QMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAK-------------- 179
           +M   +  LH     +RD+KP+NFLI   G      + L DFG+A               
Sbjct: 284 EMFLAVNALHDLGYTHRDLKPENFLIDAKG-----HIKLTDFGLAAGTISNDRIQSMKVR 338

Query: 180 ----------QYRDP----KTKQHIPYREKK-----SLSGTARYMSINTHLGREQSRRDD 220
                     ++ D     + + +  YRE +     S+ G+  YM++    G++     D
Sbjct: 339 LEEVKNLEFPEFSDKSIEDRRQMYQKYRETEVNYANSMVGSPDYMALEVLEGKKYDFTVD 398

Query: 221 MEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVT--------------NVYDLA 266
             +L  + F  L G  P+ G    +  + YE +   K+                  +D  
Sbjct: 399 YWSLSCMLFESLVGYTPFSG---SSTNETYENLRHWKKTLRRPMLDNGRPAFSDRTWDFI 455

Query: 267 QGL---PVQFGRYLEVVRSLAFEETPDYEGYRKLFLSILDDMDNQADGEY 313
             L   P+   R  E V+ + + E+ D+   R L    +  +DN+ D  Y
Sbjct: 456 TRLIADPINRLRSFEHVKRMTYFESVDFNTLRDLSPPFIPQLDNETDAGY 505

>Scas_700.35
          Length = 439

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 55/119 (46%), Gaps = 14/119 (11%)

Query: 120 GRRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAK 179
           G R   K + ++A  ++  +  LH   +I+RDIKP N L+      +E +V L DFG++ 
Sbjct: 247 GGRIGEKILGKIAESVLRGLSYLHERKIIHRDIKPQNILLN-----EEGEVKLCDFGVSG 301

Query: 180 QYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 238
           +  +             + +GT+ YM+     G   S   D+ +LG       +G+ P+
Sbjct: 302 EAVNSLA---------TTFTGTSFYMAPERIQGHPYSVTCDVWSLGLTILEVAQGRFPF 351

>Scas_711.15
          Length = 727

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 14/79 (17%)

Query: 121 RRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGT-------------PDE 167
           R FS+ ++  +  Q++  I+ +H H+  +RDIKP+N L+  P               PD 
Sbjct: 163 RVFSIPSLKSILAQILAGIKHIHDHNFFHRDIKPENILVS-PNKRYFDKERLELGFYPDN 221

Query: 168 NKVHLIDFGMAKQYRDPKT 186
             V L DFG+A+   +  T
Sbjct: 222 YVVKLADFGLARHVENKNT 240

>Sklu_2385.2 YLR113W, Contig c2385 3805-5109 reverse complement
          Length = 434

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 74/163 (45%), Gaps = 18/163 (11%)

Query: 38  IGEGSFGVLFEGTNMINGVPVAIK--FEPRKSEAPQLKDEYRTYKIL-----AGTAGIPQ 90
           +G G+FG++   T+     PVAIK   +P  S A   K  YR  K+L          +  
Sbjct: 29  VGMGAFGLVCSATDTYTSQPVAIKKIMKPF-STAVLAKRTYRELKLLKHLRHENLICLED 87

Query: 91  AYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDLIYR 150
            +    E ++   V +L G  L  L     R    + V     Q++  ++ +H+  +I+R
Sbjct: 88  IFLSPLEDIY--FVTELQGTDLHRLLQ--TRPLEKQFVQYFLYQILRGLKYVHSAGVIHR 143

Query: 151 DIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYR 193
           D+KP N LI      +   + + DFG+A+  +DP+   ++  R
Sbjct: 144 DLKPSNILIN-----ENCDLKICDFGLAR-IQDPQMTGYVSTR 180

>KLLA0F20053g 1867209..1868543 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1 ser/thr protein
           kinase of MAP kinase (MAPK) family, start by similarity
          Length = 444

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 75/163 (46%), Gaps = 18/163 (11%)

