Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_27.968884183044160.0
Sklu_2397.884884725970.0
KLLA0D10197g85688123500.0
Scas_626.683987121250.0
AAL175W88387620720.0
YML099C (ARG81)88089219090.0
CAGL0H06875g7025628067e-96
KLLA0F10373g348631488e-10
Scas_597.4475861363e-08
AFL033W382561346e-08
Kwal_14.1631443441311e-07
YBR240C (THI2)450421292e-07
CAGL0F07865g844861204e-06
YDR213W (UPC2)913551204e-06
KLLA0F20680g787521204e-06
CAGL0C01199g922471195e-06
KLLA0F04213g768451161e-05
Kwal_56.23058775451161e-05
YLR228C (ECM22)814471151e-05
Scas_663.12944601152e-05
Sklu_2434.10983591152e-05
AGL091W866471142e-05
Sklu_1373.2608381114e-05
Scas_717.33904511124e-05
YLR256W (HAP1)1502551115e-05
Kwal_23.3122788471115e-05
YDR421W (ARO80)950551106e-05
Scas_679.26775471106e-05
KLLA0A10329g639481106e-05
KLLA0F22990g1253521099e-05
KLLA0C17050g955691081e-04
ADR404C875481071e-04
AGL099C747391071e-04
ADR405C807571062e-04
Scas_674.12*909391062e-04
YDR034C (LYS14)790441052e-04
YDR207C (UME6)836341052e-04
AFR117C1152551052e-04
Sklu_2064.2922511053e-04
Sklu_1622.2778401053e-04
Kwal_26.6805944471053e-04
Scas_596.4701391043e-04
ADR403C970411043e-04
Kwal_26.7095838741043e-04
CAGL0K11902g831431043e-04
Kwal_23.3178611331033e-04
KLLA0F09559g658991033e-04
CAGL0M12298g994411044e-04
Scas_573.41478461034e-04
Kwal_26.6732676331025e-04
KLLA0D00484g1004471025e-04
CAGL0F05357g601341025e-04
KLLA0A04169g775451025e-04
KLLA0F00572g597371025e-04
AGR061C612481026e-04
YAL051W (OAF1)1062491026e-04
Kwal_56.24566755361017e-04
CAGL0B03421g1355501017e-04
CAGL0K05841g1372381018e-04
ADR199C944531018e-04
CAGL0J07150g1022611018e-04
Kwal_23.6529598381000.001
CAGL0L04400g987491000.001
Sklu_2296.6919401000.001
Kwal_55.2072282744990.001
KLLA0A03443g97562990.001
KLLA0F14322g71740980.001
CAGL0F03025g92877990.001
Scas_556.6102263990.001
ABL099W80039980.001
Kwal_14.2619116773980.002
YMR280C (CAT8)143337980.002
Kwal_55.2067425245950.002
KLLA0A06039g65728970.002
KLLA0D11286g67849970.002
Scas_721.9486947970.002
YOR363C (PIP2)99639970.002
Scas_661.2374147960.002
KLLA0A03421g88061960.003
KLLA0D05038g67345950.003
CAGL0D03850g83433950.003
Scas_588.1183556950.004
YLR266C (PDR8)70145950.004
KLLA0F22880g116439950.004
YLR014C (PPR1)90437940.004
KLLA0F19602g60345940.004
KLLA0A01804g94577940.004
Kwal_47.1723394889940.005
Scas_625.5114150940.005
CAGL0D02904g88755940.005
KLLA0D01452g144529940.005
AGL233C87246940.005
Sklu_2191.271845930.006
ABL121C128529930.006
Scas_699.793540930.006
Scas_696.44116433930.006
KLLA0F18084g86029930.007
KLLA0E19701g68142920.007
CAGL0E05434g81644920.007
Kwal_56.2467064343920.007
KLLA0C16489g72830920.008
YHR056C (RSC30)88333920.008
Kwal_23.642573537920.008
Scas_521.289037920.009
YOR172W (YRM1)78642920.009
Scas_720.5889040920.009
YBL066C (SEF1)105736920.010
Kwal_27.10232120929920.010
KLLA0D12650g65150910.010
ACL058W81739910.010
CAGL0A00451g110768910.010
YJL089W (SIP4)82952910.011
AFR171W61241910.011
AGL206C73539910.012
Kwal_34.1575162828900.012
AFR096W85233910.012
KLLA0F02387g72737900.014
YLL054C76953900.014
Scas_590.2117230900.014
KLLA0D10153g65537900.015
YDR303C (RSC3)88555900.016
YLR278C134129900.017
Kwal_47.1768185451890.018
KLLA0F10835g75640890.020
Scas_550.5*83241890.020
Kwal_26.810997064890.021
Scas_711.3193234880.023
KLLA0E20405g113847880.023
YPL248C (GAL4)88143880.026
Kwal_23.290588137880.026
Sklu_1973.177740870.028
CAGL0H00396g94051880.028
YKL038W (RGT1)117055870.032
Sklu_2301.151737870.033
AAL057C80933870.033
Scas_659.1075729870.035
KLLA0C04620g126938870.037
AGR369W105136870.037
CAGL0I07755g105342870.037
KLLA0D09977g63455860.038
AGL083W85675860.040
ACR028C60150860.042
KLLA0E18194g86541850.050
Scas_715.3111547850.052
KLLA0E14036g67840850.052
Scas_688.1776938850.053
Scas_542.890244850.055
KLLA0F13904g57940840.065
Scas_630.1470150840.067
YOR337W (TEA1)75937840.067
YCR106W (RDS1)83237840.078
KLLA0A09119g108248840.084
YKL015W (PUT3)97941840.084
CAGL0H01507g79433830.085
Sklu_2321.390637830.085
Sklu_2411.1168755830.094
YOR162C (YRR1)81047830.10
KLLA0C14212g104037830.11
CAGL0M03025g125429830.11
CAGL0A04455g109836830.11
AER183C87942820.11
Sklu_2376.692229820.12
Scas_709.5175939820.12
KLLA0F25630g100760820.12
CAGL0L01903g128750820.12
Scas_526.3110929820.13
Scas_662.890648820.14
CAGL0G09757g142329820.14
ADR365W70137810.15
CAGL0F02519g83255810.16
YMR019W (STB4)94941810.16
Kwal_26.666457947810.16
CAGL0L03377g120933810.17
YGL013C (PDR1)106847810.17
YNR063W60734800.19
CAGL0G08844g84739800.19
ACR241C79562800.22
YIL130W96439800.22
KLLA0C10923g77558800.22
Kwal_27.12467414112790.23
AFL160C64846800.24
KLLA0C19228g59129790.24
YPR196W47029790.25
Kwal_23.653755241790.26
Scas_518.591998790.26
Kwal_27.10852104636790.28
Kwal_14.163645640780.29
YBL005W (PDR3)97641790.30
YDL170W (UGA3)52829780.31
Kwal_14.81956832780.32
YHR178W (STB5)74341780.34
AER370W80144780.34
KLLA0E02618g110953780.35
Scas_657.385623780.36
Scas_709.4237485770.38
AGR280C110628780.39
Scas_702.7d97842780.41
Scas_449.163629770.45
Scas_669.863735770.46
KLLA0F04609g91636770.51
Kwal_26.744871459760.56
Kwal_47.1693966933760.70
CAGL0L04576g86521760.71
Kwal_23.351457930750.75
YBR297W (MAL33)46829750.77
Sklu_2268.287535750.80
Kwal_14.931106145750.82
Scas_638.14104347750.88
YJL103C61828740.96
Scas_691.3290653741.0
AGL361C69629741.1
Kwal_47.1808974534741.1
YGR288W (MAL13)47377731.2
Sklu_2384.683136741.2
KLLA0D12672g86529741.2
Sklu_1993.282336741.2
Kwal_23.475481236741.3
KLLA0D15356g62447731.3
Scas_234.133725731.3
YJL206C75842731.3
AFR081C48227731.5
CAGL0F09229g83541731.6
Kwal_47.1750692436721.8
KLLA0C03201g65042721.8
YKL222C70528722.1
YOR380W (RDR1)54640712.2
Sklu_2023.365829712.2
Scas_610.980942712.3
YDR520C77253712.6
Kwal_23.437069245712.7
YBR033W91952703.1
KLLA0D00396g36137693.1
Scas_680.2573829703.5
ACL195C10937653.7
Kwal_33.1393479725703.8
Sklu_2335.694050694.6
Scas_637.799852694.7
YAL014C (SYN8)255118666.1
AER291C66343677.1
CAGL0M04543g28099658.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.9688
         (830 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.9688                                                         1705   0.0  
Sklu_2397.8 YML099C, Contig c2397 9784-12330                         1004   0.0  
KLLA0D10197g complement(861726..864296) similar to sp|P05085 Sac...   909   0.0  
Scas_626.6                                                            823   0.0  
AAL175W [12] [Homologous to ScYML099C (ARG81) - NSH] complement(...   802   0.0  
YML099C (ARG81) [3872] chr13 complement(74398..77040) Component ...   739   0.0  
CAGL0H06875g complement(682518..684626) some similarities with s...   315   7e-96
KLLA0F10373g 957948..958994 some similarities with sp|P38141 Sac...    62   8e-10
Scas_597.4                                                             57   3e-08
AFL033W [3160] [Homologous to ScYBR240C (THI2) - SH] complement(...    56   6e-08
Kwal_14.1631                                                           55   1e-07
YBR240C (THI2) [419] chr2 complement(700447..701799) Zinc-finger...    54   2e-07
CAGL0F07865g complement(768270..770804) similar to tr|Q12151 Sac...    51   4e-06
YDR213W (UPC2) [1051] chr4 (889744..892485) Sterol regulatory el...    51   4e-06
KLLA0F20680g 1924148..1926511 weakly similar to sp|P39001 Saccha...    51   4e-06
CAGL0C01199g complement(121944..124712) similar to tr|Q12151 Sac...    50   5e-06
KLLA0F04213g 400673..402979 similar to sp|P40971 Saccharomyces c...    49   1e-05
Kwal_56.23058                                                          49   1e-05
YLR228C (ECM22) [3628] chr12 complement(600021..602465) Sterol r...    49   1e-05
Scas_663.12                                                            49   2e-05
Sklu_2434.10 YAL051W, Contig c2434 22765-25716                         49   2e-05
AGL091W [4220] [Homologous to ScYLR228C (ECM22) - SH; ScYDR213W ...    49   2e-05
Sklu_1373.2 YDR207C, Contig c1373 1069-2895                            47   4e-05
Scas_717.33                                                            48   4e-05
YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription facto...    47   5e-05
Kwal_23.3122                                                           47   5e-05
YDR421W (ARO80) [1245] chr4 (1312028..1314880) Positive transcri...    47   6e-05
Scas_679.26                                                            47   6e-05
KLLA0A10329g 903873..905792 some similarities with ca|CA6113|IPF...    47   6e-05
KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces...    47   9e-05
KLLA0C17050g 1490472..1493339 some similarities with ca|CA3454|I...    46   1e-04
ADR404C [2144] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    46   1e-04
AGL099C [4213] [Homologous to ScYDR207C (UME6) - SH] (516587..51...    46   1e-04
ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    45   2e-04
Scas_674.12*                                                           45   2e-04
YDR034C (LYS14) [885] chr4 complement(509732..512104) Transcript...    45   2e-04
YDR207C (UME6) [1046] chr4 complement(865005..867515) Global tra...    45   2e-04
AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH] (646832..65...    45   2e-04
Sklu_2064.2 , Contig c2064 873-3641                                    45   3e-04
Sklu_1622.2 YDR034C, Contig c1622 1522-3858                            45   3e-04
Kwal_26.6805                                                           45   3e-04
Scas_596.4                                                             45   3e-04
ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    45   3e-04
Kwal_26.7095                                                           45   3e-04
CAGL0K11902g complement(1148381..1150876) similar to sp|P40971 S...    45   3e-04
Kwal_23.3178                                                           44   3e-04
KLLA0F09559g complement(876719..878695) some similarities with s...    44   3e-04
CAGL0M12298g complement(1225753..1228737) similar to sp|P39720 S...    45   4e-04
Scas_573.4                                                             44   4e-04
Kwal_26.6732                                                           44   5e-04
KLLA0D00484g 44879..47893 no similarity, hypothetical start            44   5e-04
CAGL0F05357g 541830..543635 some similarities with sp|P39001 Sac...    44   5e-04
KLLA0A04169g complement(376273..378600) similar to sgd|S0004218 ...    44   5e-04
KLLA0F00572g complement(42710..44503) some similarities with ca|...    44   5e-04
AGR061C [4371] [Homologous to ScYLR098C (CHA4) - SH] (831058..83...    44   6e-04
YAL051W (OAF1) [17] chr1 (48565..51753) Transcription factor req...    44   6e-04
Kwal_56.24566                                                          44   7e-04
CAGL0B03421g complement(336071..340138) similar to sp|P12351 Sac...    44   7e-04
CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces c...    44   8e-04
ADR199C [1940] [Homologous to ScYDR421W (ARO80) - SH] (1048530.....    44   8e-04
CAGL0J07150g complement(686734..689802) similar to sp|P39720 Sac...    44   8e-04
Kwal_23.6529                                                           43   0.001
CAGL0L04400g complement(511762..514725) similar to tr|Q12340 Sac...    43   0.001
Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement       43   0.001
Kwal_55.20722                                                          43   0.001
KLLA0A03443g 311628..314555 weakly similar to sp|P39720 Saccharo...    43   0.001
KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1 Kluyver...    42   0.001
CAGL0F03025g 295783..298569 similar to sp|Q04052 Saccharomyces c...    43   0.001
Scas_556.6                                                             43   0.001
ABL099W [493] [Homologous to ScYDR034C (LYS14) - SH] complement(...    42   0.001
Kwal_14.2619                                                           42   0.002
YMR280C (CAT8) [4234] chr13 complement(827027..831328) Transcrip...    42   0.002
Kwal_55.20674                                                          41   0.002
KLLA0A06039g 557368..559341 weakly similar to sp|P36023 Saccharo...    42   0.002
KLLA0D11286g complement(964642..966678) no similarity, hypotheti...    42   0.002
Scas_721.94                                                            42   0.002
YOR363C (PIP2) [5140] chr15 complement(1020218..1023208) Transcr...    42   0.002
Scas_661.23                                                            42   0.002
KLLA0A03421g 308414..311056 weakly similar to sp|P39720 Saccharo...    42   0.003
KLLA0D05038g 433653..435674 weakly similar to sp|P40971 Saccharo...    41   0.003
CAGL0D03850g 384689..387193 weakly similar to sp|Q06639 Saccharo...    41   0.003
Scas_588.11                                                            41   0.004
YLR266C (PDR8) [3660] chr12 complement(675621..677726) Zn[2]-Cys...    41   0.004
KLLA0F22880g 2123577..2127071 some similarities with ca|CA3639|I...    41   0.004
YLR014C (PPR1) [3432] chr12 complement(172267..174981) Transcrip...    41   0.004
KLLA0F19602g complement(1814949..1816760) similar to sp|P43634 S...    41   0.004
KLLA0A01804g complement(159689..162526) similar to sgd|S0002829 ...    41   0.004
Kwal_47.17233                                                          41   0.005
Scas_625.5                                                             41   0.005
CAGL0D02904g complement(302952..305615) similar to sp|P07272 Sac...    41   0.005
KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyc...    41   0.005
AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH] ...    41   0.005
Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement         40   0.006
ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH] (170784..174...    40   0.006
Scas_699.7                                                             40   0.006
Scas_696.44                                                            40   0.006
KLLA0F18084g complement(1652031..1654613) no similarity, hypothe...    40   0.007
KLLA0E19701g complement(1739869..1741914) some similarities with...    40   0.007
CAGL0E05434g 532577..535027 similar to sp|P47988 Saccharomyces c...    40   0.007
Kwal_56.24670                                                          40   0.007
KLLA0C16489g 1444456..1446642 some similarities with ca|CA2184|I...    40   0.008
YHR056C (RSC30) [2344] chr8 complement(215184..217835) Component...    40   0.008
Kwal_23.6425                                                           40   0.008
Scas_521.2                                                             40   0.009
YOR172W (YRM1) [4969] chr15 (654210..656570) Protein with simila...    40   0.009
Scas_720.58                                                            40   0.009
YBL066C (SEF1) [131] chr2 complement(96906..100079) Protein with...    40   0.010
Kwal_27.10232                                                          40   0.010
KLLA0D12650g complement(1073580..1075535) weakly similar to ca|C...    40   0.010
ACL058W [991] [Homologous to NOHBY] complement(261723..264176) [...    40   0.010
CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces cer...    40   0.010
YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional act...    40   0.011
AFR171W [3363] [Homologous to NOHBY] complement(752592..754430) ...    40   0.011
AGL206C [4106] [Homologous to NOHBY] (311846..314053) [2208 bp, ...    40   0.012
Kwal_34.15751                                                          39   0.012
AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH] complement(...    40   0.012
KLLA0F02387g complement(213669..215852) similar to sp|P47988 Sac...    39   0.014
YLL054C (YLL054C) [3369] chr12 complement(32894..35203) Protein ...    39   0.014
Scas_590.2                                                             39   0.014
KLLA0D10153g 858016..859983 weakly similar to sp|P35995 Saccharo...    39   0.015
YDR303C (RSC3) [1131] chr4 complement(1068721..1071378) Componen...    39   0.016
YLR278C (YLR278C) [3671] chr12 complement(700001..704026) Protei...    39   0.017
Kwal_47.17681                                                          39   0.018
KLLA0F10835g 997512..999782 no similarity, hypothetical start          39   0.020
Scas_550.5*                                                            39   0.020
Kwal_26.8109                                                           39   0.021
Scas_711.31                                                            39   0.023
KLLA0E20405g <1805948..1809364 gi|3024604|sp|P87164|SEF1_KLULA K...    39   0.023
YPL248C (GAL4) [5202] chr16 complement(79711..82356) Transcripti...    39   0.026
Kwal_23.2905                                                           39   0.026
Sklu_1973.1 YDR303C, Contig c1973 815-3148 reverse complement          38   0.028
CAGL0H00396g complement(37005..39827) similar to sp|P08638 Sacch...    39   0.028
YKL038W (RGT1) [3220] chr11 (365248..368760) Protein involved in...    38   0.032
Sklu_2301.1 , Contig c2301 1246-2795 reverse complement                38   0.033
AAL057C [130] [Homologous to ScYDR303C (RSC3) - SH; ScYHR056C (R...    38   0.033
Scas_659.10                                                            38   0.035
KLLA0C04620g complement(422705..426514) weakly similar to sp|Q05...    38   0.037
AGR369W [4680] [Homologous to ScYBL066C (SEF1) - SH] complement(...    38   0.037
CAGL0I07755g complement(745315..748476) similar to tr|Q12180 Sac...    38   0.037
KLLA0D09977g complement(841852..843756) weakly similar to sp|P40...    38   0.038
AGL083W [4228] [Homologous to ScYKL038W (RGT1) - SH; ScYBR033W (...    38   0.040
ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp, ...    38   0.042
KLLA0E18194g 1613115..1615712 similar to sp|P25502 Saccharomyces...    37   0.050
Scas_715.3                                                             37   0.052
KLLA0E14036g complement(1239566..1241602) some similarities with...    37   0.052
Scas_688.17                                                            37   0.053
Scas_542.8                                                             37   0.055
KLLA0F13904g complement(1287758..1289497) some similarities with...    37   0.065
Scas_630.14                                                            37   0.067
YOR337W (TEA1) [5116] chr15 (954339..956618) Ty1 enhancer activa...    37   0.067
YCR106W (RDS1) [627] chr3 (310954..313452) Protein with similari...    37   0.078
KLLA0A09119g complement(797533..800781) weakly similar to sp|P12...    37   0.084
YKL015W (PUT3) [3241] chr11 (408187..411126) Transcription facto...    37   0.084
CAGL0H01507g complement(147689..150073) similar to sp|Q06639 Sac...    37   0.085
Sklu_2321.3 YLR014C, Contig c2321 8747-11467                           37   0.085
Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement      37   0.094
YOR162C (YRR1) [4961] chr15 complement(639560..641992) Transcrip...    37   0.10 
KLLA0C14212g complement(1229219..1232341) some similarities with...    37   0.11 
CAGL0M03025g complement(341849..345613) similar to sp|P39113 Sac...    37   0.11 
CAGL0A04455g 432854..436150 similar to sp|P34228 Saccharomyces c...    37   0.11 
AER183C [2685] [Homologous to ScYOL089C (HAL9) - NSH] (975879..9...    36   0.11 
Sklu_2376.6 , Contig c2376 12573-15341 reverse complement              36   0.12 
Scas_709.51                                                            36   0.12 
KLLA0F25630g 2378464..2381487 some similarities with sp|P32862 S...    36   0.12 
CAGL0L01903g 218703..222566 similar to sp|P32862 Saccharomyces c...    36   0.12 
Scas_526.3                                                             36   0.13 
Scas_662.8                                                             36   0.14 
CAGL0G09757g 930351..934622 some similarities with sp|Q05854 Sac...    36   0.14 
ADR365W [2106] [Homologous to ScYOR337W (TEA1) - SH] complement(...    36   0.15 
CAGL0F02519g 245120..247618 weakly similar to sp|P39529 Saccharo...    36   0.16 
YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding prote...    36   0.16 
Kwal_26.6664                                                           36   0.16 
CAGL0L03377g complement(382932..386561) some similarities with s...    36   0.17 
YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finge...    36   0.17 
YNR063W (YNR063W) [4646] chr14 (746940..748763) Protein with sim...    35   0.19 
CAGL0G08844g complement(846590..849133) similar to sp|P40467 Sac...    35   0.19 
ACR241C [1288] [Homologous to ScYKR064W - SH] (784358..786745) [...    35   0.22 
YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that cont...    35   0.22 
KLLA0C10923g complement(939148..941475) similar to sp|P07272 Sac...    35   0.22 
Kwal_27.12467                                                          35   0.23 
AFL160C [3035] [Homologous to ScYPL248C (GAL4) - SH] (130842..13...    35   0.24 
KLLA0C19228g 1713787..1715562 similar to sp|P53749 Saccharomyces...    35   0.24 
YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive regulat...    35   0.25 
Kwal_23.6537                                                           35   0.26 
Scas_518.5                                                             35   0.26 
Kwal_27.10852                                                          35   0.28 
Kwal_14.1636                                                           35   0.29 
YBL005W (PDR3) [189] chr2 (217435..220365) Zinc-finger transcrip...    35   0.30 
YDL170W (UGA3) [701] chr4 (156319..157905) Transcriptional activ...    35   0.31 
Kwal_14.819                                                            35   0.32 
YHR178W (STB5) [2464] chr8 (459297..461528) Probable transcripti...    35   0.34 
AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH] complement(...    35   0.34 
KLLA0E02618g 244696..248025 no similarity, hypothetical start          35   0.35 
Scas_657.3                                                             35   0.36 
Scas_709.42                                                            34   0.38 
AGR280C [4591] [Homologous to ScYLR278C - SH] (1266918..1270238)...    35   0.39 
Scas_702.7d                                                            35   0.41 
Scas_449.1                                                             34   0.45 
Scas_669.8                                                             34   0.46 
KLLA0F04609g complement(451579..454329) similar to sp|P40467 Sac...    34   0.51 
Kwal_26.7448                                                           34   0.56 
Kwal_47.16939                                                          34   0.70 
CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces c...    34   0.71 
Kwal_23.3514                                                           33   0.75 
YBR297W (MAL33) [474] chr2 (800479..801885) Maltose fermentation...    33   0.77 
Sklu_2268.2 YKR064W, Contig c2268 4260-6887 reverse complement         33   0.80 
Kwal_14.931                                                            33   0.82 
Scas_638.14                                                            33   0.88 
YJL103C (YJL103C) [2812] chr10 complement(228942..230798) Protei...    33   0.96 
Scas_691.32                                                            33   1.0  
AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 69...    33   1.1  
Kwal_47.18089                                                          33   1.1  
YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway r...    33   1.2  
Sklu_2384.6 YKL015W, Contig c2384 10929-13424                          33   1.2  
KLLA0D12672g complement(1076011..1078608) gi|125903|sp|P08657|LA...    33   1.2  
Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement         33   1.2  
Kwal_23.4754                                                           33   1.3  
KLLA0D15356g 1301848..1303722 no similarity, hypothetical start        33   1.3  
Scas_234.1                                                             33   1.3  
YJL206C (YJL206C) [2722] chr10 complement(47659..49935) Protein ...    33   1.3  
AFR081C [3273] [Homologous to ScYJL103C - SH] (574366..575814) [...    33   1.5  
CAGL0F09229g complement(908186..910693) weakly similar to sp|P39...    33   1.6  
Kwal_47.17506                                                          32   1.8  
KLLA0C03201g complement(286973..288925) similar to sp|P39529 Sac...    32   1.8  
YKL222C (YKL222C) [3053] chr11 complement(3504..5621) Protein wi...    32   2.1  
YOR380W (RDR1) [5153] chr15 (1051286..1052926) Protein with simi...    32   2.2  
Sklu_2023.3 YHR178W, Contig c2023 2677-4653 reverse complement         32   2.2  
Scas_610.9                                                             32   2.3  
YDR520C (YDR520C) [1333] chr4 complement(1481073..1483391) Prote...    32   2.6  
Kwal_23.4370                                                           32   2.7  
YBR033W (YBR033W) [224] chr2 (301906..304665) Protein with simil...    32   3.1  
KLLA0D00396g complement(36277..37362) some similarities with ca|...    31   3.1  
Scas_680.25                                                            32   3.5  
ACL195C [854] [Homologous to NOHBY] (19204..19533) [330 bp, 109 aa]    30   3.7  
Kwal_33.13934                                                          32   3.8  
Sklu_2335.6 YBL005W, Contig c2335 10191-13013                          31   4.6  
Scas_637.7                                                             31   4.7  
YAL014C (SYN8) [54] chr1 complement(128255..129022) Protein of u...    30   6.1  
AER291C [2793] [Homologous to ScYHR178W (STB5) - SH] (1172383..1...    30   7.1  
CAGL0M04543g 498691..499533 weakly similar to sp|P25623 Saccharo...    30   8.7  