Query: 38  IGEGSFGVLFEGTNMINGVPVAIK--FEPRKSEAPQLKDEYRTYKIL-----AGTAGIPQ 90
           +G G+FG++   T+ +   PVAIK   +P  S +   K  YR  K+L          +  
Sbjct: 28  VGMGAFGLVCSATDTLTSQPVAIKKIMKPF-STSVLAKRTYRELKLLKHLRHENLICLED 86

Query: 91  AYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDLIYR 150
            +    E ++   V +L G  L  L     R    + V     Q++  ++ +H+  +I+R
Sbjct: 87  IFLSPLEDIY--FVTELQGTDLHRLLQ--TRPLEKQFVQYFLYQILRGLKYVHSAGVIHR 142

Query: 151 DIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYR 193
           D+KP N LI      +   + + DFG+A+  +DP+   ++  R
Sbjct: 143 DLKPSNILIN-----ENCDLKICDFGLAR-IQDPQMTGYVSTR 179

>ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C
           (MKK2) - SH] complement(557738..559312) [1575 bp, 524
           aa]
          Length = 524

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 55/127 (43%), Gaps = 14/127 (11%)

Query: 120 GRRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAK 179
           G R   K + ++A  ++  +  LH   +I+RDIKP N L+   G     +V L DFG++ 
Sbjct: 333 GGRVGEKVLGKIAESVLRGLSYLHQRKIIHRDIKPQNILLNEAG-----QVKLCDFGVSG 387

Query: 180 QYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 239
           +  +             + +GT+ YM+     G+  S   D+ +LG       +   P+ 
Sbjct: 388 EAVNSLA---------TTFTGTSYYMAPERIQGQPYSVTSDVWSLGLTLLEVAQAHFPFD 438

Query: 240 GLKAPNN 246
             K   N
Sbjct: 439 SGKFAAN 445

>ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH]
           complement(597519..600032) [2514 bp, 837 aa]
          Length = 837

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 67/153 (43%), Gaps = 26/153 (16%)

Query: 114 DLFDWCGRRFSVKTVV--QVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVH 171
           DL D+     SV      ++  Q++  +  +H   + +RD+KPDN LI +    D   V 
Sbjct: 299 DLMDFVAAHGSVGEDAGREITRQILEAVRYIHEQGISHRDLKPDNILIEQ---DDPVLVK 355

Query: 172 LIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSI----------NTHLGREQSRRDDM 221
           + DFG+AK  +D  T         K+  GT  Y++           N   G   S   DM
Sbjct: 356 ITDFGLAK-IQDNTTFM-------KTFCGTLAYVAPEVIGGKNPEGNGANGNLYSSLVDM 407

Query: 222 EALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 254
            ++G + +  L G LP+ G      +Q Y++I 
Sbjct: 408 WSIGCLVYVILTGHLPFSG---STQEQLYKQIA 437

>CAGL0M02519g complement(290723..292993) highly similar to tr|Q03002
           Saccharomyces cerevisiae YPL141c or sp|Q01919
           Saccharomyces cerevisiae YOR233w KIN4, hypothetical
           start
          Length = 756

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 70/165 (42%), Gaps = 29/165 (17%)

Query: 121 RRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQ 180
           RR       ++  Q+I+ +  +H+  L++RD+K +N L+      +E  + + DFG   +
Sbjct: 162 RRLKENHACRLFSQLISAVHYIHSKGLVHRDLKLENLLLD-----NEENLIITDFGFVNE 216

Query: 181 YRDPKTKQHIPYREK---KSLSGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQ 235
           +           R+    K+  G+  Y +    +      +R+ D  + G + F  L G 
Sbjct: 217 F----------LRQNGMMKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGY 266

Query: 236 LPWQGLKAPNNKQKYEKIGEKKRVTNVYDLAQGLPVQFGRYLEVV 280
           LPW     P N   ++       ++ +Y+     P++F  Y+  V
Sbjct: 267 LPWDD--DPKNPDGHD-------ISRLYNYILNTPLKFPEYINPV 302

>KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces
           cerevisiae YGL180w APG1 essential for autophagocytosis,
           start by similarity
          Length = 831

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 58/265 (21%), Positives = 115/265 (43%), Gaps = 51/265 (19%)

Query: 31  HYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTAGIPQ 90
           +Y + K+IG+GSF V+++G ++ +G  +AIK   R     +LK++     +    A + +
Sbjct: 20  NYSVEKEIGKGSFAVVYKGLSLRDGRNIAIKAVSRS----KLKNKKLLENLEVEIAILKK 75

Query: 91  AYYFGQEGLHNI--------LVIDLLGPSLEDLFDWCGRRFS-------VKTV------- 128
             +    GL +         L+++     L DL  +  +R +       +KTV       
Sbjct: 76  IKHPHIVGLIDCERTSSDFYLIMEYCA--LGDLTFFIKKRKNLVLKHPLIKTVFEHYPPP 133

Query: 129 ------------VQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFG 176
                       V    Q+ + ++ L + +L++RDIKP N L+  P     +     + G
Sbjct: 134 STEHNGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLCTPLLDYNDPKTFHELG 193

Query: 177 MAKQYRDPKTK-------QHIPYRE-KKSLSGTARYMSINTHLGREQSRRDDMEALGHVF 228
               Y  P  K       + +P     ++L G+  YM+      ++ + + D+ ++G V 
Sbjct: 194 FVGIYNLPILKIADFGFARFLPNTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVL 253

Query: 229 FYFLRGQLPWQGLKAPNNKQKYEKI 253
           +    G+ P+   KA N+ + ++KI
Sbjct: 254 YEMCCGRPPF---KASNHLELFQKI 275

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 62/249 (24%), Positives = 96/249 (38%), Gaps = 49/249 (19%)

Query: 24  DSTIVGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIK---FEPRKS------EAPQLKD 74
           D++I    Y + + IG G++GV++         P AIK   FE          E   LK+
Sbjct: 2   DNSIAHGTYALKQVIGRGAYGVVYRAVKRGTNKPCAIKQIEFEDESELNEHMLEIDLLKN 61

Query: 75  EYRTYKILAGTAGIPQAY-------YFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKT 127
             R   I+     I +A+       Y  +  L +IL     GP LED             
Sbjct: 62  -LRHQNIVEYRGFIQKAHELYIILEYCARGSLRDILK---HGPLLED------------D 105

Query: 128 VVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTK 187
            V    Q +  ++ LH   +I+RDIK  N L+   G      V L DFG++ +       
Sbjct: 106 TVNYVTQTLYGLQYLHEQGVIHRDIKAANLLLTEEGI-----VKLADFGVSTRIN----- 155

Query: 188 QHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNK 247
                R   + +G+  +M+     G+  S   D+ +LG      L G  P+  L   N  
Sbjct: 156 -----RMAMTYAGSPNWMAPEVMTGQGASTVSDIWSLGATVVELLTGNPPFHNL--VNES 208

Query: 248 QKYEKIGEK 256
             Y  + E+
Sbjct: 209 ACYAIVNEE 217

>Scas_683.12
          Length = 356

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 99/225 (44%), Gaps = 35/225 (15%)

Query: 38  IGEGSFGVLFEGTNMINGVPVAIKFEPR-KSEAPQLKDEYRTYKILAGT-AGIPQAYYFG 95
           I  G+F  +++  +      VA+K  P+ K  +  + +E+   KIL  +   I     F 
Sbjct: 9   IQTGTFSTVYKAWSSQRNEYVALKIMPKSKYSSGGMANEFEIMKILGRSHPNICSMLDFY 68

Query: 96  QEGLHNILVIDLLGPSLEDLFDWC------GRRFSVKTV----VQVAVQMITLIEDLHTH 145
           Q+  + +LV++       DL+D+       G +    T+     +V  Q+ + I   H+ 
Sbjct: 69  QDTNYYVLVLEYC--EYGDLYDFLSVAKRQGDQIHPSTIQLDFAKVLRQISSAIMYSHSL 126