>Kwal_27.9688
          Length = 841

 Score = 1705 bits (4416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 816/830 (98%), Positives = 816/830 (98%)

Query: 1   MKPRKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWS 60
           MKPRKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWS
Sbjct: 1   MKPRKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWS 60

Query: 61  PSIKFNKFGQVDSNGSPANGTEEPQSQRRNVGFVTXXXXXXXXXXXXXXLSALHSPSQDK 120
           PSIKFNKFGQVDSNGSPANGTEEPQSQRRNVGFVT              LSALHSPSQDK
Sbjct: 61  PSIKFNKFGQVDSNGSPANGTEEPQSQRRNVGFVTYKDEYEFYEDMDEELSALHSPSQDK 120

Query: 121 ISDNKTWIIKKFGVFRGTENVKTKYTPRRKRRQAGRVSEDQIKKPPTTEIKRPHINADSE 180
           ISDNKTWIIKKFGVFRGTENVKTKYTPRRKRRQAGRVSEDQIKKPPTTEIKRPHINADSE
Sbjct: 121 ISDNKTWIIKKFGVFRGTENVKTKYTPRRKRRQAGRVSEDQIKKPPTTEIKRPHINADSE 180

Query: 181 ITSSQSLANLFDFDFSSMNFNGHEWIANELRDDALLSASAIQGGTMDNLFQRPQGQTSFS 240
           ITSSQSLANLFDFDFSSMNFNGHEWIANELRDDALLSASAIQGGTMDNLFQRPQGQTSFS
Sbjct: 181 ITSSQSLANLFDFDFSSMNFNGHEWIANELRDDALLSASAIQGGTMDNLFQRPQGQTSFS 240

Query: 241 ANNRRQSSYNTLHLPRRLQPDQEESDQTNNQLQKAGPADVDDISRVYKLLFHRNEDRSKV 300
           ANNRRQSSYNTLHLPRRLQPDQEESDQTNNQLQKAGPADVDDISRVYKLLFHRNEDRSKV
Sbjct: 241 ANNRRQSSYNTLHLPRRLQPDQEESDQTNNQLQKAGPADVDDISRVYKLLFHRNEDRSKV 300

Query: 301 TQQAPVVPIDDQHVPRTIVPLDNVILINSSGTEGRMPKQVLEVVNSDVPDHTIFNLPTND 360
           TQQAPVVPIDDQHVPRTIVPLDNVILINSSGTEGRMPKQVLEVVNSDVPDHTIFNLPTND
Sbjct: 301 TQQAPVVPIDDQHVPRTIVPLDNVILINSSGTEGRMPKQVLEVVNSDVPDHTIFNLPTND 360

Query: 361 NILLRLPTTGLKVHGLTRFLMNYYLQNVVDLMTVVALPTNPWRTIYFPRAAQALGDIAGV 420
           NILLRLPTTGLKVHGLTRFLMNYYLQNVVDLMTVVALPTNPWRTIYFPRAAQALGDIAGV
Sbjct: 361 NILLRLPTTGLKVHGLTRFLMNYYLQNVVDLMTVVALPTNPWRTIYFPRAAQALGDIAGV 420

Query: 421 GYTSNSRNSLLNAILAVSCFNLQSKFPRNSPEMRFYLQLGIEFRGQASDFLKACLASSAK 480
           GYTSNSRNSLLNAILAVSCFNLQSKFPRNSPEMRFYLQLGIEFRGQASDFLKACLASSAK
Sbjct: 421 GYTSNSRNSLLNAILAVSCFNLQSKFPRNSPEMRFYLQLGIEFRGQASDFLKACLASSAK 480

Query: 481 QERYKDILTAILSMNSIDVVWGTMADCQYHLTLCEGLVEERMKTRPKLSGKARALHRIFS 540
           QERYKDILTAILSMNSIDVVWGTMADCQYHLTLCEGLVEERMKTRPKLSGKARALHRIFS
Sbjct: 481 QERYKDILTAILSMNSIDVVWGTMADCQYHLTLCEGLVEERMKTRPKLSGKARALHRIFS 540

Query: 541 FLKLIQDSTALDKVHEREIVIDHRIPESVVENDVSDNGGEFKESLNKVDGKIRIEYVKQN 600
           FLKLIQDSTALDKVHEREIVIDHRIPESVVENDVSDNGGEFKESLNKVDGKIRIEYVKQN
Sbjct: 541 FLKLIQDSTALDKVHEREIVIDHRIPESVVENDVSDNGGEFKESLNKVDGKIRIEYVKQN 600

Query: 601 RKSGSTPIFDSVASQTYYYPGNRMGSGDYTKSLEGNDVLSTDALYGLPNSIILLFSDCVR 660
           RKSGSTPIFDSVASQTYYYPGNRMGSGDYTKSLEGNDVLSTDALYGLPNSIILLFSDCVR
Sbjct: 601 RKSGSTPIFDSVASQTYYYPGNRMGSGDYTKSLEGNDVLSTDALYGLPNSIILLFSDCVR 660

Query: 661 LARHREYYRKHDQDPPESYEILCAEFEKKLSGWTSEWDFHKPNSTEFVNDTIEGVYYHTM 720
           LARHREYYRKHDQDPPESYEILCAEFEKKLSGWTSEWDFHKPNSTEFVNDTIEGVYYHTM
Sbjct: 661 LARHREYYRKHDQDPPESYEILCAEFEKKLSGWTSEWDFHKPNSTEFVNDTIEGVYYHTM 720

Query: 721 SFYQSLIIYYNTMARGRRHQDIQENVRNALTYLNKLTELINKGVKIVPLIWQGFIAGCSA 780
           SFYQSLIIYYNTMARGRRHQDIQENVRNALTYLNKLTELINKGVKIVPLIWQGFIAGCSA
Sbjct: 721 SFYQSLIIYYNTMARGRRHQDIQENVRNALTYLNKLTELINKGVKIVPLIWQGFIAGCSA 780

Query: 781 IDTDLQLQYKEWAARLANSGMGSYWGARQIMFEVWRRRVNGENCDNWFNV 830
           IDTDLQLQYKEWAARLANSGMGSYWGARQIMFEVWRRRVNGENCDNWFNV
Sbjct: 781 IDTDLQLQYKEWAARLANSGMGSYWGARQIMFEVWRRRVNGENCDNWFNV 830

>Sklu_2397.8 YML099C, Contig c2397 9784-12330
          Length = 848

 Score = 1004 bits (2597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/847 (60%), Positives = 623/847 (73%), Gaps = 46/847 (5%)

Query: 12  KEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSPSIKFNKFG-- 69
           ++ RR KTFTGCWTCRSRKVKCDLG+P+C+RCE+SG ECGGYDIKLRWS  IKF+++G  
Sbjct: 9   RKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKPIKFDRYGVQ 68

Query: 70  QVDSNGSPANGTEEPQSQRRNVGFVTXXXXXXXXXXXXXXLSALHSPSQDKISDNKTWII 129
              S  SP +G++EPQ QRRN+ FV               LSALHSP  + I+ +KTWII
Sbjct: 69  LPPSPNSPDSGSDEPQFQRRNIAFVRYQDEYEFYEDMDDELSALHSPPLENIAGDKTWII 128

Query: 130 KKFGVFRGTENVKTKYTPRRKRRQ------AGRVSEDQIKKPPTTEIKRPHINADSEITS 183
            KFGVFRGTE VK KY PR+KR++       G VS    K   TT +K    ++ S  T 
Sbjct: 129 NKFGVFRGTEKVKKKYVPRKKRKRNVSYNRGGSVSS---KLSSTTSVKSKGSSSISNSTP 185

Query: 184 SQSLANLFDFDFSSMNFNGHEWIANELRDDALLSASAIQGGTMDNLFQRPQG----QTSF 239
           +    +LFDFDFSSMNF GHEWI+NELRDDALLSASA+QG    N F  P G    ++S 
Sbjct: 186 T----DLFDFDFSSMNFTGHEWISNELRDDALLSASAVQG-IPTNTFTFPAGGNHTESSA 240

Query: 240 SANNRRQSSYNTLHLPRRLQPDQEESDQTNNQLQKAGPADVDDISRVYKLLFHRNEDRSK 299
           +A+     + +  H  +    +Q+ + Q       A    + ++S+VY+LL HRNED+ K
Sbjct: 241 TADFNDAKNASGQHHGQHQHRNQQSNIQGTVNGGFASIDPIAEVSQVYRLLSHRNEDKDK 300

Query: 300 VTQQAP------VVPIDDQHVPRTIVPLDNVILINSSGTEGRMPKQVLEVVNSDVPDHTI 353
             Q+         +   +   P ++VPL+N+I I++ G E RMP+ VLE+V S VPD +I
Sbjct: 301 DVQEQQKHDTHQTIASQEDEFP-SLVPLNNLISIHAPGGESRMPESVLEIVPSVVPDPSI 359

Query: 354 FNLPTNDNILLRLPTTGLKVHGLTRFLMNYYLQNVVDLMTVVALPTNPWRTIYFPRAAQA 413
           FNL ++ NILLRLPTTGL VHGL RFL+NYYLQNV DLMTVVALPTNPW+TIYFPRA +A
Sbjct: 360 FNLQSDKNILLRLPTTGLHVHGLARFLLNYYLQNVADLMTVVALPTNPWKTIYFPRALKA 419

Query: 414 LGDIAGVGYTSNSRNSLLNAILAVSCFNLQSKFPRNSPEMRFYLQLGIEFRGQASDFLKA 473
           LGD+AG+GYTSNSRNSLLNA+LAVSCFNLQSKFP+N+P+MRFYL LGIEFR QAS+FLK 
Sbjct: 420 LGDLAGIGYTSNSRNSLLNALLAVSCFNLQSKFPKNTPQMRFYLYLGIEFRSQASNFLKK 479

Query: 474 CLASSAKQERYKDILTAILSMNSIDVVWGTMADCQYHLTLCEGLVEERMKTRPKLSGKAR 533
           CL SSA QERYKDILTAILSMNSIDVVWGTMADCQYHLT+CE  VEERMKTRPK+S KA+
Sbjct: 480 CLNSSAHQERYKDILTAILSMNSIDVVWGTMADCQYHLTICEDFVEERMKTRPKISEKAK 539

Query: 534 ALHRIFSFLKLIQDSTALDKVHEREIVID-------HRIPESVVENDVSDNGGEFKESLN 586
           ALHRIFSFLKLIQDSTALDKV E EIVI         ++ ES    D++   GEFKESLN
Sbjct: 540 ALHRIFSFLKLIQDSTALDKVREGEIVIKDDEDVTGEQLQESQTGQDLNIADGEFKESLN 599

Query: 587 KVDGKIRIEYVK--QNRKSGSTPIFDSVASQTYYYPGNRMGSGDYTKSLEGNDVLSTDAL 644
           + DGKIRIE+VK  Q+  SGSTPIF ++ S+TYYYP           S    D+LSTDAL
Sbjct: 600 QKDGKIRIEFVKQPQSSSSGSTPIFTNITSETYYYP---------KMSTTTQDILSTDAL 650

Query: 645 YGLPNSIILLFSDCVRLARHREYYRKHDQDPPESYEILCAEFEKKLSGWTSEWDFHKPNS 704
           YGLPNS+IL FSDCVRL RHREYY+ +    P  Y  LC EFEK+L  W SEWDF+KP++
Sbjct: 651 YGLPNSLILCFSDCVRLVRHREYYKMNKLPAPRKYAKLCTEFEKRLLNWKSEWDFYKPHT 710

Query: 705 TEFVNDTIEGVYYHTMSFYQSLIIYYNTMARGRRHQDIQENVRNALTYLNKLTELIN-KG 763
            EFVNDTIEGVY+HTMSFY SLIIYY TMAR   +Q +Q  V   L++LN+L++LI+ K 
Sbjct: 711 REFVNDTIEGVYHHTMSFYYSLIIYYFTMARDLNNQLLQSYVEKVLSHLNQLSDLIDHKN 770

Query: 764 VKIVPLIWQGFIAGCSAIDTDLQLQYKEWAARLANSGMGSYWGARQIMFEVWRRRVNGEN 823
           VK+VPLIWQGFIAGCS++D++LQL +K+WAA+LA+SGMGSYWGARQIMFEVWRRR+NGE 
Sbjct: 771 VKVVPLIWQGFIAGCSSVDSNLQLSFKKWAAKLASSGMGSYWGARQIMFEVWRRRMNGEE 830

Query: 824 CDNWFNV 830
            DNW +V
Sbjct: 831 NDNWCSV 837

>KLLA0D10197g complement(861726..864296) similar to sp|P05085
           Saccharomyces cerevisiae YML099c ARG81 transcription
           factor involved in arginine metabolism singleton, start
           by similarity
          Length = 856

 Score =  909 bits (2350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/881 (53%), Positives = 593/881 (67%), Gaps = 87/881 (9%)

Query: 1   MKPRKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWS 60
           MKP K          RVKTFTGCWTCRSRKVKCDL +P C+RCEK GL CGGYD+KLRW+
Sbjct: 1   MKPAKP---------RVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWT 51

Query: 61  PSIKFNKFGQVDSNGSPANGTEEPQSQRRNVGFVTXXXXXXXXXXXXXXLSALHSPSQDK 120
             I+F+  G V +  +     +EPQ QRRNV FV               LSAL SP  + 
Sbjct: 52  RPIQFDTMGNVTATPTGIKDPDEPQYQRRNVDFVRYKEEYVYYEDMDDELSALSSPPLEL 111

Query: 121 ISDNKTWIIKKFGVFRGTENVKTKYTPRRKRRQ------------------AGRVSEDQI 162
           IS++KTWIIKKFGVF+GT+ VK +Y PR+KR++                    +V     
Sbjct: 112 ISEDKTWIIKKFGVFKGTDKVKKRYVPRKKRKKNQVFINAIEKAQKKLANKKNKVKTADS 171

Query: 163 KKPPTTEIKRPH----INADSEITSSQSLANLFDFDFSSMNFNGHEWIANELRDDALLSA 218
                T +  P      +A+ + TS+Q L +LF+FD +S+ F G+EWI+NELRDDALLSA
Sbjct: 172 DSKEGTNLCTPEDMESSSANDDHTSAQQLHSLFEFDMNSLLFPGNEWISNELRDDALLSA 231

Query: 219 SAIQGGTM-------DNLFQRPQGQTSFSANNRRQSSYNTLHLPRRLQPDQEESDQTNNQ 271
           SA+QG T+       +N    PQ   +     ++  S N                   N 
Sbjct: 232 SAVQGETIPFMGIRQNNTPDTPQTPLTVDNMGKKNGSVNG----------------NCND 275

Query: 272 LQKAGPADVDDISRVYKLLFHRNEDRSKVTQQAPVVPIDDQHVPRTI--VPLDNVILINS 329
            + +G  + D+++RVY+LLFHR     +             H   TI  VPL N + +N 
Sbjct: 276 GRTSGNDNEDELARVYRLLFHRRGSSDQPPPPTITSETKSGHAKETIGIVPLRNFVELNV 335

Query: 330 SGTEGRMPKQVLEVVNSDVPDHTIFNLPTNDNILLRLPTTGLKVHGLTRFLMNYYLQNVV 389
            G+   MP+  +EV++S VPD +IFN P N N LL +PTTG+ VHGL RFL+NYYLQNV 
Sbjct: 336 PGST--MPRSAIEVIHSQVPDPSIFNRPGNTNPLLDIPTTGVHVHGLARFLLNYYLQNVA 393

Query: 390 DLMTVVALPTNPWRTIYFPRAAQALGDIAGVGYTSNSRNSLLNAILAVSCFNLQSKFPRN 449
           DLMTVV LPTN W+TIYFPRA +ALGD+ G+GYTSNSRNSLLNA+LAVSCFNLQSKFP+N
Sbjct: 394 DLMTVVVLPTNSWKTIYFPRALKALGDLTGIGYTSNSRNSLLNALLAVSCFNLQSKFPKN 453

Query: 450 SPEMRFYLQLGIEFRGQASDFLKACLASSAKQERYKDILTAILSMNSIDVVWGTMADCQY 509
           SPEM+F+L LGIEFR QAS FLK CL+++  QERYKDILTAILSMNSIDVVWGTMADCQ 
Sbjct: 454 SPEMKFFLTLGIEFRTQASSFLKRCLSNTVNQERYKDILTAILSMNSIDVVWGTMADCQV 513

Query: 510 HLTLCEGLVEERMKTRPKLSGKARALHRIFSFLKLIQDSTALDKVHEREIVI--DHRIPE 567
           HL +CE  VE RMKTRPK+S KA+ALHRIFSFLKLIQDST+LDKV  +EIVI  ++   +
Sbjct: 514 HLAICEDFVENRMKTRPKISAKAKALHRIFSFLKLIQDSTSLDKVRTKEIVILDNNSSID 573

Query: 568 SVVENDVSDNGGEFKESLNKVDGKIRIEYV----------------KQNRKSGSTPIFDS 611
           S + + +S + GEFKESLN+ DGKI IE+                   +    +TPIF +
Sbjct: 574 SHISSGISLSNGEFKESLNREDGKIVIEFFSSPSSGKPSPVAFPKGSHDSSGVTTPIFSN 633

Query: 612 VASQTYYYPGNRMGSGDYTKSLEGNDVLSTDALYGLPNSIILLFSDCVRLARHREYYRKH 671
           +AS++YYYP     S D       N++LSTDALYGLPNS+ILLFSDCVRLARH EYYR+H
Sbjct: 634 IASESYYYP----KSND-----TDNNILSTDALYGLPNSLILLFSDCVRLARHLEYYRQH 684

Query: 672 DQDPPESYEILCAEFEKKLSGWTSEWDFHKPNSTE-FVNDTIEGVYYHTMSFYQSLIIYY 730
           +   P++++ LC EFE+++  W SEWDF  P S + FVNDTIEGVY+HTMSFY  LIIYY
Sbjct: 685 NIVTPKAFKKLCTEFEQRILSWKSEWDFKVPGSPDHFVNDTIEGVYHHTMSFYNGLIIYY 744

Query: 731 NTMARGRRHQDIQENVRNALTYLNKLTELI-NKGVKIVPLIWQGFIAGCSAIDTDLQLQY 789
            T+ +G  ++ ++ +V+N L  L +LTELI NKGVKIVPLIWQGF+AGC+ ID++LQL++
Sbjct: 745 FTVVKGLTYKYVKHHVQNVLNSLIQLTELIENKGVKIVPLIWQGFMAGCACIDSNLQLEF 804

Query: 790 KEWAARLANSGMGSYWGARQIMFEVWRRRVNGENCDNWFNV 830
           KEWAA+L  SGMGSYWGARQIMFEVWRRR+NGE  D+WF+V
Sbjct: 805 KEWAAKLCKSGMGSYWGARQIMFEVWRRRLNGEQNDDWFSV 845

>Scas_626.6
          Length = 839

 Score =  823 bits (2125), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/871 (49%), Positives = 563/871 (64%), Gaps = 88/871 (10%)

Query: 4   RKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSPSI 63
           RKS+ T+ K  RR KTFTGCWTCRSRKVKCDL +P C RC+KSGLECGGYDIKLRWS  +
Sbjct: 2   RKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKLV 61

Query: 64  KFNKFG---QVDSNGSPANGTEEPQSQRRNVGFVTXXXXXXXXXXXXXXLSALHSPSQDK 120
           KF+ +G       NG+ A+  EEPQ QRRN+ FV               LS LH+P  +K
Sbjct: 62  KFDPYGVQLPPSPNGNSASN-EEPQYQRRNIDFVKYKEEYIFHEDMDDELSILHAPPTEK 120

Query: 121 ISDNKTWIIKKFGVFRGTENVKTKYTPRRKRRQAGRVSEDQIKKPPTTEIKRPHINADSE 180
           I+D KTWIIKKFGVFRGT+ +  +Y PR+KRR          K  P+T  KR  +   ++
Sbjct: 121 IADGKTWIIKKFGVFRGTDKIDKQYAPRKKRR----------KPAPSTVSKRKTLKTGNK 170

Query: 181 ITSSQS------------------------LANLFDFDFSSMNFNGHEWIANELRDDALL 216
           +++ +S                        + +  DFD +  N   +EWI++ELRDD LL
Sbjct: 171 LSAKESAGKPINIEDSPSKPMSNHQSPVNNIPSFVDFDLAMNNVPSYEWISSELRDDVLL 230

Query: 217 SASAIQGGTMDNLFQRPQGQTSFSANNRRQSSYNTLHLPRRLQPDQEESDQTNNQLQKAG 276
           SA AIQG +++++   P   TS   +  + +    L     +       D T     +  
Sbjct: 231 SAFAIQGASINDV---PDSTTSAKTSINQGTVSTGLFSNIPIDGTNSIGDDT-----QTS 282

Query: 277 PADVDDISRVYKLLFHRNEDRSKVTQQAPVVPIDDQHVPRTIVPLDNVILINSSGTEGRM 336
           P +   I     LLFH         +Q P  P   + + +T        L+++  ++  M
Sbjct: 283 PNNDYTIQNALNLLFH--------NKQTPTSPSTSKGMVKT--------LLDAPQSDSHM 326

Query: 337 PKQVLEVVNSDVPDHTIFNLPTNDNILLRLPTTGLKVHGLTRFLMNYYLQNVVDLMTVVA 396
           P+ ++E++N    +  IF      N+   +P +G+ VHG+ +FL+NYYL+NV DLMTVV 
Sbjct: 327 PRTIMEIINPSPLELEIFEALNKLNLSWNIPASGVNVHGIGKFLLNYYLENVADLMTVVP 386

Query: 397 LPTNPWRTIYFPRAAQALGDIAGVGYTSNSRNSLLNAILAVSCFNLQSKFPRNSPEMRFY 456
           L  NPW+ +YFPRA QALGD+ G+GYT+NSRNSLLNA+LAVSCFNL+SKF +NS E  ++
Sbjct: 387 LSRNPWKKLYFPRALQALGDLVGLGYTTNSRNSLLNALLAVSCFNLKSKFEKNSKEYNYF 446

Query: 457 LQLGIEFRGQASDFLKACLASSAKQERYKDILTAILSMNSIDVVWGTMADCQYHLTLCEG 516
           L LGIE R QAS+FL  CL S+   E+YKD+LTAILSMNSIDVVWGTM DCQ HLT+CE 
Sbjct: 447 LNLGIELRKQASNFLNICLNSTVTVEKYKDVLTAILSMNSIDVVWGTMEDCQRHLTICED 506

Query: 517 LVEERMKTRPKLSGKARALHRIFSFLKLIQDSTALDKVHEREIVI--------DHRIPES 568
            VE+RM +RP +SGKAR LHRIFSFLKLIQDSTALDKV ++EIVI         +++ + 
Sbjct: 507 FVEKRMNSRPHISGKARTLHRIFSFLKLIQDSTALDKVRDKEIVIYGKKDKPDKNKVADP 566

Query: 569 VVENDVSDNGGEFKESLNKVDGKIRIEYVK--------QNRKSGSTPIFDSVASQTYYYP 620
            V+ D S+NGG+F+ESLNK++GKI+IEY++        +   S S P+F ++AS++YY P
Sbjct: 567 FVK-DTSNNGGQFRESLNKLNGKIQIEYIRNDDSNDNNEQSASSSPPMFANIASESYYKP 625

Query: 621 GNRMGSGDYTKSLEGNDVLSTDALYGLPNSIILLFSDCVRLARHREYYRKHDQDPPESYE 680
           G +  S DY       D+LSTDALYGLPNS+ILLFSDCVR+ RH EYY       P  + 
Sbjct: 626 GQKSES-DY-------DILSTDALYGLPNSLILLFSDCVRIVRHNEYYNIKYLAVPREFT 677

Query: 681 ILCAEFEKKLSGWTSEWDFHKPNSTEFVNDTIEGVYYHTMSFYQSLIIYYNTMARGRRHQ 740
            +C  FEK+L  W  EW F+K N+ EF++DTIEGVY+HTMSFY  L+IYY +MA+   +Q
Sbjct: 678 EICLNFEKRLLKWKPEWAFYKENTDEFIDDTIEGVYHHTMSFYYGLVIYYFSMAKHLNNQ 737

Query: 741 DIQENVRNALTYLNKLTELIN-KGVKIVPLIWQGFIAGCSAIDTDLQLQYKEWAARLANS 799
            +Q  V   L +LNKLT+LI+ K VKIVPL+WQGFIAGCS+   DLQ ++++WAA+LA S
Sbjct: 738 FLQSYVEKVLLHLNKLTDLIDHKSVKIVPLMWQGFIAGCSSNMQDLQQEFRKWAAKLAES 797

Query: 800 GMGSYWGARQIMFEVWRRRVNGENCDNWFNV 830
           GMGSYWGARQ+MFEVWRRR+N E  DNW++V
Sbjct: 798 GMGSYWGARQVMFEVWRRRMNDEPNDNWYSV 828

>AAL175W [12] [Homologous to ScYML099C (ARG81) - NSH]
           complement(32874..35525) [2652 bp, 883 aa]
          Length = 883

 Score =  802 bits (2072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/876 (48%), Positives = 558/876 (63%), Gaps = 89/876 (10%)

Query: 11  GKEVRR--VKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSPSIKFNKF 68
           G  VRR   KTFTGCWTCR RKVKCDLGKP+CQRCEKSGL+CGGYDIKLRWS  I+F+KF
Sbjct: 30  GTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNPIRFDKF 89

Query: 69  G-QVDSNGSPANGTEEPQS-QRRNVGFVTXXXXXXXXXXXXXXLSALHSPSQDKISDNKT 126
           G Q+       +G +  Q  QRRN+ FV               LSALHSP  + I+D+KT
Sbjct: 90  GNQMAGEDRDGDGEQPAQPFQRRNIMFVRYDEEYEYYEDMDDELSALHSPPLEMIADHKT 149

Query: 127 WIIKKFGVFRGTENVKTKYTPRRKR--------------RQAGRVSEDQIKKPPTTEIKR 172
           WIIK+FGVF+GT+ VK KY PR++R              R+     E Q ++    E++ 
Sbjct: 150 WIIKRFGVFKGTDRVKRKYVPRKRRKVNPVFADAMAREHRRKLEEREKQARRKRKGELQG 209

Query: 173 ----------------PHINADSEITSSQSLANLFDFDFSSMNFNGHEWIANELRDDALL 216
                           P     +   S  S   LFDFDFS+      EW+A EL+DD  L
Sbjct: 210 SLGSGNATGAGFAKAGPPAAESAGAMSPVSATPLFDFDFSTPGLVSSEWMAGELKDDTTL 269

Query: 217 SASAIQGG----TMDNLFQRPQGQTSFSANNRRQSSYNTLHLPRRLQPDQEESDQTNNQL 272
           S++ ++      T  ++ Q   G T+ +A  + QSS      P +  P           L
Sbjct: 270 SSAMLRNTLSFPTGLSVAQHGDGITADTAPPKSQSSI----FPEQTLP-----------L 314

Query: 273 QKAG---PADVDDISRVYKLLFHRNEDRSKVTQQAPVVPIDDQHVPRTIVPLDNVILINS 329
           Q AG   P  VD++S+VY+LL   N   +          +   H P T+   DNV +   
Sbjct: 315 QSAGTMVPPSVDEVSKVYRLLL--NNQGTDCNSSTGYKGLSGVHTPYTV---DNVAI--- 366

Query: 330 SGTEGRMPKQVLEVVNSDVPDHTIFNLPTNDNILLRLPTTGLKVHGLTRFLMNYYLQNVV 389
            G E RMP   +E V S VPD TIF L  + N L+RLP  G+++HGLTRFL++YY QNV 
Sbjct: 367 HGPESRMPASAIESVPSIVPDPTIFTLAEHTNSLIRLPRMGMQIHGLTRFLLSYYQQNVA 426

Query: 390 DLMTVVALPTNPWRTIYFPRAAQALGDIAGVGYTSNSRNSLLNAILAVSCFNLQSKFPRN 449
           DLM+VVALP NPW+TIYFPRA +ALG++  +GYTS+SRN+LLNA+LAVSCF+LQSKFP+N
Sbjct: 427 DLMSVVALPKNPWKTIYFPRAVKALGELGALGYTSHSRNALLNALLAVSCFHLQSKFPKN 486

Query: 450 SPEMRFYLQLGIEFRGQASDFLKACLASSAKQERYKDILTAILSMNSIDVVWGTMADCQY 509
           S EM++++ LG++FR QAS FL ACL+S+++QE YKD+LTAILSMNSIDVVWGTM+DCQY
Sbjct: 487 SKEMKYFVSLGMDFRNQASGFLNACLSSTSRQEHYKDVLTAILSMNSIDVVWGTMSDCQY 546

Query: 510 HLTLCEGLVEERMKTRPKLSGKARALHRIFSFLKLIQDSTALDKVHEREIVIDHRIPESV 569
           HLT+CE  +E RMK+RP LS KAR LHRIFSFLKLIQDSTALDKV E+EI++     +  
Sbjct: 547 HLTICEEFIESRMKSRPLLSEKARCLHRIFSFLKLIQDSTALDKVQEKEIIMKDAGDKEF 606

Query: 570 VEN---------DVSDNGGEFKESLNKVDGKIRIEYVKQNRK----SGSTPIFDSVASQT 616
            +N         D S   G + E LNK +G++ IE+++++ +     GS P+F+++ +++
Sbjct: 607 QKNGSSTPPLSTDSSSFTGRYVEQLNKDNGRVCIEFIEKDGQYFDTRGSVPLFNTIVTKS 666

Query: 617 YYYPGNRMGSGDYTKSLEGNDVLSTDALYGLPNSIILLFSDCVRLARHREYYRKHDQDPP 676
           Y +  N              D LS D LYGLPNS+ILLFSDCV L RHR Y+++H+   P
Sbjct: 667 YPHEINETRI----------DTLSMDVLYGLPNSLILLFSDCVSLVRHRFYFKRHNTAQP 716

Query: 677 ESYEILCAEFEKKLSGWTSEWDFHKPNS-TEFVNDTIEGVYYHTMSFYQSLIIYYNTMAR 735
            S+ + C + E++L  W  EW F K +S  EF+NDT+EGVY+HTMSFY  L+IYY TMAR
Sbjct: 717 TSFGLFCVKIEQRLLSWKPEWIFWKDDSKAEFINDTVEGVYHHTMSFYYGLLIYYFTMAR 776

Query: 736 GRRHQDIQENVRNALTYLNKLTELI-NKGVKIVPLIWQGFIAGCSAIDTDLQLQYKEWAA 794
                 +Q  V+  L++L +L  +I +K VKIVPL+WQGF+AGCS  D+ +QL++K+W A
Sbjct: 777 SLEDHTLQNYVQKVLSHLRELGNIIEHKDVKIVPLMWQGFMAGCSCTDSSMQLEFKKWTA 836

Query: 795 RLANSGMGSYWGARQIMFEVWRRRVNGENCDNWFNV 830
           +L N G+GSYWGARQIM EVWRRR+    CDNW++V
Sbjct: 837 QLVNFGIGSYWGARQIMLEVWRRRMTDGKCDNWYSV 872

>YML099C (ARG81) [3872] chr13 complement(74398..77040) Component of
           the ARGR regulatory complex, contains a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain [2643 bp, 880 aa]
          Length = 880

 Score =  739 bits (1909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/892 (46%), Positives = 545/892 (61%), Gaps = 93/892 (10%)

Query: 6   SSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSPSIKF 65
           SS    K++ R KTFTGCWTCR RKVKCDL  P+CQRCEKS L CGGYDIKLRWS  ++F
Sbjct: 4   SSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKPMQF 63

Query: 66  NKFGQVDSNGSPANGT------EEPQSQRRNVGFVTXXXXXXXXXXXXXXLSALHSPSQD 119
           + +G      SPA  T      +EPQ QRRN+ FV               L+ LH+P  +
Sbjct: 64  DPYGVPIPQNSPATTTNLSGSVDEPQYQRRNIDFVRYDEEYVYHEDMDDELTMLHTPPIE 123

Query: 120 KISDNKTWIIKKFGVFRGTENVKTKYTPRRKRRQAG------------------------ 155
           KISDNKTWIIKKFGVF+GT+ +  +Y PR+KR +                          
Sbjct: 124 KISDNKTWIIKKFGVFKGTDKIDKQYAPRKKRNRKRVAKSLESSASISLSSLPSSSTISF 183

Query: 156 --RVSEDQIKKPPTTEIKRPHINADSEITSSQSLANLFDFDFSSMNFNGHEWIANELRDD 213
             R  ED+++      +K   ++A+  +  +    NL D+D++++N  G+EWI++ELRDD
Sbjct: 184 PIRHIEDKLRN--KGHVKTGILSANDGVPPT---PNLLDYDWNNLNITGYEWISSELRDD 238

Query: 214 ALLSASAIQGGTMDNLFQRPQGQTSFSANNRRQSSYNTLHLPRRLQPDQEESDQTNNQLQ 273
           ALLSA  +QG  + +   +PQ + S   N+   S    ++        + ++  ++    
Sbjct: 239 ALLSAVTLQGHHLGH--TQPQ-EISLEENSNVVSGEEHVNAKEHGCAFEADNQGSSTLPN 295

Query: 274 KAGPADVDDISRVYKLLFHRNEDRSKVTQQAPVVPIDDQHV---PRTIVPLD-NVILINS 329
           KA  A+     +  KLLF +N   S+  +  P   IDD  V   PR++   D N I +  
Sbjct: 296 KAASANDKLYQQNLKLLFQKNSSNSE--EPDPQALIDDVFVNIEPRSLPASDLNKITLAP 353

Query: 330 SGTEGRMPKQVLEVVN--SDVPDHTIFNLPTNDNILLRLPTTGLKVHGLTRFLMNYYLQN 387
              E RMPK +LE+ +  SD+P   +       +I+   P T L VHGL RFL+N+Y  N
Sbjct: 354 PNEESRMPKSMLELTSYSSDLPPELV-------DII---PKTDLTVHGLARFLLNHYFNN 403

Query: 388 VVDLMTVVALPTNPWRTIYFPRAAQALGDIAGVGYTSNSRNSLLNAILAVSCFNLQSKFP 447
           V D MTVV L  NPW+T+YFPRA  ALGD+AG+G +SNSRN+LLNA+LAVSCF+LQSK+P
Sbjct: 404 VADKMTVVVLEKNPWKTLYFPRALMALGDLAGLGQSSNSRNALLNALLAVSCFHLQSKYP 463

Query: 448 RNSPEMRFYLQLGIEFRGQASDFLKACL-ASSAKQERYKDILTAILSMNSIDVVWGTMAD 506
           RN    +++L LGIE R QAS+FL+ CL   S+  E+YKD+LTAILSMNSIDVVWGTMAD
Sbjct: 464 RNYKLQKYFLGLGIELRNQASNFLRLCLNTKSSIPEKYKDVLTAILSMNSIDVVWGTMAD 523

Query: 507 CQYHLTLCEGLVEERMKTRPKLSGKARALHRIFSFLKLIQDSTALDKVHEREIVI----- 561
           CQ HL LCE  VE RMK RP +S K + LHRIFSFLKLIQDSTALDKV  +EIVI     
Sbjct: 524 CQDHLALCEDFVESRMKLRPNISEKTKTLHRIFSFLKLIQDSTALDKVRAKEIVILPSEE 583

Query: 562 -DHRIPESVVENDVSDN--------GGEFKESLNKVDGKIRIEYVKQ---NRKSGST--- 606
            D+  P        S +         G F+E+LN+ DGKI IE+VK+   N  + ST   
Sbjct: 584 DDNYKPLDTSNATTSSSEPRVDVVQEGLFREALNENDGKIHIEFVKEPITNVSADSTPSS 643

Query: 607 ---PIFDSVASQTYYYPGNRMGSGDYTKSLEGND--VLSTDALYGLPNSIILLFSDCVRL 661
              PIF ++A+++YY         D +K +   D  ++ TD+LYGLPNS+ILLFSDCVR+
Sbjct: 644 TTPPIFTNIATESYY------NKSDISKLVSKTDENIIGTDSLYGLPNSLILLFSDCVRI 697