Query: 146 DLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQ-HI---PYREKKSLSGT 201
            + +RDIKP+N L+ + G      + L D+G A   RD  +K+ HI    YR  ++   T
Sbjct: 127 GIAHRDIKPENILLTKEG-----DIKLADWGHA--IRDSFSKESHIGTDNYRAPETFDCT 179

Query: 202 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNN 246
             Y           + + D  +LG    Y + GQ P++ L   ++
Sbjct: 180 IEY----------DTFKIDYWSLGVTSLYLIFGQAPFKNLTLSSD 214

>ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W
           (DBF20) - SH] complement(764718..766451) [1734 bp, 577
           aa]
          Length = 577

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/227 (21%), Positives = 87/227 (38%), Gaps = 52/227 (22%)

Query: 134 QMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMA--------------- 178
           +M   ++ LH     +RD+KP+NFLI   G      + L DFG+A               
Sbjct: 288 EMFCAVDALHKLGYTHRDLKPENFLIDSKG-----HIKLTDFGLASGTVSMERIESMRIR 342

Query: 179 ----KQYRDPKTKQ-HIPYREK-------------KSLSGTARYMSINTHLGREQSRRDD 220
               K    P+ K+  + YR K              S  G+  YM++     +      D
Sbjct: 343 LEEVKNLEFPEFKETSMDYRRKMYHRVREKELNYASSTVGSPDYMALEVLEAKNYDFTVD 402

Query: 221 MEALGHVFFYFLRGQLPWQGLKAP---NNKQKYEKIGEKKRVTN--------VYDLAQGL 269
             +LG + F  L G  P+ G  +     N ++++++  + R  N         ++L   L
Sbjct: 403 YWSLGCILFESLVGYTPFSGSSSNETYENLRRWKQVLRRPRCENGRPAFSDRTWELITRL 462

Query: 270 ---PVQFGRYLEVVRSLAFEETPDYEGYRKLFLSILDDMDNQADGEY 313
              P+   R  E V+ + +    D+   R +    +  +D++ D  Y
Sbjct: 463 IADPINRLRSFEHVKKMKYFAEIDFANLRSMSPPFIPQLDSETDAGY 509

>Scas_668.22
          Length = 893

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 90/207 (43%), Gaps = 22/207 (10%)

Query: 37  KIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTAGI-PQAYYFG 95
           KIG+G+ G ++    + +   VAIK   + +   Q K E    +IL       P    F 
Sbjct: 616 KIGQGASGGVYIANEIGSNESVAIK---QMNLEKQPKKELIINEILVMKGSRHPNIVNFI 672

Query: 96  QEGLHN----ILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDLIYRD 151
              L +    +++  + G SL D+   C    +   +  V  + ++ ++ LH+  +++RD
Sbjct: 673 DSYLLDGDLWVIMEYMEGGSLTDVVTHC--ILTEGQIGAVCRETLSGLQFLHSKGVLHRD 730

Query: 152 IKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHL 211
           IK DN L+   G      + L DFG   Q  +   K       + ++ GT  +M+     
Sbjct: 731 IKSDNILLSISG-----DIKLTDFGFCAQINEINLK-------RTTMVGTPYWMAPEVVS 778

Query: 212 GREQSRRDDMEALGHVFFYFLRGQLPW 238
            +E   + D+ +LG +    + G+ P+
Sbjct: 779 RKEYGPKVDIWSLGIMIIEMIEGEPPY 805

>YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine protein
           kinase required for cytokinesis [2529 bp, 842 aa]
          Length = 842

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 52/111 (46%), Gaps = 15/111 (13%)

Query: 128 VVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTK 187
           +V+   Q +  + D H   +I+RDIK DN L+         +V + DFG   +  D ++K
Sbjct: 673 IVRETCQGLKFLHDKH---IIHRDIKSDNVLLD-----TRARVKITDFGFCARLTDKRSK 724

Query: 188 QHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 238
                  + ++ GT  +M+      RE   + D+ +LG +    L G+ P+
Sbjct: 725 -------RATMVGTPYWMAPEVVKQREYDEKIDVWSLGIMTIEMLEGEPPY 768