Query: 662 ARHREYYRKHDQDPPESYEILCAEFEKKLSGWTSEWDFHKPNS--TEFVNDTIEGVYYHT 719
            RH EYY       P  +  L   FEK+L  W SEW+FH+ NS    F+N T E +Y+HT
Sbjct: 698 VRHNEYYNLTYLPVPRKFNELSLNFEKRLLKWKSEWNFHQENSEGKSFINSTAEALYHHT 757

Query: 720 MSFYQSLIIYYNTMARGRRHQDIQENVRNALTYLNKLTELIN-KGVKIVPLIWQGFIAGC 778
           MSFY SLIIYY TMAR    Q +Q  V   L +LN + EL++ K VKIVPLIWQGF+AGC
Sbjct: 758 MSFYFSLIIYYFTMARSLNCQFLQNYVAKVLDHLNAMEELVDQKKVKIVPLIWQGFMAGC 817

Query: 779 SAIDTDLQLQYKEWAARLANSGMGSYWGARQIMFEVWRRRVNGENCDNWFNV 830
           +  D + Q +++ WAA+LA SG+GSYWGARQ+M EVWRRR   E  DNW++V
Sbjct: 818 ACTDENRQQEFRRWAAKLAESGVGSYWGARQVMLEVWRRRKEDEPGDNWYSV 869

>CAGL0H06875g complement(682518..684626) some similarities with
           sp|05085 Saccharomyces cerevisiae YML099c ARG81,
           hypothetical start
          Length = 702

 Score =  315 bits (806), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 198/562 (35%), Positives = 291/562 (51%), Gaps = 87/562 (15%)

Query: 304 APVVPIDDQHVPRTIVPLDNVIL-----INSSGTEGRMPKQVLEVVNSD-VPDHTIFNLP 357
           AP V       P ++ P   +++     +   G    M    +E++  D + DH+     
Sbjct: 182 APSVATSTMTTPISLSPTSPMMIPDTLGLTFDGNPAFMSPLPMELLQPDFIHDHSH---- 237

Query: 358 TNDNILLRLPTTGLK-VHGLTRFLMNYYLQNVVDLMTVVALPT---NPWRTIYFPRAAQA 413
                L+ L T     VH   RFL+ +YL+ V DLMT+  +P    NPW  IYFPRA  A
Sbjct: 238 -----LVSLSTESCSIVHNNVRFLLTHYLEKVPDLMTIAPIPNKNKNPWAKIYFPRAIAA 292

Query: 414 LGDIAGVGYTSN-SRNSLLNAILAVSCFNLQSKFPRNSPEMRFYLQLGIEFRGQASDFLK 472
           LG++     + N +R SLLN  L+VSCFNL+     +     FYL L +E R +AS FL 
Sbjct: 293 LGELIAFPNSQNYARISLLNGCLSVSCFNLKDLLKYDPVSTDFYLNLAVELRTRASHFLN 352

Query: 473 ACLASSAKQERYKDIL-----------------TAILSMNSIDVVWGTMADCQYHLTLCE 515
             L    + E Y+DIL                  AIL+MNSID+VWGTM DC  +L +CE
Sbjct: 353 LALEQEEEYEEYRDILEDDDIAEDYNKHFCDMLIAILTMNSIDIVWGTMVDCDNYLRICE 412

Query: 516 GLVEERMKTRPKLSGKARALHRIFSFLKLIQDSTALDKVHEREIVIDHRIPESVVENDVS 575
            L+ +  K R  +S K ++L+ I++FLKL+Q+STA++ +   E  +D   P+        
Sbjct: 413 QLISKN-KKRVVVSKKIKSLYTIYAFLKLMQNSTAMETI-TSEPSLDFHNPDI------- 463

Query: 576 DNGGEFKESLNKVDGKIRIEYVKQNRKSGSTPIFDSVASQTYYYPGNRMGSGDYTKSLEG 635
                           I  +Y+++  ++    IF      T +Y   +M +         
Sbjct: 464 ----------------IPYKYLRETYENDIKTIF------TDHYGSTKMNT--------- 492

Query: 636 NDVLSTDALYGLPNSIILLFSDCVRLARHREYYRKHDQ--DPPESYEILCAEFEKKLSGW 693
              L  DAL  LPNS++LLF DCV L R+  Y++K  +  + P  + +   EFE KLS W
Sbjct: 493 ---LGADALNALPNSLVLLFYDCVSLTRYYFYHKKKSEGIELPTEFFMKTREFEDKLSNW 549

Query: 694 TSEWDFHKPNSTEFVNDTIEGVYYHTMSFYQSLIIYYNTMARGRRHQDIQENVRNALTYL 753
            SEWDF       F++ TIEG+Y+HTMSFY  L +YY    + + ++ +   V   + +L
Sbjct: 550 KSEWDFFDSTGRNFLSPTIEGIYHHTMSFYYGLCVYYYNFIKNQDYESLNVEVWKVIYHL 609

Query: 754 NKLTELIN-----KGVKIVPLIWQGFIAGCSAIDTDLQLQYKEWAARLANSGMGSYWGAR 808
            ++  L +     +G+K++PLIWQGFIAGC   D ++Q ++K W   ++ +G GSY GA 
Sbjct: 610 QQIEFLKDSSAGKEGIKLIPLIWQGFIAGCLCSDPEVQSEFKTWFDTVSLTGAGSYRGAI 669

Query: 809 QIMFEVWRRRVNGENCDNWFNV 830
           QIMFEVWRRR N E  D+W +V
Sbjct: 670 QIMFEVWRRRDNNELGDDWLSV 691

 Score =  135 bits (339), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 85/133 (63%), Gaps = 5/133 (3%)

Query: 12  KEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSPSIKFNKFG-Q 70
           K  R VKT++GCWTCR+RKVKCDL +P+C RC +S ++CGGY IKLRWSP + F+ +G  
Sbjct: 4   KSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSPLLHFDLYGVP 63

Query: 71  VDSNGS----PANGTEEPQSQRRNVGFVTXXXXXXXXXXXXXXLSALHSPSQDKISDNKT 126
           + SN S      +  E   + RRNV  V               LS LH+P +DKI++NKT
Sbjct: 64  MPSNESITTTEGDDVETSTNLRRNVERVRYEEEYEYHEDMDEELSELHAPPEDKIANNKT 123

Query: 127 WIIKKFGVFRGTE 139
           WIIKKFGVFR  E
Sbjct: 124 WIIKKFGVFRAIE 136

>KLLA0F10373g 957948..958994 some similarities with sp|P38141
          Saccharomyces cerevisiae YBR240c THI2 regulator of the
          thiamine biosynthetic genes singleton, hypothetical
          start
          Length = 348

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 37/63 (58%), Gaps = 5/63 (7%)

Query: 18 KTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSPS----IKFNKFGQVDS 73
          + FTGCW CR +K KCD  KP C  C K G+EC  YD++L W P     +K N+ G +  
Sbjct: 5  RNFTGCWACRFKKRKCDERKPICSLCLKHGVEC-CYDVRLSWLPENMYVVKDNELGVISG 63

Query: 74 NGS 76
          N +
Sbjct: 64 NSN 66

>Scas_597.4
          Length = 475

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 43/86 (50%), Gaps = 3/86 (3%)

Query: 5  KSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSPSIK 64
          KS    GK + + +TFTGCW CR +K +CD  KP C  C + G  C  YDI+L W     
Sbjct: 7  KSLKVDGK-LNKARTFTGCWACRLKKRRCDELKPTCSLCVRHGDTC-SYDIRLMWLDVNM 64

Query: 65 FNKFGQVDSNGSPANGTEEPQSQRRN 90
          F K     S G+      E Q +R N
Sbjct: 65 F-KVDTSMSGGAEYVTFNESQQRRCN 89

>AFL033W [3160] [Homologous to ScYBR240C (THI2) - SH]
          complement(373485..374633) [1149 bp, 382 aa]
          Length = 382

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 4  RKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRW 59
          R      G    R++ FTGCW CR +K +CD G P C  C K G  C  YD++L W
Sbjct: 5  RNERHRAGARKPRIRCFTGCWACRFKKRRCDEGVPFCALCVKHGDAC-SYDVRLVW 59

>Kwal_14.1631
          Length = 443

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 29/44 (65%), Gaps = 1/44 (2%)

Query: 16 RVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRW 59
          + ++FTGCW CR +K +CD  KP C  C K G +C  YDI+L W
Sbjct: 8  KARSFTGCWACRFKKRRCDEAKPVCSLCLKHGDQC-SYDIRLVW 50

>YBR240C (THI2) [419] chr2 complement(700447..701799) Zinc-finger
          regulatory protein for thiamine pyrophosphokinase
          (THI80) expression [1353 bp, 450 aa]
          Length = 450

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query: 18 KTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRW 59
          +TFTGCW CR +K +CD  +P C  C K G  C  YDI+L W
Sbjct: 25 RTFTGCWACRFKKRRCDENRPICSLCAKHGDNC-SYDIRLMW 65

>CAGL0F07865g complement(768270..770804) similar to tr|Q12151
           Saccharomyces cerevisiae YDR213w UPC2, start by
           similarity
          Length = 844

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 45/86 (52%), Gaps = 1/86 (1%)

Query: 6   SSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSPSIKF 65
           S+ + GK     K+  GC  C+ R+VKCD GKP C +C K  LEC    ++     +   
Sbjct: 37  STTSTGKRKFHNKSKNGCDHCKRRRVKCDEGKPMCDKCVKMKLECVYTPVQPPKRRTRTR 96

Query: 66  NKFGQVDSNGSPANGTEEPQSQRRNV 91
            K+   D+NG     TE+PQ + ++V
Sbjct: 97  VKYITRDANGEIIE-TEKPQVEGKDV 121

>YDR213W (UPC2) [1051] chr4 (889744..892485) Sterol regulatory
          element binding protein involved in the regulation of
          sterol biosynthetic gene expression and the uptake and
          intracellular esterification of sterols [2742 bp, 913
          aa]
          Length = 913

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 31/55 (56%)

Query: 4  RKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLR 58
          + S+ + GK     K+  GC  C+ R+VKCD GKP C++C    LEC    I LR
Sbjct: 32 KVSTTSTGKRKFHNKSKNGCDNCKRRRVKCDEGKPACRKCTNMKLECQYTPIHLR 86

>KLLA0F20680g 1924148..1926511 weakly similar to sp|P39001
           Saccharomyces cerevisiae YDR207c UME6 negative
           transcriptional regulator singleton, hypothetical start
          Length = 787

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 5   KSSDT-KGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDI 55
           KSSD  K +     ++ TGCW CR RK KC   KP CQ C +  LEC  YDI
Sbjct: 700 KSSDQIKKRNATGARSRTGCWICRLRKKKCTEEKPQCQNCVRLHLEC-FYDI 750

>CAGL0C01199g complement(121944..124712) similar to tr|Q12151
          Saccharomyces cerevisiae YDR213w UPC2, hypothetical
          start
          Length = 922

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 27/47 (57%)

Query: 4  RKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          R S  + GK     K+ TGC  C+ R+VKCD GKP C++C    L C
Sbjct: 29 RVSKTSTGKRKFHKKSKTGCDNCKRRRVKCDEGKPGCKKCSNLNLVC 75

>KLLA0F04213g 400673..402979 similar to sp|P40971 Saccharomyces
           cerevisiae YDR034c LYS14 transcriptional activator of
           lysine pathway genes singleton, start by similarity
          Length = 768

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 28/45 (62%)

Query: 6   SSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
           S+D  GK V+R  +  GC  C+ R++KCD GKP C +C +   +C
Sbjct: 138 STDADGKIVKRKYSRNGCLECKKRRMKCDEGKPTCWQCARLNRKC 182

>Kwal_56.23058
          Length = 775

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 27/45 (60%)

Query: 6   SSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
           SS   GK V+R  +  GC  C+ R++KCD GKP C +C +   EC
Sbjct: 132 SSGADGKTVKRKYSRNGCTECKRRRMKCDEGKPTCWQCARLNREC 176

>YLR228C (ECM22) [3628] chr12 complement(600021..602465) Sterol
          regulatory element binding protein involved in the
          regulation of sterol biosynthetic gene expression and
          may be involved in regulating sterol uptake [2445 bp,
          814 aa]
          Length = 814

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 28/47 (59%)

Query: 4  RKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          + S  + GK     K+ TGC  C+ R+VKCD GKP C++C    L+C
Sbjct: 25 KVSKTSTGKRKFHNKSKTGCDNCKRRRVKCDEGKPFCKKCTNMKLDC 71

>Scas_663.12
          Length = 944

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 3  PRKS-SDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSP 61
          P KS +D++  + +R +    C  CR  KVKCD  KP C RC K  LEC  YD+  + +P
Sbjct: 19 PSKSINDSQVTKKKRYRLSFVCQGCRRSKVKCDQEKPVCSRCSKHDLEC-VYDVTKQHAP 77

>Sklu_2434.10 YAL051W, Contig c2434 22765-25716
          Length = 983

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 3  PRKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSP 61
          P K  +      +R +    C  CR  K KCD  KP+C RC K+G+EC  YDI+ +  P
Sbjct: 8  PYKQEEQNSHSSKRNRISFVCKACRKSKTKCDREKPSCTRCIKNGIEC-VYDIEQQTQP 65

>AGL091W [4220] [Homologous to ScYLR228C (ECM22) - SH; ScYDR213W
           (UPC2) - SH] complement(535317..537917) [2601 bp, 866
           aa]
          Length = 866

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 26/47 (55%)

Query: 4   RKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
           + S    GK     K+  GC  C+ R+VKCD GKP CQ+C K  L C
Sbjct: 70  KVSKTATGKRKFHNKSKNGCDNCKRRRVKCDEGKPGCQKCLKMRLSC 116

>Sklu_1373.2 YDR207C, Contig c1373 1069-2895
          Length = 608

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 18  KTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDI 55
           ++ TGCW CR RK KC   KP+C  C +  LEC  YDI
Sbjct: 536 RSRTGCWICRLRKKKCTEEKPHCNNCTRLNLEC-FYDI 572

>Scas_717.33
          Length = 904

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 6/51 (11%)

Query: 6  SSDTKGKEVRRVKTFTGCWTCRSRKVKCDLG------KPNCQRCEKSGLEC 50
          +S    ++++  ++F  C +CR RKVKCDLG      KP C RC + G  C
Sbjct: 17 ASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67

>YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription factor
           with heme-dependent DNA-binding activity, responsible
           for heme-dependent activation of many genes [4509 bp,
           1502 aa]
          Length = 1502

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 33/55 (60%)

Query: 6   SSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWS 60
           SSD+   + +R +    C  CR RKVKCD  +P+CQ+C K+G+    + ++  W+
Sbjct: 47  SSDSSKIKRKRNRIPLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWA 101

>Kwal_23.3122
          Length = 788

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 27/47 (57%)

Query: 4  RKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          + S  + GK     K+  GC  C+ R+VKCD  KP+CQ+C    LEC
Sbjct: 31 KVSKTSTGKRKFHKKSKNGCDNCKRRRVKCDEDKPSCQKCLNMKLEC 77

>YDR421W (ARO80) [1245] chr4 (1312028..1314880) Positive
          transcription regulator of ARO9 and ARO10, member of
          the Zn2Cys6 transcription factor family [2853 bp, 950
          aa]
          Length = 950

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 6/55 (10%)

Query: 2  KPRKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLG------KPNCQRCEKSGLEC 50
          K R S +   +  +R +T+  C +CRSRKVKCDLG       P C RC++   +C
Sbjct: 4  KKRPSGNAAFELPKRRRTYQACISCRSRKVKCDLGPVDNPHDPPCARCKRELKKC 58

>Scas_679.26
          Length = 775

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 26/47 (55%)

Query: 4  RKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          + S  + GK     K+  GC  C+ R+VKCD  KP CQ+C    LEC
Sbjct: 39 KVSKTSTGKRKFHNKSKNGCDNCKRRRVKCDELKPTCQKCINMNLEC 85

>KLLA0A10329g 903873..905792 some similarities with
          ca|CA6113|IPF100.3 Candida albicans zinc finger
          protein, 3-prime end (by homology), hypothetical start
          Length = 639

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 2/48 (4%)

Query: 13 EVRRV-KTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRW 59
          E+++V +++ GC  C+S K KCD  KP+C  C+K G +C  Y   L+W
Sbjct: 6  EMKKVARSYMGCQKCKSLKKKCDEVKPHCGYCKKRGFQC-DYSRTLKW 52

>KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces
          cerevisiae YLR256w HAP1 transcription factor singleton,
          hypothetical start
          Length = 1253

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 31/52 (59%)

Query: 9  TKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWS 60
          T  ++ +R +    C  CR RKVKCD G+P CQ+C K+G+    + ++  W+
Sbjct: 11 TPQQKRKRNRVPLSCTICRKRKVKCDKGRPQCQQCVKTGVGHLCHYMEQTWA 62

>KLLA0C17050g 1490472..1493339 some similarities with
           ca|CA3454|IPF10533.exon1 Candida albicans unknown
           function, exon 1, hypothetical start
          Length = 955

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 33/69 (47%), Gaps = 2/69 (2%)

Query: 15  RRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSPSIKFN-KFGQVDS 73
           +R +    C  C  RK+KCD  KP C+ C K+G EC  Y +  R S   K N   G  D 
Sbjct: 38  KRQRQILSCVACHKRKIKCDRAKPVCESCGKNGWEC-LYFLNARVSRGGKHNISTGTEDV 96

Query: 74  NGSPANGTE 82
             S A+  E
Sbjct: 97  TASEASKEE 105

>ADR404C [2144] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1432323..1434950) [2628 bp, 875 aa]
          Length = 875

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query: 23 CWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDI--KLRWSPSIKFNKF 68
          C  CR  K KCD  KP C RC + GL C GYDI  +L   PS K  K 
Sbjct: 24 CIPCRKCKTKCDKLKPTCSRCAELGLYC-GYDIEKQLTEDPSDKIQKL 70

>AGL099C [4213] [Homologous to ScYDR207C (UME6) - SH]
           (516587..518830) [2244 bp, 747 aa]
          Length = 747

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 17  VKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDI 55
            ++ TGCW CR RK KC   +P C  C +  LEC  YDI
Sbjct: 674 TRSRTGCWICRLRKKKCSEERPQCSNCLRLNLEC-VYDI 711

>ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1435705..1438128) [2424 bp, 807 aa]
          Length = 807

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 5  KSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSP 61
          K + TKG   RR K    C +CR  K KCD  KP+C RC K+G  C  YD++ +  P
Sbjct: 24 KVTKTKG---RRNKLSFVCQSCRRSKTKCDKVKPSCTRCVKNGSVC-VYDVETQTKP 76

>Scas_674.12*
          Length = 909

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%)

Query: 12 KEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          K  R+ +    C  CRS+KVKCD  +P+C RC K+   C
Sbjct: 4  KNYRKARPSFVCLVCRSKKVKCDKARPSCGRCRKTNKLC 42

>YDR034C (LYS14) [885] chr4 complement(509732..512104)
           Transcriptional activator of lysine pathway genes with
           2-aminoadipate semialdehyde as coinducer [2373 bp, 790
           aa]
          Length = 790

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%)

Query: 7   SDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
           +D KG  V+R  +  GC  C+ R++KCD  KP C +C +   +C
Sbjct: 143 TDKKGNTVKRKYSRNGCSECKRRRMKCDETKPTCWQCARLNRQC 186

>YDR207C (UME6) [1046] chr4 complement(865005..867515) Global
           transcriptional regulator containing a zinc binuclear
           cluster domain involved in pathway specific repression
           or induction [2511 bp, 836 aa]
          Length = 836

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 17  VKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
            ++ TGCW CR RK KC   +P+C  CE+  L+C
Sbjct: 765 TRSRTGCWICRLRKKKCTEERPHCFNCERLKLDC 798

>AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH]
          (646832..650290) [3459 bp, 1152 aa]
          Length = 1152

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 31/55 (56%)

Query: 6  SSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWS 60
          SS T   + +R +    C  CR RKVKCD  +P+C +C K+G+    + ++  W+
Sbjct: 2  SSPTASSKRKRNRVPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYMEQTWA 56

>Sklu_2064.2 , Contig c2064 873-3641
          Length = 922

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 11 GKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSP 61
          GK  +R +    C  CR RK+KCD  +P C +C + GL C  YDI+ + +P
Sbjct: 13 GKVQKRNRLSFVCLECRRRKIKCDKQRPCCIQCAEQGLTC-VYDIERQPAP 62

>Sklu_1622.2 YDR034C, Contig c1622 1522-3858
          Length = 778

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 25/40 (62%)