>Scas_544.6
          Length = 489

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 43/93 (46%), Gaps = 14/93 (15%)

Query: 145 HDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 204
           + +I+RDIKP N LI   G      V L DFG++K+  +      +         GT+ Y
Sbjct: 293 YKIIHRDIKPSNVLINSKGL-----VKLCDFGVSKKLINSIADTFV---------GTSTY 338

Query: 205 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLP 237
           MS     G   S + D+ +LG +    + GQ P
Sbjct: 339 MSPERIQGNVYSTKGDVWSLGLMIIELVTGQFP 371

>CAGL0M03729g complement(420316..422901) similar to sp|P48562
           Saccharomyces cerevisiae YNL298w CLA4, start by
           similarity
          Length = 861

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 47/97 (48%), Gaps = 12/97 (12%)

Query: 142 LHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 201
           LH  ++I+RDIK DN L+         +V + DFG   +  D ++K       + ++ GT
Sbjct: 703 LHDKNIIHRDIKSDNVLLDTKA-----RVKITDFGFCAKLTDQRSK-------RATMVGT 750

Query: 202 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 238
             +M+      +E   + D+ +LG +    L G+ P+
Sbjct: 751 PYWMAPEVVKQKEYDAKVDVWSLGIMAIEMLEGEPPY 787

>CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces
           cerevisiae YNL020c ARK1 or sp|P40494 Saccharomyces
           cerevisiae YIL095w PRK1, start by similarity
          Length = 622

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 65/138 (47%), Gaps = 26/138 (18%)

Query: 115 LFDWCGR-------------RFSVKTVVQVAVQMITLIEDLHTHD--LIYRDIKPDNFLI 159
           + ++C R             R +   ++ + + +   +  +HT    LI+RDIK +N LI
Sbjct: 108 IMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLI 167

Query: 160 GRPGTPDENKVHLIDFGMAKQY-RDPKTKQHIPY-REKKSLSGTARYMS---INTHLGRE 214
                 +++K  L DFG    Y R PKT + + Y R    +S TA+Y +   ++   G  
Sbjct: 168 S-----NDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFS 222

Query: 215 QSRRDDMEALGHVFFYFL 232
            + + D+ ALG VF Y L
Sbjct: 223 VNDKSDIWALG-VFLYKL 239

>CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces
           cerevisiae YNL183c NPR1 ser/thr protein kinase,
           hypothetical start
          Length = 728

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 62/138 (44%), Gaps = 10/138 (7%)

Query: 114 DLFDWC-GRRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHL 172
           DLF      + S + +     Q++  ++ LH+  L +RD+K DN +I   G      V L
Sbjct: 459 DLFAIVMSNKMSYEEICCCFKQILCGVQYLHSIGLAHRDLKLDNCVINSKGI-----VKL 513

Query: 173 IDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYF 231
           IDFG A  +  P +K  +   E   + G+  Y++    +  +   R  D+ +   +F   
Sbjct: 514 IDFGAAVVFSYPFSKTLV---EASGIVGSDPYLAPEVCIFTKYDPRPVDIWSTAIIFACM 570

Query: 232 LRGQLPWQGLKAPNNKQK 249
           +  + PW+  K  +N  K
Sbjct: 571 ILKKFPWKIPKLRDNSFK 588

>ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH]
           (146098..147402) [1305 bp, 434 aa]
          Length = 434

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/230 (20%), Positives = 96/230 (41%), Gaps = 53/230 (23%)

Query: 31  HYRIGKKIGEGSFGVLFEGTNMING---VPVAIK-FEPRKSEAPQLKDEYRTYKILAGTA 86
           HY + + +G+GS+G +    + +N    + +AIK           LK   R  K +    
Sbjct: 72  HYEVLQMLGKGSYGTVVSAIDNLNANYPIRIAIKKITNIFQREVLLKRAIRELKFMH--- 128

Query: 87  GIPQAYYFGQEGLHNILVIDLLGP-------SLEDLFDW-------CGRRFSVKTVVQVA 132
                Y+ G + + +++ ++++           ++L D+          +FS   +    
Sbjct: 129 -----YFKGHKNIVSLINLEIVNEKPYDGLYCYQELIDYDLARVIHSNVQFSEFHIKHFT 183

Query: 133 VQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAK----QYRDPKTKQ 188
            Q++  ++ +H+ D+I+RD+KP N L    G     ++ + DFG+A+     + + KT  
Sbjct: 184 YQILCGVKYIHSADVIHRDLKPGNILCSISG-----QLKICDFGLARGISPLFTNTKTSN 238

Query: 189 HIP-------YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYF 231
           HI        YR  + +    RY           ++  DM A+G +   F
Sbjct: 239 HITNYVATRWYRAPELILSHKRY-----------NKSIDMWAIGCILAEF 277

>Scas_477.5
          Length = 703

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 71/149 (47%), Gaps = 14/149 (9%)

Query: 93  YFG--QEGLH-NILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDLIY 149
           Y+G  QEG + NI +  + G S+  + +  G  F    +V    Q++  +  LH  ++I+
Sbjct: 506 YYGSSQEGPNLNIFLEYVPGGSVSSMLNNYGP-FEESLIVNFIRQVLIGVAYLHNKNIIH 564

Query: 150 RDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINT 209
           RDIK  N LI   G      V + DFG++K+   P +KQ     ++ SL G+  +M+   
Sbjct: 565 RDIKGANILIDTKGC-----VKITDFGISKKL-SPLSKQD----KRASLQGSVYWMAPEV 614

Query: 210 HLGREQSRRDDMEALGHVFFYFLRGQLPW 238
                 + + D+ + G V      G+ P+
Sbjct: 615 VKQTATTEKADIWSTGCVVIEMFTGKHPF 643

>Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement
          Length = 466

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 52/108 (48%), Gaps = 11/108 (10%)

Query: 134 QMITLIEDLH-THDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPY 192
           Q++  I  LH    + +RDIKP+N L+ + G      + L DFG+A Q+R     + +  
Sbjct: 68  QLLRAIHHLHEVCGIAHRDIKPENILLDKNGN-----LKLADFGLASQFRRKDGTKRLAR 122

Query: 193 REKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQ 239
            ++    G+  YM+       E  +   D+ + G + F  L G+ PW+
Sbjct: 123 DQR----GSPPYMAPEIIYSSEYYADTTDIWSCGILVFVLLTGETPWE 166

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 58/130 (44%), Gaps = 14/130 (10%)

Query: 109 GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGTPDEN 168
           G SL D+   C    S   +  V  + +  ++ LH+  +++RDIK DN L+   G     
Sbjct: 699 GGSLTDVVTHC--LLSEGQIGAVCRETLKGLQFLHSKGVLHRDIKSDNILLSLKG----- 751

Query: 169 KVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVF 228
            + L DFG   Q  +   K       + ++ GT  +M+      +E   + D+ +LG + 
Sbjct: 752 NIKLTDFGFCAQINENNLK-------RTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMI 804

Query: 229 FYFLRGQLPW 238
              + G+ P+
Sbjct: 805 IEMIEGEPPY 814

>ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH]
           (692321..693913) [1593 bp, 530 aa]
          Length = 530

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 44/96 (45%), Gaps = 14/96 (14%)

Query: 145 HDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 204
           + +I+RDIKP N LI   G      V + DFG++K+  D      +         GT+ Y
Sbjct: 330 YKIIHRDIKPSNILINSKGF-----VKICDFGVSKKMIDSIADTFV---------GTSTY 375

Query: 205 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG 240
           MS     G   + + D+ +LG +    + G+ P  G
Sbjct: 376 MSPERIQGSCYNTKGDVWSLGLMIIELVTGEFPLGG 411

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.137    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,482,537
Number of extensions: 632134
Number of successful extensions: 2314
Number of sequences better than 10.0: 593
Number of HSP's gapped: 2086
Number of HSP's successfully gapped: 600
Length of query: 493
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 387
Effective length of database: 12,926,601
Effective search space: 5002594587
Effective search space used: 5002594587
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)