Query: 11  GKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
           GK  +R  +  GC  C+ R++KCD GKP+C +C +   EC
Sbjct: 152 GKISKRKYSRNGCTECKKRRMKCDEGKPSCWQCTRLNREC 191

>Kwal_26.6805
          Length = 944

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 15 RRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSP 61
          RR +    C +CR  K KCD  KP+C RC K G+ C  YD+  +  P
Sbjct: 21 RRNRLSFVCQSCRKGKTKCDRAKPSCSRCLKHGIRC-VYDVDRQTPP 66

>Scas_596.4
          Length = 701

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 2/39 (5%)

Query: 12  KEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
           K+ RR ++  GCW CR RK KC   KP C  C++  L+C
Sbjct: 559 KKARRSRS--GCWICRLRKKKCTEEKPACFNCQRLNLDC 595

>ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1429118..1432030) [2913 bp, 970 aa]
          Length = 970

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 23 CWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSPSI 63
          C  CR  K KCD  KP C RC K+ ++C  YDI+ + +P +
Sbjct: 32 CQACRKSKTKCDREKPRCSRCAKNNVKC-VYDIEKQRAPRV 71

>Kwal_26.7095
          Length = 838

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 38/74 (51%), Gaps = 13/74 (17%)

Query: 12 KEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSPSIKFNKFGQV 71
          K+ R  ++F  C  C+ RK+KCD  +P+C RC K  LEC  YD         + NK G+ 
Sbjct: 20 KKSRMRQSFV-CRNCKKRKIKCDKARPSCGRCSKLELEC-VYD--------FQENKDGR- 68

Query: 72 DSNGSPANGTEEPQ 85
             G P  GT + Q
Sbjct: 69 --RGLPGPGTLQEQ 80

>CAGL0K11902g complement(1148381..1150876) similar to sp|P40971
           Saccharomyces cerevisiae YDR034c LYS14 transcriptional
           activator of lysine pathway genes, hypothetical start
          Length = 831

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%)

Query: 8   DTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
           D +G  V+R  +  GC  C+ R++KCD  KP C +C +   +C
Sbjct: 189 DAEGNTVKRKYSRNGCAECKRRRMKCDESKPKCWQCTRLNRDC 231

>Kwal_23.3178
          Length = 611

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%)

Query: 18  KTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
           ++ TGCW CR RK KC   KP+C  C +  L+C
Sbjct: 540 RSRTGCWICRLRKKKCTEEKPSCHNCLRLNLQC 572

>KLLA0F09559g complement(876719..878695) some similarities with
           sgd|S0005698 Saccharomyces cerevisiae YOR172w,
           hypothetical start
          Length = 658

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 47/99 (47%), Gaps = 13/99 (13%)

Query: 4   RKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGL-EC---GGYDIKLR- 58
           + +S + GK  +R K    C  CR RK+KCD  +P C  C+  GL EC    GY+  +  
Sbjct: 71  KNASTSNGKVRKRRKVIKSCTFCRKRKLKCDRKRPMCTGCKMRGLSECVYTDGYNFDISH 130

Query: 59  ---WSPSIKFNKFGQVDS--NGSPANGTE---EPQSQRR 89
              ++ S       +++S        GTE   EP++ +R
Sbjct: 131 DDVYNKSPNLQLLNEIESLKQQLKVEGTEKHLEPETLKR 169

>CAGL0M12298g complement(1225753..1228737) similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor or sp|P52960
          Saccharomyces cerevisiae YOR363c PIP2, hypothetical
          start
          Length = 994

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 23 CWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSPSI 63
          C  CR  K +CD  KP C RC+K  LEC  YD+  + +P I
Sbjct: 27 CQACRRSKTRCDKEKPICTRCKKLKLEC-VYDMAKQSAPRI 66

>Scas_573.4
          Length = 1478

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%)

Query: 15 RRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWS 60
          +R +    C  CR RKVKCD  +P+CQ+C K+G+    + ++  W+
Sbjct: 35 KRNRVPLSCTICRKRKVKCDKIRPHCQQCTKTGVAHLCHYMEQSWA 80

>Kwal_26.6732
          Length = 676

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%)

Query: 18 KTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          ++ TGC TCR R+ KCD  KP C  CE + L+C
Sbjct: 7  RSVTGCLTCRKRRKKCDERKPVCTGCESNFLQC 39

>KLLA0D00484g 44879..47893 no similarity, hypothetical start
          Length = 1004

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query: 6  SSDTKGKEVRRVKTFT--GCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          SS+ K    +R  T++  GC  C+    KCD  KP C RCEK  ++C
Sbjct: 52 SSEEKLSTKKRKSTYSRKGCLQCKKAHTKCDERKPKCSRCEKRSIDC 98

>CAGL0F05357g 541830..543635 some similarities with sp|P39001
           Saccharomyces cerevisiae YDR207c UME6, hypothetical
           start
          Length = 601

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (61%)

Query: 17  VKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
            ++ TGCW CR RK KC   KP C  C++  L+C
Sbjct: 524 TRSRTGCWICRLRKKKCSEEKPACFNCQRLNLDC 557

>KLLA0A04169g complement(376273..378600) similar to sgd|S0004218
          Saccharomyces cerevisiae YLR228c ECM22, start by
          similarity
          Length = 775

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%)

Query: 6  SSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          S    GK     K+  GC  C+ R+VKCD  +P+C  C+K  L+C
Sbjct: 40 SKTATGKRKFHKKSKNGCDHCKRRRVKCDETRPHCLNCKKMSLDC 84

>KLLA0F00572g complement(42710..44503) some similarities with
          ca|CA2184|IPF6874.3 Candida albicans unknown function,
          3-prime end, hypothetical start
          Length = 597

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 24/37 (64%)

Query: 14 VRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          V + ++ TGC  CR RK KCD  KP C  C+++ LEC
Sbjct: 2  VIKKRSSTGCLICRRRKKKCDEVKPTCTACKRNFLEC 38

>AGR061C [4371] [Homologous to ScYLR098C (CHA4) - SH]
          (831058..832896) [1839 bp, 612 aa]
          Length = 612

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 11 GKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLR 58
          G +++++K    C TCR R+ KCDL  P C  C+K G+EC   D  LR
Sbjct: 4  GSDLKKLKL--ACQTCRKRRRKCDLQVP-CVNCQKFGVECLPVDQDLR 48

>YAL051W (OAF1) [17] chr1 (48565..51753) Transcription factor
           required for induction of SPS19 and POX1 on
           oleate-containing medium, plays a role in peroxisome
           proliferation [3189 bp, 1062 aa]
          Length = 1062

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 15  RRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSPSI 63
           +R +    C  C   K KCD  KP C RC K GL+C  YD+  + +P I
Sbjct: 58  KRNRILFVCQACWKSKTKCDREKPECGRCVKHGLKC-VYDVSKQPAPRI 105

>Kwal_56.24566
          Length = 755

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%)

Query: 15 RRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          +R ++  GC+TCR R+ KCD  +P C  C K  L+C
Sbjct: 24 KRNRSRAGCFTCRLRRKKCDEARPKCGTCSKHMLKC 59

>CAGL0B03421g complement(336071..340138) similar to sp|P12351
          Saccharomyces cerevisiae YLR256w HAP1 transcription
          factor, hypothetical start
          Length = 1355

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%)

Query: 15 RRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSPSIK 64
          +R +    C  CR RKVKCD  +P+C +C K+G+    + ++  W+   K
Sbjct: 15 KRNRIPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYMEQNWAQDAK 64

>CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces
           cerevisiae YLR256w HAP1 transcription factor,
           hypothetical start
          Length = 1372

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%)

Query: 23  CWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWS 60
           C  CR RKVKCD  +PNC +C K+G+    + ++  W+
Sbjct: 71  CTICRRRKVKCDKSRPNCTQCVKTGVAHLCHYMEQAWA 108

>ADR199C [1940] [Homologous to ScYDR421W (ARO80) - SH]
          (1048530..1051364) [2835 bp, 944 aa]
          Length = 944

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 8/53 (15%)

Query: 4  RKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLG------KPNCQRCEKSGLEC 50
          + S+   G++ RR+  +  C  CR+RKV+CDLG      +P C RC +   EC
Sbjct: 15 QSSNAGSGRKWRRI--YKACLNCRTRKVRCDLGPVDKPREPPCVRCSRERKEC 65

>CAGL0J07150g complement(686734..689802) similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor or sp|P52960
          Saccharomyces cerevisiae YOR363c PIP2, hypothetical
          start
          Length = 1022

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 29/61 (47%), Gaps = 1/61 (1%)

Query: 1  MKPRKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWS 60
          MK     D+     +R +    C  CR  K KCD  KP C RC K G+ C  YD+  + +
Sbjct: 1  MKYVDEGDSSDISKKRNRLSFVCQGCRKAKTKCDKEKPACSRCLKHGIRC-VYDLTSQKA 59

Query: 61 P 61
          P
Sbjct: 60 P 60

>Kwal_23.6529
          Length = 598

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 22 GCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRW 59
          GC  C+  K+KCD  KP C +C K G +   Y + L+W
Sbjct: 13 GCINCKKSKIKCDEKKPMCGQCAKKGRDDCAYALVLQW 50

>CAGL0L04400g complement(511762..514725) similar to tr|Q12340
          Saccharomyces cerevisiae YOR172w, hypothetical start
          Length = 987

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 5  KSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGY 53
          K+SD K +  +R K    C  CR RK+KCD  KP C  C +  L    Y
Sbjct: 20 KNSDCK-RPKKRFKPLKSCAFCRKRKLKCDKQKPRCSSCARRNLPVCVY 67

>Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement
          Length = 919

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 23/40 (57%)

Query: 15 RRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYD 54
          R+ ++   C  CR +K+KCD  KPNC  C+K G  C   D
Sbjct: 21 RQERSSQACDRCRLKKIKCDGLKPNCTSCKKVGFHCQTSD 60

>Kwal_55.20722
          Length = 827

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 2/44 (4%)

Query: 8  DTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECG 51
          D K   V R +    C  CR+RK+KCD  +P C RC+++ L C 
Sbjct: 2  DRKSPRVNRPRLV--CLECRNRKLKCDKARPKCTRCKQNLLTCS 43

>KLLA0A03443g 311628..314555 weakly similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor, start by similarity
          Length = 975

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 2  KPRKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSP 61
          K R+   + G   R+  +F  C  CR  K KCD  KP C RC K  L+C  YD++ +  P
Sbjct: 15 KSREDQTSNGACKRQRISFV-CQACRKNKTKCDREKPRCGRCVKYHLKC-VYDVEQQKPP 72

Query: 62 SI 63
           +
Sbjct: 73 RV 74

>KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1
          Kluyveromyces lactis Sip4 protein, start by similarity
          Length = 717

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 16 RVKTFT-GCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYD 54
          +VK F+  C  CR +K+KCD  KP+C  C+K G  C   D
Sbjct: 55 KVKRFSQACDRCRLKKIKCDGIKPSCSNCKKIGYHCSTSD 94

>CAGL0F03025g 295783..298569 similar to sp|Q04052 Saccharomyces
          cerevisiae YDR421w positive transcription regulator of
          ARO9 and ARO10, hypothetical start
          Length = 928

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 36/77 (46%), Gaps = 15/77 (19%)

Query: 6  SSDTKGKEVRRVKTFTGCWTCRSRKVKCDLG------KPNCQRCEKSGLECGGYDIKLRW 59
          SS ++G+  +   TF  C  C+ +K+KCDLG       P C  C +S   C         
Sbjct: 23 SSSSQGQ--KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC------FFN 74

Query: 60 SPSIKFNKFGQV-DSNG 75
          +P +K  K G + DS G
Sbjct: 75 APKVKIGKLGNILDSQG 91

>Scas_556.6
          Length = 1022

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 30/63 (47%), Gaps = 7/63 (11%)

Query: 6  SSDTKGKEVRRVK-----TFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWS 60
          SS   G   R++K     +F  C  CR  K KCD  KP C RC K  L C  YD+  +  
Sbjct: 25 SSPAAGGSNRQIKKRNRISFV-CQECRKAKTKCDKEKPACTRCVKQNLAC-VYDVAKQPP 82

Query: 61 PSI 63
          P I
Sbjct: 83 PRI 85

>ABL099W [493] [Homologous to ScYDR034C (LYS14) - SH]
           complement(212832..215234) [2403 bp, 800 aa]
          Length = 800

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%)

Query: 12  KEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
           K  +R  +  GC  C+ R++KCD GKP C +C +   EC
Sbjct: 186 KRTKRKYSRNGCTECKRRRMKCDEGKPICWQCSRLNREC 224

>Kwal_14.2619
          Length = 1167

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 36/73 (49%), Gaps = 7/73 (9%)

Query: 21 TGCWTCRSRKVKCDLGKPNCQRC--EKSGLECGGYDIKLRWSPSIKFNKFGQVDSNGSPA 78
          T C TCR RKVKCD  KP C  C   KS  EC  Y++K      +KF       S+ S  
Sbjct: 10 TSCLTCRRRKVKCDRSKPVCLACIKYKSISEC-SYEVK----RGVKFLHMVYSASSASEN 64

Query: 79 NGTEEPQSQRRNV 91
           G +  +S+ R +
Sbjct: 65 AGNKVSKSRTRKL 77

>YMR280C (CAT8) [4234] chr13 complement(827027..831328)
           Transcription factor required for derepression of
           gluconeogenic enzymes, contains an N-terminal
           Zn[2]-Cys[6] fungal-type binuclear cluster domain [4302
           bp, 1433 aa]
          Length = 1433

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%)

Query: 22  GCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLR 58
            C  CRS+K +CD  +P C +C   G EC   D  LR
Sbjct: 69  ACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLR 105

>Kwal_55.20674
          Length = 252

 Score = 41.2 bits (95), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 1/45 (2%)

Query: 6  SSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          S  TK  + R    FT C +CR RK KC   KP CQRC +  + C
Sbjct: 5  SRATKMGKDRSGAMFT-CKSCRQRKRKCSREKPQCQRCARLSIPC 48

>KLLA0A06039g 557368..559341 weakly similar to sp|P36023
          Saccharomyces cerevisiae YKR064w singleton, start by
          similarity
          Length = 657

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 17/28 (60%)

Query: 23 CWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          C  CR RK KCD GKP+C  C K G  C
Sbjct: 21 CLNCRRRKTKCDRGKPSCSNCLKLGETC 48

>KLLA0D11286g complement(964642..966678) no similarity,
          hypothetical start
          Length = 678

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 26/49 (53%)

Query: 5  KSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGY 53
          KS+    +++ R +T   C  C S K KCD  KP+C RC K  L C  +
Sbjct: 8  KSAKEIKEQIVRKRTPKSCIRCYSIKRKCDHKKPSCTRCFKKSLPCEYF 56

>Scas_721.94
          Length = 869

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%)

Query: 4  RKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          + S+ + GK     K+  GC  C+ R+VKCD  KP C+RC    + C
Sbjct: 36 KVSATSTGKRKFHNKSKQGCTHCKRRRVKCDELKPACRRCLNWNVPC 82

>YOR363C (PIP2) [5140] chr15 complement(1020218..1023208)
          Transcription factor required for induction of
          peroxisomal proteins in response to oleic acid [2991
          bp, 996 aa]
          Length = 996

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 21/39 (53%), Gaps = 1/39 (2%)

Query: 23 CWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSP 61
          C  CR  K KCD  KP C RC K  L C  YD+  + +P
Sbjct: 25 CQACRKAKTKCDQEKPRCGRCTKQNLFC-IYDVARQAAP 62

>Scas_661.23
          Length = 741

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 7   SDTKGKE---VRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
           SDT  K+   V+R  +  GC  C+ R++KCD  KP C +C +   EC
Sbjct: 113 SDTNAKKTNIVKRKYSRNGCAECKRRRMKCDETKPICWQCARLSREC 159

>KLLA0A03421g 308414..311056 weakly similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor, start by similarity
          Length = 880

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 3/61 (4%)

Query: 1  MKPRKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWS 60
          M+  + ++ K K  +R K    C  CR  K KCD  KP+C RC++    C  YD++ +  
Sbjct: 1  METNQEANLKAK--KRYKLSFVCQLCRKSKTKCDRKKPSCARCQRLNKPC-IYDLEYQPL 57

Query: 61 P 61
          P
Sbjct: 58 P 58

>KLLA0D05038g 433653..435674 weakly similar to sp|P40971
          Saccharomyces cerevisiae YDR034c LYS14 transcriptional
          activator of lysine pathway genes singleton, start by
          similarity
          Length = 673

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%)

Query: 6  SSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          S+ T+  + +R  +  GC  C+ +KVKCD  KP C +C    LEC
Sbjct: 11 SNVTEPAKKKRKYSKNGCLECKRKKVKCDETKPMCWQCTHLSLEC 55

>CAGL0D03850g 384689..387193 weakly similar to sp|Q06639
          Saccharomyces cerevisiae YDR303c RSC3 or sp|P38781
          Saccharomyces cerevisiae YHR056c, hypothetical start
          Length = 834

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 19/33 (57%)

Query: 15 RRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSG 47
          ++VK    C  CR RK+ CD GKP C  C K G
Sbjct: 8  KKVKKPPACQQCRRRKIGCDRGKPICGNCLKQG 40

>Scas_588.11
          Length = 835

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 8  DTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGL-ECGGYDIKLRWSPS 62
          D +G+++R+      C  CR RK+ CD  KP C  C K+   +C   DI  R+ P+
Sbjct: 2  DIRGRKMRKP---PACVQCRKRKIGCDRVKPICGNCRKTNKGDCFFPDIPGRYVPA 54

>YLR266C (PDR8) [3660] chr12 complement(675621..677726)
          Zn[2]-Cys[6] zinc finger transcription factor, likely
          involved in pleiotropic drug response [2106 bp, 701 aa]
          Length = 701

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 4/45 (8%)

Query: 3  PRKSSD----TKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRC 43
          P KS+     + GK+ +R K    C  CR RK+KC   +P CQ+C
Sbjct: 7  PMKSTTGEPVSSGKKGKRRKVIKSCAFCRKRKLKCSQARPMCQQC 51

>KLLA0F22880g 2123577..2127071 some similarities with
          ca|CA3639|IPF9251 Candida albicans unknown function,
          hypothetical start
          Length = 1164

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 3/39 (7%)

Query: 22 GCWTCRSRKVKCDLGKPNCQRCEKSG--LECGGYDIKLR 58
           C  CR RKV+CD  KP C  C K G  +EC  Y+++ R
Sbjct: 8  SCLVCRRRKVRCDRAKPVCLVCVKHGSNMEC-NYEVQKR 45

>YLR014C (PPR1) [3432] chr12 complement(172267..174981)
          Transcription factor regulating pyrimidine pathway,
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region [2715 bp, 904 aa]
          Length = 904

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%)

Query: 18 KTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYD 54
          K+ T C  CR +K+KCD   P+C+RC K  + C   D
Sbjct: 29 KSRTACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLD 65

>KLLA0F19602g complement(1814949..1816760) similar to sp|P43634
          Saccharomyces cerevisiae YLR098c CHA4 transcription
          factor, start by similarity
          Length = 603

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 3/45 (6%)

Query: 6  SSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          S+ T GK  R+ K    C  CR ++ KCD+ +P C  C K G+EC
Sbjct: 2  STITDGK--RKRKAHLACQNCRIKRRKCDMERP-CSNCLKYGIEC 43

>KLLA0A01804g complement(159689..162526) similar to sgd|S0002829
          Saccharomyces cerevisiae YDR421w positive transcription
          regulator of ARO9 and ARO10, start by similarity
          Length = 945

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 13/77 (16%)

Query: 7  SDTKGKEVRRVKTFTGCWTCRSRKVKCDLGK------PNCQRCEKSGLEC-------GGY 53
          S T  K+    + +  C  C+ RKVKCDLG       P C RC++   EC       GG+
Sbjct: 8  SQTAPKKQTFKRGYKACLNCKMRKVKCDLGPFDNPHGPPCVRCKRESRECMFTETKRGGF 67

Query: 54 DIKLRWSPSIKFNKFGQ 70
           +  +   S+K    G+
Sbjct: 68 RVAKQSLVSLKEESAGK 84

>Kwal_47.17233
          Length = 948

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 37/89 (41%), Gaps = 24/89 (26%)

Query: 15  RRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC-------------GGYDIKLRWS- 60
           RR +    C  C  RK+KC    P+C +C K   EC              G ++K+  S 
Sbjct: 27  RRQRKILSCVPCHKRKIKCTRETPSCSKCLKKNWECSYFLNDRISRGGHSGMEVKVENSD 86

Query: 61  PSIKFNKFGQVDSNGSPANGTEEPQSQRR 89
           P +  NK          ANGT +P  +++
Sbjct: 87  PEVLANK----------ANGTSDPLKKKQ 105

>Scas_625.5
          Length = 1141

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 15  RRVKTFTGCWTCRSRKVKCDLG--KPNCQRCEKSGLECGGYDIKLRWSPS 62
           +R K    C  CR +K+KCD    K  C  C+++G +C    + L+  PS
Sbjct: 67  KRTKASRACDQCRKKKIKCDFSEEKTLCSNCQRNGEKCTFERVPLKRGPS 116

>CAGL0D02904g complement(302952..305615) similar to sp|P07272
          Saccharomyces cerevisiae YLR014c PPR1 transcription
          factor regulating pyrimidine pathway, hypothetical
          start
          Length = 887

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 9/55 (16%)

Query: 9  TKGKE---------VRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYD 54
          TKGK+         V+  K    C  CR +KVKCD G P+C+ C ++ + C   D
Sbjct: 2  TKGKKRVSKPVPGGVKFTKFPNACKLCRRKKVKCDQGYPSCKGCLRNNVPCVSVD 56

>KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyces
           lactis Cat8p, start by similarity
          Length = 1445

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 22  GCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
            C  CR++K++CD  +P C +C   G EC
Sbjct: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210

>AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH]
          (260414..263032) [2619 bp, 872 aa]
          Length = 872

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 2/46 (4%)

Query: 7  SDTKGKEVR-RVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGL-EC 50
          +++ GK V+ R K    C  CR R+VKC+  +P C  C   GL EC
Sbjct: 2  AESDGKIVKTRRKVSKSCVFCRKRRVKCNKARPKCSTCIGKGLPEC 47

>Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement
          Length = 718

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 2/45 (4%)

Query: 8  DTKGKEVR-RVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGL-EC 50
          D++   +R R K    C  CR RK+KCD  KP C  C    L EC
Sbjct: 3  DSQASVIRKRRKVIKSCLFCRKRKLKCDHKKPKCSTCAARNLPEC 47

>ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH]
           (170784..174641) [3858 bp, 1285 aa]
          Length = 1285

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 22  GCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
            C  CRS+K +CD  +P C +C   G EC
Sbjct: 77  ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105

>Scas_699.7
          Length = 935

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 22 GCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSP 61
           C  CR +K+KC   KP C +C K+  EC  Y  K R SP
Sbjct: 12 ACDLCRVKKLKCSKEKPKCAKCLKNNWEC-CYSPKTRRSP 50

>Scas_696.44
          Length = 1164

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 18/33 (54%)

Query: 22  GCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYD 54
            C  CRS+K +CD  +P C +C   G EC   D
Sbjct: 80  ACDRCRSKKTRCDGKRPQCSQCAIVGFECKISD 112

>KLLA0F18084g complement(1652031..1654613) no similarity,
          hypothetical start
          Length = 860

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 17/29 (58%)

Query: 22 GCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
           C  CR  + KCD GKP C RC K  ++C
Sbjct: 4  SCQNCRKTRRKCDRGKPTCARCIKYKIDC 32

>KLLA0E19701g complement(1739869..1741914) some similarities with
          sp|P26370 Saccharomyces cerevisiae YDL170w UGA3
          transcriptional activator for GABA catabolic genes
          singleton, hypothetical start
          Length = 681

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 25/42 (59%)

Query: 9  TKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          ++G+  RR  +  GC TC+ RK +C   +P C+ C +  L+C
Sbjct: 6  SEGEPKRRRHSKKGCLTCKVRKKRCSEDRPICKDCARLSLDC 47

>CAGL0E05434g 532577..535027 similar to sp|P47988 Saccharomyces
           cerevisiae YOR337w TEA1 TY1 enhancer activator,
           hypothetical start
          Length = 816

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 15  RRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLR 58
           R  K    C  CR R+ KCDL  P C  C+K GLEC   +  LR
Sbjct: 68  RPTKKRLACSNCRRRRKKCDLQYP-CFTCDKLGLECNINEEDLR 110

>Kwal_56.24670
          Length = 643

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 3/43 (6%)

Query: 8  DTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          +T GK   R    TGC  C+ RK +C   KP C  CE+ G  C
Sbjct: 15 NTVGKRTHRK---TGCIPCKIRKKRCSEHKPTCTDCERLGFTC 54

>KLLA0C16489g 1444456..1446642 some similarities with
          ca|CA2184|IPF6874.3 Candida albicans unknown function,
          3-prime end, hypothetical start
          Length = 728

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 22/30 (73%)

Query: 21 TGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          +GC+TCR +++KCD   P C RC+++ L C
Sbjct: 41 SGCFTCRLKRMKCDEQHPICGRCKRNLLTC 70

>YHR056C (RSC30) [2344] chr8 complement(215184..217835) Component
          of the abundant RSC chromatin remodeling complex [2652
          bp, 883 aa]
          Length = 883

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 19/33 (57%)

Query: 13 EVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEK 45
          +VR+V+    C  CR RK+ CD  KP C  C K
Sbjct: 5  QVRKVRKPPACTQCRKRKIGCDRAKPICGNCVK 37

>Kwal_23.6425
          Length = 735

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 15 RRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGL-EC 50
          +R K+   C  CR RK+KCD  +P C  C   GL EC
Sbjct: 28 KRRKSIKQCLFCRKRKLKCDKNRPVCGTCASRGLTEC 64

>Scas_521.2
          Length = 890

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%)

Query: 18 KTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYD 54
          K+ + C  CRS+K+KCD   P+C RC    + C   D
Sbjct: 36 KSKSACKRCRSKKIKCDQKFPSCDRCAHLKVPCVSVD 72

>YOR172W (YRM1) [4969] chr15 (654210..656570) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [2361 bp, 786 aa]
          Length = 786

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 22/42 (52%)

Query: 6  SSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSG 47
          S +T  K  +R K    C  CR RK++CD  KP C  C+  G
Sbjct: 14 SEETVKKAQKRRKPIKSCAFCRKRKLRCDQQKPMCSTCKTRG 55

>Scas_720.58
          Length = 890

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 22 GCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSP 61
           C  CR +K+KC    P C +C K+G++C  Y  K++ SP
Sbjct: 19 ACDNCRLKKLKCSKETPKCSKCLKNGMKC-LYSPKVKRSP 57

>YBL066C (SEF1) [131] chr2 complement(96906..100079) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [3174 bp, 1057 aa]
          Length = 1057

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 3/36 (8%)

Query: 18 KTFTGCWTCRSRKVKCDLGK--PN-CQRCEKSGLEC 50
          +  T C  CR  K+KCD  +  P+ C RCEK GL C
Sbjct: 52 RPVTSCTHCRQHKIKCDASQNFPHPCSRCEKIGLHC 87

>Kwal_27.10232
          Length = 1209

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 22  GCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
            C  CRS+K +CD  +P C +C   G EC
Sbjct: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101

>KLLA0D12650g complement(1073580..1075535) weakly similar to
          ca|CA2184|IPF6874.3 Candida albicans unknown function,
          3-prime end, hypothetical start
          Length = 651

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 26/50 (52%), Gaps = 3/50 (6%)

Query: 5  KSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYD 54
          KSS T   E R  +   GC TCR R  KCD  KP C  C+++ L C   D
Sbjct: 17 KSSATTLVEKRSSR---GCLTCRDRHKKCDEKKPLCSGCKENFLRCVWRD 63

>ACL058W [991] [Homologous to NOHBY] complement(261723..264176)
          [2454 bp, 817 aa]
          Length = 817

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 20/39 (51%)

Query: 15 RRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGY 53
          +R +    C  C  RKVKC+  +P C  CEK+   C  +
Sbjct: 30 KRQRRVLNCMPCHKRKVKCNRARPVCDHCEKNRYACAYF 68

>CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces
          cerevisiae YGL013c PDR1 transcription factor,
          hypothetical start
          Length = 1107

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 32/68 (47%), Gaps = 3/68 (4%)

Query: 15 RRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSPSIKFNKFGQVDSN 74
          RR K    C +CR RK+KC+  KP C  C   G EC   D K   + ++K N  G+    
Sbjct: 23 RRTKVGKACDSCRRRKIKCNGLKP-CPSCTIYGCECTYTDAK--STKNLKSNDAGKSKPT 79

Query: 75 GSPANGTE 82
          G  +   E
Sbjct: 80 GRVSKNKE 87

>YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional
          activator of gluconeogenic genes through CSRE elements,
          activated by Snf1p kinase, contains a Zn[2]-Cys[6]
          fungal-type binuclear cluster domain [2490 bp, 829 aa]
          Length = 829

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 22/52 (42%)

Query: 3  PRKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYD 54
          P   S +       V+    C  CR +K+KCD  KPNC  C K    C   D
Sbjct: 26 PTGQSSSNAITDFSVRKAHACDRCRLKKIKCDGLKPNCSNCAKIDFPCKTSD 77

>AFR171W [3363] [Homologous to NOHBY] complement(752592..754430)
          [1839 bp, 612 aa]
          Length = 612

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 21/41 (51%)

Query: 10 KGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          KG   R   +  GC  C+ RKVKCD  KP C +C   G  C
Sbjct: 9  KGVARRSKYSKNGCSECKRRKVKCDETKPACWQCSHLGKRC 49

>AGL206C [4106] [Homologous to NOHBY] (311846..314053) [2208 bp,
          735 aa]
          Length = 735

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 6/39 (15%)

Query: 22 GCWTCRSRKVKCDLGKPNCQRCEKSGLEC------GGYD 54
          GC TCR+R+ KCD  +P C  C+++ L C      G YD
Sbjct: 49 GCLTCRARRKKCDETRPKCIGCQRNLLLCHWADDDGNYD 87

>Kwal_34.15751
          Length = 628

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%)

Query: 23 CWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          C  CR RK+KC+  KP+C RC K  L+C
Sbjct: 15 CDACRIRKLKCNKQKPSCSRCVKHDLQC 42

>AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH]
          complement(606993..609551) [2559 bp, 852 aa]
          Length = 852

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 22 GCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYD 54
           C  CR +K+KCD  +P+C  C+K G +C   D
Sbjct: 28 ACDRCRLKKIKCDGLRPSCTSCKKIGYQCKTSD 60

>KLLA0F02387g complement(213669..215852) similar to sp|P47988
          Saccharomyces cerevisiae YOR337w TEA1 TY1 enhancer
          activator, start by similarity
          Length = 727

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 22 GCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLR 58
           C  CR R+ KCDL  P C RC++ GL C    + LR
Sbjct: 40 ACANCRRRRKKCDLEYP-CGRCQELGLGCNINKVDLR 75

>YLL054C (YLL054C) [3369] chr12 complement(32894..35203) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [2310 bp, 769 aa]
          Length = 769

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 4/53 (7%)

Query: 15 RRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDI---KLRWSPSIK 64
          ++VK    C  C+ RK+KCD   P C +C+ S   C  Y++   ++  SP+I+
Sbjct: 7  KKVKPSFVCLRCKQRKIKCDKLWPTCSKCKASSSIC-SYEVEPGRINKSPTIE 58

>Scas_590.2
          Length = 1172

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 21 TGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          T C  CR RK KCD   P+C  C K+ ++C
Sbjct: 39 TACLLCRRRKQKCDHQLPSCTACLKAAVKC 68

>KLLA0D10153g 858016..859983 weakly similar to sp|P35995
          Saccharomyces cerevisiae YKL222c, hypothetical start
          Length = 655

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 22 GCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLR 58
           C  C+ RK KCD   P+C  C K G EC  Y++ L+
Sbjct: 11 SCLMCQRRKKKCDRKAPSCSACLKKGYEC-IYNVNLQ 46

>YDR303C (RSC3) [1131] chr4 complement(1068721..1071378) Component
          of the abundant RSC chromatin remodeling complex [2658
          bp, 885 aa]
          Length = 885

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 8  DTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEK-SGLECGGYDIKLRWSP 61
          D +G   R++K    C  CR RK+ CD  KP C  C K + ++C   D+  ++ P
Sbjct: 2  DIRG---RKMKKPPACVQCRKRKIGCDRVKPICGNCMKHNKMDCFYPDVPGQYVP 53

>YLR278C (YLR278C) [3671] chr12 complement(700001..704026) Protein
          with similarity to transcription factors, contains an
          N-terminal Zn[2]-Cys[6] fungal-type binuclear cluster
          domain [4026 bp, 1341 aa]
          Length = 1341

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%)

Query: 22 GCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
           C  CR RK +CD   P+C  C K+G++C
Sbjct: 40 SCLLCRRRKQRCDHKLPSCTACLKAGIKC 68

>Kwal_47.17681
          Length = 854

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 7  SDTKGKEVRRVKTFTGCWTCRSRKVKCDLG-KPNCQRCEKSGLECGGYDIK 56
          ++  G  VR+ +T   C  C  RKV+CD   +  C  C+  GL C   D+K
Sbjct: 3  TERSGYRVRKPRTNRACEVCHDRKVRCDANIRVPCTSCQTFGLVCRLRDVK 53

>KLLA0F10835g 997512..999782 no similarity, hypothetical start
          Length = 756

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 22/40 (55%)

Query: 11 GKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          GK+ +   +  GC  C+   +KCD G+P C +C K  + C
Sbjct: 12 GKKRKTRYSRKGCLQCKRSHLKCDEGQPKCGKCVKRNISC 51

>Scas_550.5*
          Length = 832

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 25/41 (60%)

Query: 10 KGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          + K +R  +    C  CR++K++C+  +P+C RC++ G  C
Sbjct: 2  QKKSIRGQRPTHVCAACRTQKLRCNRERPSCSRCQRIGRTC 42

>Kwal_26.8109
          Length = 970

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 28/64 (43%), Gaps = 2/64 (3%)

Query: 13 EVRRVKTFTGCWTCRSRKVKCDLG--KPNCQRCEKSGLECGGYDIKLRWSPSIKFNKFGQ 70
          E RR KT   C  CR +K +CD     P C  C++    C    + ++  P+  + +  +
Sbjct: 29 ERRRSKTSRACDQCRGKKTRCDFSDENPVCTSCQRMSKTCTFERVPMKRGPTKGYTRANE 88

Query: 71 VDSN 74
             N
Sbjct: 89 APEN 92

>Scas_711.31
          Length = 932

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (58%)

Query: 17 VKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          +K    C  CR +K+KCD   P+C  C K+G+ C
Sbjct: 39 IKRKQACDRCRLKKIKCDDRTPDCTPCMKAGIPC 72

>KLLA0E20405g <1805948..1809364 gi|3024604|sp|P87164|SEF1_KLULA
           Kluyveromyces lactis SUPPRESSOR PROTEIN SEF1, start by
           similarity
          Length = 1138

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 5/47 (10%)

Query: 9   TKGKEVRRV--KTFTGCWTCRSRKVKCDLGK---PNCQRCEKSGLEC 50
           +KGK V     +  T C  CR  K+KC+  +     C RCE+ GL C
Sbjct: 121 SKGKAVVNAGHRPVTSCTHCRQHKIKCNASEKFPAPCSRCERMGLHC 167

>YPL248C (GAL4) [5202] chr16 complement(79711..82356)
          Transcription factor involved in expression of
          galactose-induced genes, phosphorylation correlates
          with activity [2646 bp, 881 aa]
          Length = 881

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 7/43 (16%)

Query: 22 GCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSPSIK 64
           C  CR +K+KC   KP C +C K+  EC       R+SP  K
Sbjct: 10 ACDICRLKKLKCSKEKPKCAKCLKNNWEC-------RYSPKTK 45

>Kwal_23.2905
          Length = 881

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 19/37 (51%)

Query: 18 KTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYD 54
          ++   C  CR RKVKCD   P+C RC  +   C   D
Sbjct: 44 RSIAACKRCRIRKVKCDQKFPSCSRCVSANEPCVSID 80

>Sklu_1973.1 YDR303C, Contig c1973 815-3148 reverse complement
          Length = 777

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 3/40 (7%)

Query: 8  DTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSG 47
          D +G   R++K    C  CR RK+ CD  KP C  C ++G
Sbjct: 4  DIRG---RKMKKPPACVQCRKRKIGCDRAKPICGNCLRNG 40

>CAGL0H00396g complement(37005..39827) similar to sp|P08638
          Saccharomyces cerevisiae YLR451w LEU3 transcription
          factor, hypothetical start
          Length = 940

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 3/51 (5%)

Query: 3  PRKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDL---GKPNCQRCEKSGLEC 50
          P +SS T G +  + K    C  CR +K KCD        C RC+K G+ C
Sbjct: 38 PPQSSPTNGSKKPKKKKRVACVECRQQKSKCDAHDKAPEPCTRCQKKGVPC 88

>YKL038W (RGT1) [3220] chr11 (365248..368760) Protein involved in
          regulation of glucose transporters, acts as a
          transcriptional repressor that is converted to an
          activator upon glucose-induced phosphorylation [3513
          bp, 1170 aa]
          Length = 1170

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 15 RRVKTFTGCWTCRSRKVKCDLG--KPNCQRCEKSGLECGGYDIKLRWSPSIKFNK 67
          +R K    C  CR +K+KCD    K  C  C+++G  C    + L+  PS  + +
Sbjct: 39 KRTKASRACDQCRKKKIKCDYKDEKGVCSNCQRNGDRCSFDRVPLKRGPSKGYTR 93

>Sklu_2301.1 , Contig c2301 1246-2795 reverse complement
          Length = 517

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 19/37 (51%)

Query: 18 KTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYD 54
          ++   C  CR++K KCD   P+C RC   G  C   D
Sbjct: 35 RSIVACERCRTKKTKCDQNFPSCARCASLGEPCISVD 71

>AAL057C [130] [Homologous to ScYDR303C (RSC3) - SH; ScYHR056C
          (RSC30) - SH] (246899..249328) [2430 bp, 809 aa]
          Length = 809

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 15 RRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSG 47
          R++K    C  CR RK+ CD  KP C  C ++G
Sbjct: 8  RKMKKPPACVQCRKRKIGCDRAKPLCGNCVRNG 40

>Scas_659.10
          Length = 757

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 15 RRVKTFTGCWTCRSRKVKCDLGKPNCQRC 43
          RR K    C  CR RK+KCD  KP C +C
Sbjct: 13 RRRKPIKSCAFCRGRKLKCDKNKPICNQC 41

>KLLA0C04620g complement(422705..426514) weakly similar to
          sp|Q05854 Saccharomyces cerevisiae YLR278c, start by
          similarity
          Length = 1269

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 5/38 (13%)

Query: 22 GCWTCRSRKVKCDLGKPNCQRCEKSGLEC-----GGYD 54
           C  C+ RK KCD   P+C  C K+G++C      GYD
Sbjct: 40 ACLLCQRRKQKCDHKIPSCTACLKAGVKCIQPAKYGYD 77

>AGR369W [4680] [Homologous to ScYBL066C (SEF1) - SH]
           complement(1412347..1415502) [3156 bp, 1051 aa]
          Length = 1051

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 3/36 (8%)

Query: 18  KTFTGCWTCRSRKVKCDLGK---PNCQRCEKSGLEC 50
           +  T C  CR  K+KC+  +    +C RCE+ GL+C
Sbjct: 87  RPVTSCTHCRQHKIKCNASENFPSSCSRCERMGLQC 122

>CAGL0I07755g complement(745315..748476) similar to tr|Q12180
           Saccharomyces cerevisiae YOL089c HAL9, hypothetical
           start
          Length = 1053

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 5/42 (11%)

Query: 12  KEVRRVKTFTGCWTCRSRKVKCDLGKP---NCQRCEKSGLEC 50
           KE RR      C  CR RK KCD   P    C  C K+G++C
Sbjct: 169 KEKRRAAK--ACEYCRKRKTKCDEVSPYTNKCSNCSKAGVDC 208

>KLLA0D09977g complement(841852..843756) weakly similar to
          sp|P40969 Saccharomyces cerevisiae YMR168c CEP3
          kinetochore protein complex, 71 KD subunit singleton,
          start by similarity
          Length = 634

 Score = 37.7 bits (86), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 27/55 (49%), Gaps = 9/55 (16%)

Query: 1  MKPRKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRC-EKSGLECGGYD 54
          M   K S TKGK          C  C++RKVKCD   P CQ C E++  E   YD
Sbjct: 1  MSKPKISLTKGKH--------PCTFCQARKVKCDRSLPACQNCIERNVTELCEYD 47

>AGL083W [4228] [Homologous to ScYKL038W (RGT1) - SH; ScYBR033W
           (EDS1) - NSH] complement(550291..552861) [2571 bp, 856
           aa]
          Length = 856

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 3/75 (4%)

Query: 4   RKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGK--PNCQRCEKSGLECGGYDIKLRWSP 61
           R S ++ G   RR K    C  CR +K+KC+  +   +C  C K+   C    + L+  P
Sbjct: 27  RDSVESAGDGRRRTKVSRACDQCRRKKIKCEYQEDAQSCSGCRKNSERCAFERVPLKRGP 86

Query: 62  SIKFNKFGQVDSNGS 76
           S  + + G+   +G+
Sbjct: 87  SKGYTR-GEGAGDGA 100

>ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp,
          601 aa]
          Length = 601

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 10/50 (20%)

Query: 1  MKPRKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          MK RKS  ++           GC  C+    KCD  KP C +C K  +EC
Sbjct: 9  MKKRKSPYSRK----------GCLQCKKSHTKCDETKPACLKCVKRNVEC 48

>KLLA0E18194g 1613115..1615712 similar to sp|P25502 Saccharomyces
          cerevisiae YKL015w PUT3 positive activator of the
          proline utilisation pathway, start by similarity
          Length = 865

 Score = 37.4 bits (85), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 3/41 (7%)

Query: 10 KGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          K K+V+R  +   C  CR R +KC  G P C +C K+G+ C
Sbjct: 35 KKKKVKR--SSLACTRCRRRHIKCPGGNP-CSKCLKAGVAC 72

>Scas_715.3
          Length = 1115

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 6/47 (12%)

Query: 18  KTFTGCWTCRSRKVKCDLGK---PNCQRCEKSGLECGGYDIKLRWSP 61
           +  T C  CR +K+KCD  +     C RC+K  L+C    I  R+ P
Sbjct: 101 RPVTSCSHCRQQKIKCDASQNFPAPCSRCQKMALQC---QIDPRFKP 144

>KLLA0E14036g complement(1239566..1241602) some similarities with
          ca|CA4758|CaPPR1 Candida albicans transcription factor
          regulating pyrimidine pathway (by homology),
          hypothetical start
          Length = 678

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 20/40 (50%)

Query: 15 RRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYD 54
          RR      C  C+ R+ +CD G P C  C  +G++C   D
Sbjct: 59 RRKNQGVACCFCKRRRKRCDGGFPQCGACVNAGIQCTFVD 98

>Scas_688.17
          Length = 769

 Score = 37.4 bits (85), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 17/38 (44%)

Query: 8  DTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEK 45
          D      R+ K    C  CR RK+ CD G P C  C K
Sbjct: 2  DPNNIPTRKPKKNPACIQCRKRKIGCDRGHPKCGNCIK 39

>Scas_542.8
          Length = 902

 Score = 37.4 bits (85), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 2/44 (4%)

Query: 7  SDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          ++T+    RR K+   C  CR R +KC  G P C RC K  L+C
Sbjct: 14 NNTEPSSKRRPKSL-ACILCRKRHIKCSGGNP-CARCIKHDLKC 55

>KLLA0F13904g complement(1287758..1289497) some similarities with
          sp|P42950 Saccharomyces cerevisiae YJL103c,
          hypothetical start
          Length = 579

 Score = 37.0 bits (84), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 9  TKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGL 48
          T  +++ R    T C  C  + ++CDLG+P CQ C K G+
Sbjct: 6  TAQEKLNRKPIPTACVFCHEKHLQCDLGRP-CQNCSKRGI 44

>Scas_630.14
          Length = 701

 Score = 37.0 bits (84), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%)

Query: 5  KSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYD 54
          K++ +K    +R +    C  CR RK KCD  KP C  C   G++   YD
Sbjct: 8  KAAKSKDGIRKRNRVPKSCTVCRLRKSKCDRIKPYCSSCVLHGIKECRYD 57

>YOR337W (TEA1) [5116] chr15 (954339..956618) Ty1 enhancer activator
           of the Gal4p-type family of DNA-binding proteins [2280
           bp, 759 aa]
          Length = 759

 Score = 37.0 bits (84), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 22  GCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLR 58
            C  CR+R+ KCDLG P C  C +  L C   D  LR
Sbjct: 69  ACTNCRNRRKKCDLGFP-CGNCSRLELVCNVNDEDLR 104

>YCR106W (RDS1) [627] chr3 (310954..313452) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region, involved in resistance to cycloheximide [2499
          bp, 832 aa]
          Length = 832

 Score = 37.0 bits (84), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 22/37 (59%)

Query: 14 VRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          V++ +    C  C+  K KCD  +P C RC+++ L+C
Sbjct: 6  VKKPRLRLVCLQCKKIKRKCDKLRPACSRCQQNSLQC 42

>KLLA0A09119g complement(797533..800781) weakly similar to
          sp|P12383 Saccharomyces cerevisiae YGL013c PDR1
          transcription factor, start by similarity
          Length = 1082

 Score = 37.0 bits (84), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 3  PRKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          PR S+     + RR K    C +CR +K+KC  G   C+ CE  G EC
Sbjct: 36 PRDSNGNGTGKPRR-KVSRACDSCRKKKIKCS-GTLPCKSCETYGCEC 81

>YKL015W (PUT3) [3241] chr11 (408187..411126) Transcription factor
          that activates the proline utilization pathway genes,
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region [2940 bp, 979 aa]
          Length = 979

 Score = 37.0 bits (84), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 10 KGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          K  + R+ ++   C +CR R +KC  G P CQ+C  S   C
Sbjct: 21 KQPQKRQQRSSVACLSCRKRHIKCPGGNP-CQKCVTSNAIC 60

>CAGL0H01507g complement(147689..150073) similar to sp|Q06639
          Saccharomyces cerevisiae YDR303c RSC3, start by
          similarity
          Length = 794

 Score = 36.6 bits (83), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 15 RRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSG 47
          R++K    C  CR RKV CD  +P C  C ++G
Sbjct: 6  RKMKKPPACAQCRRRKVGCDRVRPVCGNCARAG 38

>Sklu_2321.3 YLR014C, Contig c2321 8747-11467
          Length = 906

 Score = 36.6 bits (83), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 19/37 (51%)

Query: 18 KTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYD 54
          ++   C  CR +KVKCD   P+C +C  +   C   D
Sbjct: 38 RSIAACKRCRLKKVKCDQKFPSCSKCASANEPCVSLD 74

>Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement
          Length = 687

 Score = 36.6 bits (83), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 6/55 (10%)

Query: 1  MKPRKSSDTK--GKE---VRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          M P K +D    GK+    +R++    C  C+ RK+KCD  +P C  C K+ ++C
Sbjct: 1  MDPSKYNDPSLYGKDNGSKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQC 54

>YOR162C (YRR1) [4961] chr15 complement(639560..641992)
          Transcription factor involved in drug-induced
          transcriptional regulation, including activation of
          multidrug transporter gene SNQ2, has a Zn[2]-Cys[6]
          fungal-type binuclear cluster domain [2433 bp, 810 aa]
          Length = 810

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 2/47 (4%)

Query: 7  SDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGY 53
          + T GK  +R K    C  CR RK++CD  KP C  C    L    Y
Sbjct: 40 TSTSGK--KRNKLIKSCGFCRRRKLRCDQQKPMCSTCISRNLTTCQY 84

>KLLA0C14212g complement(1229219..1232341) some similarities with
           sp|P25611 Saccharomyces cerevisiae YCR106w, hypothetical
           start
          Length = 1040

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 14  VRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
           ++R +    C+ CR RK +CD G P C +C     EC
Sbjct: 66  MKRNRVSYVCYACRRRKTRCDRGNP-CSKCVALSTEC 101

>CAGL0M03025g complement(341849..345613) similar to sp|P39113
          Saccharomyces cerevisiae YMR280c CAT8 transcription
          factor involved in gluconeogenesis, hypothetical start
          Length = 1254

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 15/29 (51%)

Query: 22 GCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
           C  CR +K KCD   P C +C   G EC
Sbjct: 59 ACDRCRLKKTKCDGKIPQCSQCALVGFEC 87

>CAGL0A04455g 432854..436150 similar to sp|P34228 Saccharomyces
           cerevisiae YBL066c SEF1, hypothetical start
          Length = 1098

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 3/36 (8%)

Query: 18  KTFTGCWTCRSRKVKCDLGK---PNCQRCEKSGLEC 50
           +  T C  CR  K+KCD  +     C RC K+G  C
Sbjct: 82  RPVTSCTHCRQHKIKCDASQNFPAPCTRCAKNGFHC 117

>AER183C [2685] [Homologous to ScYOL089C (HAL9) - NSH]
           (975879..978518) [2640 bp, 879 aa]
          Length = 879

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 9   TKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
           T+ K V R +    C  CR++K++C+ G+  C  CEK  L C
Sbjct: 67  TETKTVMRKRVSKACDICRAKKIRCN-GEEPCVNCEKFNLGC 107

>Sklu_2376.6 , Contig c2376 12573-15341 reverse complement
          Length = 922

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 15 RRVKTFTGCWTCRSRKVKCDLGKPNCQRC 43
          +R +T   C  C+ RK+KCD  +P C  C
Sbjct: 20 KRQRTTVVCTNCKKRKIKCDRKRPACSNC 48

>Scas_709.51
          Length = 759

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 12 KEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          ++ +R++    C  C+ RKVKCD  KP C  C K  ++C
Sbjct: 23 RKKQRIRVQRACNICKRRKVKCDGNKP-CLNCIKKEIDC 60

>KLLA0F25630g 2378464..2381487 some similarities with sp|P32862
           Saccharomyces cerevisiae YKL038w RGT1 regulator of
           glucose-induced genes, hypothetical start
          Length = 1007

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 7/60 (11%)

Query: 15  RRVKTFTGCWTCRSRKVKCDL-------GKPNCQRCEKSGLECGGYDIKLRWSPSIKFNK 67
           RR K    C  CR +K+KCD           +C  C K G +C    I L+  PS  + +
Sbjct: 109 RRSKVSRACDQCRKKKIKCDFIEGHDINPDQSCTGCRKIGEKCSFERIPLKRGPSKGYTR 168

>CAGL0L01903g 218703..222566 similar to sp|P32862 Saccharomyces
          cerevisiae YKL038w RGT1, hypothetical start
          Length = 1287

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 15 RRVKTFTGCWTCRSRKVKCDLGKPN--CQRCEKSGLECGGYDIKLRWSPS 62
          +R      C  CR +K+KCD  +    C  C+++G  C    + L+  PS
Sbjct: 8  KRTNVSRACDQCRRKKIKCDRNQERNICTSCQRNGERCKFERVPLKRGPS 57

>Scas_526.3
          Length = 1109

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 22 GCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
           C  CR RK +CD   P+C  C K+ ++C
Sbjct: 40 SCLLCRRRKQRCDHKMPSCTACLKAAVKC 68

>Scas_662.8
          Length = 906

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 4/48 (8%)

Query: 3  PRKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          PR+   T+ + V+R +    C  CR +KVKCD  +P C  C     EC
Sbjct: 20 PRQ---TEHQIVKRRRVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 63

>CAGL0G09757g 930351..934622 some similarities with sp|Q05854
          Saccharomyces cerevisiae YLR278c, hypothetical start
          Length = 1423

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 22 GCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
           C  CR RK +CD   P+C  C K+ ++C
Sbjct: 40 SCLLCRRRKQRCDHKLPSCTACLKAAVKC 68

>ADR365W [2106] [Homologous to ScYOR337W (TEA1) - SH]
          complement(1355410..1357515) [2106 bp, 701 aa]
          Length = 701

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 22 GCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLR 58
           C  CR R+ KCDL  P C  C +  LEC   D  LR
Sbjct: 46 ACTNCRRRRKKCDLNYP-CSSCLRLKLECNVNDEDLR 81

>CAGL0F02519g 245120..247618 weakly similar to sp|P39529
          Saccharomyces cerevisiae YJL206c, hypothetical start
          Length = 832

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 6/55 (10%)

Query: 1  MKPRK---SSD-TKGKEVRRVKTFT-GCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          MKP+    S D T  + V R +  +  C  C+ RK KC  G P CQ C K+ ++C
Sbjct: 9  MKPKLFVLSPDMTTNQLVARTQRLSRACDLCKKRKTKCQGGNP-CQSCRKANIQC 62

>YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding protein,
           contains a Zn[2]-Cys[6] fungal-type binuclear cluster
           domain in the N-terminal region [2850 bp, 949 aa]
          Length = 949

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 21/41 (51%), Gaps = 2/41 (4%)

Query: 16  RVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIK 56
           R++    C  C+ RKVKCD   P C  C K   EC  YD K
Sbjct: 80  RLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKEC-RYDFK 118

>Kwal_26.6664
          Length = 579

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%)

Query: 12 KEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLR 58
          K++ R +    C  C + K KC+  KP C RC +  L+C  Y  +LR
Sbjct: 4  KQITRNRPVKACIKCYNGKRKCNKAKPVCGRCARLHLQC-LYSAELR 49

>CAGL0L03377g complement(382932..386561) some similarities with
          sp|P46954 Saccharomyces cerevisiae YJL089w SIP4
          interacts with SNF1 protein kinase, hypothetical start
          Length = 1209

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 1/33 (3%)

Query: 22 GCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYD 54
           C  CRS+K+KCD  +P C  C K G  C   D
Sbjct: 28 ACDRCRSKKIKCDGLQP-CSNCAKIGYNCVTSD 59

>YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finger
          transcription factor, in conjunction with Pdr3p
          regulates the expression of a network of genes involved
          in multiple drug resistance [3207 bp, 1068 aa]
          Length = 1068

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 22/47 (46%), Gaps = 7/47 (14%)

Query: 16 RVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC------GGYDIK 56
          R K    C  CR RK+KC+ GK  C  CE    EC      GG  IK
Sbjct: 39 RSKVSKACDNCRKRKIKCN-GKFPCASCEIYSCECTFSTRQGGARIK 84

>YNR063W (YNR063W) [4646] chr14 (746940..748763) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [1824 bp, 607 aa]
          Length = 607

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 10 KGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRC 43
          + K+ R+      C  CR RK+KCD  KP C RC
Sbjct: 3  RSKDARKRSISLACTVCRKRKLKCDGNKP-CGRC 35

>CAGL0G08844g complement(846590..849133) similar to sp|P40467
          Saccharomyces cerevisiae YIL130w, hypothetical start
          Length = 847

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 1/39 (2%)

Query: 12 KEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          +E +R K    C  CR +KVKCD  +P C  C     EC
Sbjct: 9  QEGKRRKVTRACDDCRKKKVKCDGNQP-CIHCTVYSYEC 46

>ACR241C [1288] [Homologous to ScYKR064W - SH] (784358..786745)
          [2388 bp, 795 aa]
          Length = 795

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 28/62 (45%), Gaps = 5/62 (8%)

Query: 23 CWTCRSRKVKCDLGKPNCQRCEKSG-LECGGYDIKLRWSPSIKFNKFGQVDSNGSPANGT 81
          C  C+ RK +CD GKP C  C + G  E   Y I    SPS K    G      + +NG 
Sbjct: 14 CSNCKRRKSRCDRGKPACGNCIRLGNRETCHYFI----SPSEKGGDGGDSPGESTGSNGA 69

Query: 82 EE 83
           E
Sbjct: 70 LE 71

>YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region, putative transcription
          factor [2895 bp, 964 aa]
          Length = 964

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 1/39 (2%)

Query: 12 KEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          + V+R +    C  CR +KVKCD  +P C  C     EC
Sbjct: 10 QSVKRRRVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

>KLLA0C10923g complement(939148..941475) similar to sp|P07272
          Saccharomyces cerevisiae YLR014c PPR1 transcription
          factor regulating pyrimidine pathway, hypothetical
          start
          Length = 775

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 3/58 (5%)

Query: 1  MKPRKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLR 58
          M  + + ++ G   R V     C  CR RK+KCD   P+C +C ++   C   D   R
Sbjct: 1  MANKVTKESSGNIYRSV---AACKRCRIRKIKCDNKFPSCTKCIQAQEPCITIDPSTR 55

>Kwal_27.12467
          Length = 414

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 46/112 (41%), Gaps = 12/112 (10%)

Query: 165 PPTTEIKRPHINADSEITSSQSLANLFDFDFSSMNFNGHEWIANELRDDALLSASAIQGG 224
           PP  ++   H  +     S+ S ++L+D DF + NF          R D+L   S   G 
Sbjct: 73  PPDPQLAEKHNTSSVLAFSTHSPSSLYDMDFYTSNFTA--------RPDSLSVPSDRHGS 124

Query: 225 TMDNLFQRPQGQTSFSANNRRQSSYNTLHLPRRLQPDQEESDQTNNQLQKAG 276
            +DNL    Q       NN +  +  + H+ +  QP    S QT N   +A 
Sbjct: 125 VIDNL----QAPKKLPINNHQLPANESSHVLQPSQPLDFPSLQTTNPFYRAA 172

>AFL160C [3035] [Homologous to ScYPL248C (GAL4) - SH]
          (130842..132788) [1947 bp, 648 aa]
          Length = 648

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 1/46 (2%)

Query: 16 RVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSP 61
          R      C +CR RK+KC    P C +C +    C  Y  K+R SP
Sbjct: 2  RPPVIQACDSCRRRKMKCSKTFPKCAKCREDNRVC-LYSPKIRRSP 46

>KLLA0C19228g 1713787..1715562 similar to sp|P53749 Saccharomyces
          cerevisiae YNR063w singleton, hypothetical start
          Length = 591

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 1/29 (3%)

Query: 22 GCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
           C  C+ RK KCD  KP C+RC K  ++C
Sbjct: 2  ACLECKKRKQKCDGQKP-CRRCTKLNVKC 29

>YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive
          regulator of the maltose pathway MAL genes, contains a
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [1413 bp, 470 aa]
          Length = 470

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 1/29 (3%)

Query: 22 GCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
           C  CR R+VKCD  +P C RC +  L C
Sbjct: 7  SCDCCRVRRVKCDRNRP-CDRCRQRNLRC 34

>Kwal_23.6537
          Length = 552

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 1/41 (2%)

Query: 15 RRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDI 55
          +R++    C  CR RK KCD G P C  C   G  C   D+
Sbjct: 12 KRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDV 51

>Scas_518.5
          Length = 919

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 45/98 (45%), Gaps = 16/98 (16%)

Query: 10  KGKEVRRVKTFTGCWTCRSRKVKC-----DLGKPNCQRCEKSGLECG-GYDIKLRWSPSI 63
           +GKE ++ +    C  CR RKVKC       GK  C  C K+ +EC   + ++L     +
Sbjct: 107 EGKESKK-RVLKACDYCRKRKVKCGDIIAQTGK--CANCTKNDVECTFKFHLQLERKKRL 163

Query: 64  KFN--KFGQVDSNGSPANGT-----EEPQSQRRNVGFV 94
           +    ++G  + N     GT     EE  + R++  FV
Sbjct: 164 QNAVWEYGDENGNSDDEEGTYLKLLEELDTLRKSEAFV 201

>Kwal_27.10852
          Length = 1046

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 3/36 (8%)

Query: 18  KTFTGCWTCRSRKVKCDLG---KPNCQRCEKSGLEC 50
           +  T C  CR  K+KC+        C RCE+ GL C
Sbjct: 95  RPVTSCTHCRQHKIKCNANDNFPAPCSRCERMGLHC 130

>Kwal_14.1636
          Length = 456

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 1/40 (2%)

Query: 15 RRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYD 54
          RR KT   C  C    V C   +P C RC K GLE    D
Sbjct: 4  RRQKTSVACINCSKSHVTCQAERP-CTRCVKKGLEASCVD 42

>YBL005W (PDR3) [189] chr2 (217435..220365) Zinc-finger
          transcription factor, in conjunction with Pdr1p
          regulates the expression of a network of genes involved
          in multiple drug resistance [2931 bp, 976 aa]
          Length = 976

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 19/41 (46%), Gaps = 1/41 (2%)

Query: 10 KGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          K K+  R K  T C  CR RK+KC  GK  C  C      C
Sbjct: 2  KVKKSTRSKVSTACVNCRKRKIKCT-GKYPCTNCISYDCTC 41

>YDL170W (UGA3) [701] chr4 (156319..157905) Transcriptional
          activator for 4-aminobutyric acid (GABA) catabolic
          genes, including UGA4, UGA1, and UGS2, contains a
          Zn[2]-Cys[6] fungal-type binuclear cluster domain [1587
          bp, 528 aa]
          Length = 528

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 22 GCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          GC TC+ RK +C   KP C+ C +    C
Sbjct: 16 GCITCKIRKKRCSEDKPVCRDCRRLSFPC 44

>Kwal_14.819
          Length = 568

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 16/32 (50%)

Query: 19 TFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          +   C  CR RKV+C    P C+ C K   EC
Sbjct: 12 SIISCRQCRDRKVRCSRQIPKCKSCTKRNCEC 43

>YHR178W (STB5) [2464] chr8 (459297..461528) Probable
          transcriptional activator of multidrug resistance genes
          such as PDR5 and SNQ2 [2232 bp, 743 aa]
          Length = 743

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 18/41 (43%)

Query: 10 KGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          +G   +R      C  CR  K KC    P C  C+K+G  C
Sbjct: 9  QGGRSQRTTELYSCARCRKLKKKCGKQIPTCANCDKNGAHC 49

>AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH]
          complement(1320487..1322892) [2406 bp, 801 aa]
          Length = 801

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%)

Query: 7  SDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          S++ G  ++R +    C  CR +KVKCD   P C  C     EC
Sbjct: 2  SESAGLGLKRRRVTRACDECRKKKVKCDSRHP-CIHCTVYSYEC 44

>KLLA0E02618g 244696..248025 no similarity, hypothetical start
          Length = 1109

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 11/53 (20%)

Query: 8  DTKGKEVRRVKTFT-GCWTCRSRKVKCDLGKPN---------CQRCEKSGLEC 50
          D++  + R+ K     C  CR RK+KCD G+ N         C  C +S LEC
Sbjct: 11 DSRHPDSRKRKVAKRACLACRERKIKCD-GEANPDPSGGPGKCTNCVRSTLEC 62

>Scas_657.3
          Length = 856

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 14/23 (60%)

Query: 21 TGCWTCRSRKVKCDLGKPNCQRC 43
          T C  CR RK+KCD  +P C  C
Sbjct: 43 TSCAFCRQRKLKCDQKRPICSTC 65

>Scas_709.42
          Length = 374

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 2/85 (2%)

Query: 475 LASSAKQERYKDILTAILSMNSIDVVWGTMADCQYHLTLCEGLVEERMKTRPKLSGKARA 534
           LA  +  E   DI T  L   SID   GTM  C       + + +   K R K+    ++
Sbjct: 52  LALFSNNETLDDISTNSLKFLSIDYYLGTM--CSKKQATAKQVGDPSSKNRMKVKFLEKS 109

Query: 535 LHRIFSFLKLIQDSTALDKVHEREI 559
           +  I  FL ++QD   LD +  R+I
Sbjct: 110 VQIIMQFLTMLQDYEILDTMLARKI 134

>AGR280C [4591] [Homologous to ScYLR278C - SH] (1266918..1270238)
          [3321 bp, 1106 aa]
          Length = 1106

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 17/28 (60%)

Query: 23 CWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          C  C+ RK +CD   P+C  C K+G+ C
Sbjct: 41 CLLCQRRKQRCDHKIPSCTACLKAGVRC 68

>Scas_702.7d
          Length = 978

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%)

Query: 9  TKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          T   +++++++   C  CR RK+KC   +P C  CE  G  C
Sbjct: 4  TSNGKIKKLRSSRACSNCRRRKIKCSGIQP-CPNCEIYGCLC 44

>Scas_449.1
          Length = 636

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 1/29 (3%)

Query: 22 GCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
           C  CR R+ KCDL  P C  C + GL C
Sbjct: 36 ACSNCRRRRKKCDLNFP-CANCIRLGLNC 63

>Scas_669.8
          Length = 637

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 19/35 (54%), Gaps = 1/35 (2%)

Query: 15 RRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLE 49
           R KT   C  C+ RKVKCD   P C  C + GLE
Sbjct: 8  ERRKTPYACNVCKKRKVKCDKLIP-CTSCIQKGLE 41

>KLLA0F04609g complement(451579..454329) similar to sp|P40467
          Saccharomyces cerevisiae YIL130w, start by similarity
          Length = 916

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 1/36 (2%)

Query: 15 RRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          +R +    C  CR +KVKCD GK  C  C     EC
Sbjct: 6  KRRRVTRACDECRKKKVKCD-GKQPCIHCTVYNYEC 40

>Kwal_26.7448
          Length = 714

 Score = 33.9 bits (76), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 6/59 (10%)

Query: 1   MKPRKSSDTKGKEVRRVK--TFTGCWTCRSRKVKCDLGKPNCQRCE----KSGLECGGY 53
           + PR++   K +  RR    +  GC  C+ R++KCD   P C  C+    K   +C  Y
Sbjct: 71  VSPRETVVLKKRITRRRHRNSRLGCDECKRRRIKCDETLPECNNCKNRHNKGPSQCCSY 129

>Kwal_47.16939
          Length = 669

 Score = 33.9 bits (76), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%)

Query: 23 CWTCRSRKVKCD-LGKPNCQRCEKSGLECGGYD 54
          C  C+  KVKC+ L    CQRC +  L+C   D
Sbjct: 13 CSNCKKNKVKCEYLSSLPCQRCARHSLKCYYLD 45

>CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces
          cerevisiae YOR172w, hypothetical start
          Length = 865

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 13/21 (61%)

Query: 23 CWTCRSRKVKCDLGKPNCQRC 43
          C  CR RK+KCD  +P C  C
Sbjct: 40 CAFCRRRKLKCDNARPMCSTC 60

>Kwal_23.3514
          Length = 579

 Score = 33.5 bits (75), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 1/30 (3%)

Query: 18 KTFTGCWTCRSRKVKCDLGKPNCQRCEKSG 47
          KT T C  C  RKVKCD   P C  C K G
Sbjct: 7  KTRTPCVVCTKRKVKCDRNIP-CSNCVKRG 35

>YBR297W (MAL33) [474] chr2 (800479..801885) Maltose fermentation
          regulatory protein, has a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1407 bp, 468 aa]
          Length = 468

 Score = 33.5 bits (75), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 1/29 (3%)

Query: 22 GCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
           C  CR R+VKCD GK  C RC +   +C
Sbjct: 7  ACDYCRVRRVKCD-GKKPCSRCIEHNFDC 34

>Sklu_2268.2 YKR064W, Contig c2268 4260-6887 reverse complement
          Length = 875

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 18/35 (51%)

Query: 15 RRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLE 49
          RR +    C  C+ RK KCD  KP C  C + G E
Sbjct: 5  RRNRPTVVCSNCKRRKSKCDKQKPACSNCVRLGDE 39

>Kwal_14.931
          Length = 1061

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 6/45 (13%)

Query: 11  GKEVRRVKTFTGCWTCRSRKVKC----DLGKPNCQRCEKSGLECG 51
            +E + V     C  CR R++KC    DL   NC +CE  G++C 
Sbjct: 123 AQENKSVIAQKPCDHCRRRQIKCVITPDLA--NCVQCENKGIKCA 165

>Scas_638.14
          Length = 1043

 Score = 33.5 bits (75), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 3/47 (6%)

Query: 6  SSDTKGKEVRRV--KTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          ++++K K VR+   K    C  CR RK+KC  GK  C  CE     C
Sbjct: 29 NTNSKDKRVRKPTNKVSKACDNCRKRKIKCT-GKQPCATCEAYQCPC 74

>YJL103C (YJL103C) [2812] chr10 complement(228942..230798) Protein
          with similarity to transcription factors, contains a
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [1857 bp, 618 aa]
          Length = 618

 Score = 33.1 bits (74), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 21 TGCWTCRSRKVKCDLGKPNCQRCEKSGL 48
          T C  C ++ ++CD+G+P CQ C K  +
Sbjct: 18 TACEFCHTKHIQCDVGRP-CQNCLKRNI 44

>Scas_691.32
          Length = 906

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 6/53 (11%)

Query: 3  PRKSSDTKGKEV--RRVKTFTGCWTCRSRKVKCDL--GKPN-CQRCEKSGLEC 50
          P  S+D   ++   +R + F  C  CR +K KCD     P+ C +C+K G+ C
Sbjct: 25 PANSTDQHQQDTNHKRKRKF-ACVECRQQKSKCDAYEKAPDPCTKCQKKGVPC 76

>AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 696
          aa]
          Length = 696

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 15/29 (51%)

Query: 22 GCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          GC  C+   +KCD  +P C  C K  + C
Sbjct: 60 GCSQCKKSHIKCDKVQPLCTTCAKKNILC 88

>Kwal_47.18089
          Length = 745

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 1/34 (2%)

Query: 22 GCWTCRSRKVKCDLGKPNCQRCEKSGL-ECGGYD 54
           C  CR RK+KCD  +P C  C    L EC   D
Sbjct: 28 SCTFCRHRKLKCDHKRPMCGSCAARKLPECIYVD 61

>YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway
          regulatory protein, contains a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1422 bp, 473 aa]
          Length = 473

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 30/77 (38%), Gaps = 15/77 (19%)

Query: 22 GCWTCRSRKVKCDLGKPNCQRCEKSGLEC---------GGYDIKLRWSPSIKFNKFGQVD 72
           C  CR R+VKCD GK  C  C ++ L+C         G   I+LR        +  +V 
Sbjct: 12 ACDCCRIRRVKCD-GKRPCSSCLQNSLDCTYLQPSRKRGPKSIRLR-----SLKRIAEVQ 65

Query: 73 SNGSPANGTEEPQSQRR 89
              P      P   +R
Sbjct: 66 RESGPNTIATAPVIYKR 82

>Sklu_2384.6 YKL015W, Contig c2384 10929-13424
          Length = 831

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 1/36 (2%)

Query: 15 RRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          R+ ++   C  CR R VKC  G P C +C  + + C
Sbjct: 40 RQKRSSMACVRCRRRHVKCPGGNP-CSKCIAANIAC 74

>KLLA0D12672g complement(1076011..1078608)
           gi|125903|sp|P08657|LAC9_KLULA Kluyveromyces lactis
           Lactose regulatory protein LAC9, start by similarity
          Length = 865

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 14/29 (48%)

Query: 22  GCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
            C  CR +K KC    P C  C K  L+C
Sbjct: 94  ACDACRKKKWKCSKTVPTCTNCLKYNLDC 122

>Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement
          Length = 823

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 1/36 (2%)

Query: 15 RRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          +R +    C  CR +KVKCD G+  C  C     EC
Sbjct: 7  KRRRVTRACDECRKKKVKCD-GQQPCIHCTVYSYEC 41

>Kwal_23.4754
          Length = 812

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 1/36 (2%)

Query: 15 RRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          +R +    C  CR +KVKCD G+  C  C     EC
Sbjct: 7  KRRRVTRACDECRKKKVKCD-GQQPCIHCTVYSYEC 41

>KLLA0D15356g 1301848..1303722 no similarity, hypothetical start
          Length = 624

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 4/47 (8%)

Query: 8  DTKGKEVRRV--KTFTGCWTCRSRKVKC--DLGKPNCQRCEKSGLEC 50
          D +GK+  R   +T T C +C   K KC  +  +  CQ CE  G+EC
Sbjct: 23 DGRGKKRARASGRTPTSCRSCAKSKKKCTRESDRGPCQLCENRGIEC 69

>Scas_234.1
          Length = 337

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 1/25 (4%)

Query: 23 CWTCRSRKVKCDLGKPNCQRCEKSG 47
          C  C+ RK KCD G+P C  C + G
Sbjct: 33 CTNCKKRKSKCDRGRP-CSTCARLG 56

>YJL206C (YJL206C) [2722] chr10 complement(47659..49935) Protein
          with weak similarity to Put3p and other transcription
          factors, has a Zn[2]-Cys[6] fungal-type binuclear
          cluster domain in the N-terminal region [2277 bp, 758
          aa]
          Length = 758

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 7/42 (16%)

Query: 9  TKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          TKG+  R       C  CR RKV+C  G   C+ C+ +  EC
Sbjct: 39 TKGRAHR------ACIACRKRKVRCS-GNIPCRLCQTNSYEC 73

>AFR081C [3273] [Homologous to ScYJL103C - SH] (574366..575814)
          [1449 bp, 482 aa]
          Length = 482

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 17/27 (62%), Gaps = 1/27 (3%)

Query: 22 GCWTCRSRKVKCDLGKPNCQRCEKSGL 48
           C  C  + ++CD+G+P CQ CEK  +
Sbjct: 19 ACVFCHEKHLQCDVGRP-CQNCEKRNI 44

>CAGL0F09229g complement(908186..910693) weakly similar to
          sp|P39961 Saccharomyces cerevisiae YER184c,
          hypothetical start
          Length = 835

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 19/41 (46%), Gaps = 1/41 (2%)

Query: 10 KGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          K K   + +    C  CR RKVKCD  +P C  C  +   C
Sbjct: 8  KAKLAGKDRVIRACDVCRKRKVKCDGDQP-CSSCMTASTVC 47

>Kwal_47.17506
          Length = 924

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 1/36 (2%)

Query: 15 RRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          +R K    C  CR RK+KC   +P C  C+    EC
Sbjct: 11 KRSKVSRACNNCRRRKIKCTGAQP-CLNCQTYRCEC 45

>KLLA0C03201g complement(286973..288925) similar to sp|P39529
          Saccharomyces cerevisiae YJL206c, start by similarity
          Length = 650

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 1/42 (2%)

Query: 9  TKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          T   E  R K    C +C+ RKV+CD G+  C  C  + ++C
Sbjct: 22 TNQLEPVRHKVKHACSSCKERKVRCD-GQSPCASCINARVKC 62

>YKL222C (YKL222C) [3053] chr11 complement(3504..5621) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [2118 bp, 705 aa]
          Length = 705

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 15/28 (53%)

Query: 16 RVKTFTGCWTCRSRKVKCDLGKPNCQRC 43
          R K    C  CR RK+KCD  +P C  C
Sbjct: 17 RRKPAKSCHFCRVRKLKCDRVRPFCGSC 44

>YOR380W (RDR1) [5153] chr15 (1051286..1052926) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [1641 bp, 546 aa]
          Length = 546

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 1/40 (2%)

Query: 15 RRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYD 54
          +R +    C  CR RK KC+ GK  C+ C   G  C   D
Sbjct: 12 KRQRVRKACVPCRERKRKCN-GKSPCEMCVAYGYVCHYID 50

>Sklu_2023.3 YHR178W, Contig c2023 2677-4653 reverse complement
          Length = 658

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 15/29 (51%)

Query: 22 GCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
           C  CR  K KC    P C+ C ++G EC
Sbjct: 23 SCSRCRRLKKKCSKELPACRNCSRAGEEC 51

>Scas_610.9
          Length = 809

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 3/42 (7%)

Query: 12 KEVRRVKTFTGCWTCRSRKVKCDLG--KPN-CQRCEKSGLEC 50
          KE+   +    C  CR +K KCD     PN C +C + G+ C
Sbjct: 8  KEIPMGRRKYACVECRQQKSKCDANDKAPNPCSKCARKGVPC 49

>YDR520C (YDR520C) [1333] chr4 complement(1481073..1483391) Protein
           containing a fungal Zn(2)-Cys(6) binuclear cluster
           domain, which act as transcriptional regulators [2319
           bp, 772 aa]
          Length = 772

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 9/53 (16%)

Query: 3   PRKSSDTKGKEVRRVKTFTGCWTCRSRKVKCD----LGKPNCQRCEKSGLECG 51
           P+ + + K ++ R  KTF+ C TCR  K +CD    +GK  C RC    L+C 
Sbjct: 55  PKNNGNKKPRKKR--KTFS-CDTCRRVKTRCDFEPFIGK--CYRCNVLQLDCS 102

>Kwal_23.4370
          Length = 692

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 6   SSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
           S+DT G E ++ + ++ C  CR  K +C    P C  C K+G  C
Sbjct: 58  SADTNG-EYKKYELYS-CSRCRKLKKRCSKESPVCVSCAKAGESC 100

>YBR033W (YBR033W) [224] chr2 (301906..304665) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [2760 bp, 919 aa]
          Length = 919

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 2/52 (3%)

Query: 15 RRVKTFTGCWTCRSRKVKCDLGKPN--CQRCEKSGLECGGYDIKLRWSPSIK 64
          +R K    C  CR +++KC   K    CQ C + G +C    + L+  P+ K
Sbjct: 48 QRKKASHACDQCRRKRIKCRFDKHTGVCQGCLEVGEKCQFIRVPLKRGPAKK 99

>KLLA0D00396g complement(36277..37362) some similarities with
          ca|CA2346|CaSEF1 Candida albicans Putative
          transcription factor1, hypothetical start
          Length = 361

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 3/37 (8%)

Query: 17 VKTFTGCWTCRSRKVKCDLG--KPN-CQRCEKSGLEC 50
          +K    C  CR  KVKCD    +P  C  C K GL C
Sbjct: 2  LKPLRSCTRCRKNKVKCDSANTRPGPCTACSKRGLVC 38

>Scas_680.25
          Length = 738

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 14/29 (48%)

Query: 22 GCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
           C  CR  K KC    P+C  CEK+   C
Sbjct: 15 SCSRCRRLKKKCPRQTPSCANCEKAHATC 43

>ACL195C [854] [Homologous to NOHBY] (19204..19533) [330 bp, 109
          aa]
          Length = 109

 Score = 29.6 bits (65), Expect = 3.7,   Method: Composition-based stats.
 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 5/37 (13%)

Query: 18 KTFTGCWTCRSRKVKCDLG----KPNCQRCEKSGLEC 50
          K    C  CR  K+KCD      KP C  C K G+ C
Sbjct: 26 KPLRSCVRCRKNKIKCDSATRRPKP-CSSCLKKGVGC 61

>Kwal_33.13934
          Length = 797

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 14/25 (56%)

Query: 23 CWTCRSRKVKCDLGKPNCQRCEKSG 47
          C  C+ RK KCD  KP C  C + G
Sbjct: 23 CTNCKRRKSKCDRLKPICGNCSRLG 47

>Sklu_2335.6 YBL005W, Contig c2335 10191-13013
          Length = 940

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 7/50 (14%)

Query: 1  MKPRKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          M P++ + +  K  R       C  CR RK+KC  GK  C  C+     C
Sbjct: 12 MPPKRVTKSSSKVSR------ACDNCRRRKIKCT-GKQPCSNCQAYQCHC 54

>Scas_637.7
          Length = 998

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 24/52 (46%), Gaps = 9/52 (17%)

Query: 2   KPRKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPN---CQRCEKSGLEC 50
           KP K   T GK  +RV     C  CR RK+KCD   P+   C  C K    C
Sbjct: 91  KPTKI--TSGK--KRVSK--ACDHCRKRKIKCDKVDPSTGKCSNCLKYNANC 136

>YAL014C (SYN8) [54] chr1 complement(128255..129022) Protein of
           unknown function, has low similarity to uncharacterized
           C. albicans Orf6.5182p [768 bp, 255 aa]
          Length = 255

 Score = 30.0 bits (66), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 52/118 (44%), Gaps = 18/118 (15%)

Query: 509 YHLTLCEGLVEER------MKTRPKLSGKARALHRIFSFLKLIQDSTALDKVHEREIVID 562
           Y L     LVEER      +K  P  +       ++ S L+L+Q     D++  R   I 
Sbjct: 8   YELDQLSDLVEERTRLVSVLKLAPTSNDNVTLKRQLGSILELLQKCAPNDELISRYNTIL 67

Query: 563 HRIPESVVEND-------VSDNGGEF-KESLNKV----DGKIRIEYVKQNRKSGSTPI 608
            +IP++ V+ +       V+ N  E  KESL KV    D ++ + Y   + +   +P+
Sbjct: 68  DKIPDTAVDKELYRFQQQVARNTDEVSKESLKKVRFKNDDELTVMYKDDDEQDEESPL 125

>AER291C [2793] [Homologous to ScYHR178W (STB5) - SH]
          (1172383..1174374) [1992 bp, 663 aa]
          Length = 663

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 1/43 (2%)

Query: 8  DTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50
          D +    +R +T++ C  CR  K KC    P C  CE +  EC
Sbjct: 9  DAEDSGQQRYETYS-CSRCRRLKKKCSKELPRCFSCEAASKEC 50

>CAGL0M04543g 498691..499533 weakly similar to sp|P25623
           Saccharomyces cerevisiae YCR030c, hypothetical start
          Length = 280

 Score = 29.6 bits (65), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 57/99 (57%), Gaps = 8/99 (8%)

Query: 234 QGQTSFSANNRRQSSYNTLHLP-RRLQPDQEESDQTNNQLQKAGPADVDDISRVYKLLFH 292
             QTS S N R++S YN+ H+P +RL+ +++  D+ N  ++     D+++ ++V + L +
Sbjct: 98  HNQTSTSIN-RKRSIYNSGHIPNKRLRNEKDRVDKLNQMVR-----DIENNTKVVETLLN 151

Query: 293 RNEDRSKVTQQA-PVVPIDDQHVPRTIVPLDNVILINSS 330
            ++  + V + A  V P  +   P   + +D++ +++++
Sbjct: 152 ESDITTSVDRPAINVHPFVEDEAPPPTITMDDLEIVSNA 190

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 28,221,106
Number of extensions: 1266846
Number of successful extensions: 3955
Number of sequences better than 10.0: 257
Number of HSP's gapped: 4041
Number of HSP's successfully gapped: 259
Length of query: 830
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 720
Effective length of database: 12,788,129
Effective search space: 9207452880
Effective search space used: 9207452880
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)