Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_27.1261072723702e-48
YPR063C140711852e-19
Scas_667.26*126831808e-19
ADL329W111691745e-18
CAGL0D01540g127721712e-17
KLLA0B08415g121701616e-16
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.12610
         (72 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.12610                                                         147   2e-48
YPR063C (YPR063C) [5492] chr16 complement(677807..678188,678275....    76   2e-19
Scas_667.26*                                                           74   8e-19
ADL329W [1412] [Homologous to ScYPR063C - SH] complement(122957....    72   5e-18
CAGL0D01540g 166233..166616 similar to tr|Q12160 Saccharomyces c...    70   2e-17
KLLA0B08415g 749520..749885 weakly similar to sgd|S0006267 Sacch...    67   6e-16

>Kwal_27.12610
          Length = 72

 Score =  147 bits (370), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 72/72 (100%), Positives = 72/72 (100%)

Query: 1  MPMAAMFMRNKFLAWFALLSTVHYALTTEPDANADQSAVVKVLMSLVSLAVCYINVAFPQ 60
          MPMAAMFMRNKFLAWFALLSTVHYALTTEPDANADQSAVVKVLMSLVSLAVCYINVAFPQ
Sbjct: 1  MPMAAMFMRNKFLAWFALLSTVHYALTTEPDANADQSAVVKVLMSLVSLAVCYINVAFPQ 60

Query: 61 PGPADAIKAQQA 72
          PGPADAIKAQQA
Sbjct: 61 PGPADAIKAQQA 72

>YPR063C (YPR063C) [5492] chr16
           complement(677807..678188,678275..678315) Protein of
           unknown function [423 bp, 140 aa]
          Length = 140

 Score = 75.9 bits (185), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 47/71 (66%), Gaps = 11/71 (15%)

Query: 1   MPMAAMFMRNKFLAWFALLSTVHYALTTEPD-----------ANADQSAVVKVLMSLVSL 49
           MPMAA+F+RNKF+AWF+L+ +VHY L T+ D           +  DQ   +K+ MSL+ L
Sbjct: 39  MPMAAIFLRNKFIAWFSLIQSVHYYLNTDEDIIVAYKENKAPSPMDQPPAIKLFMSLIGL 98

Query: 50  AVCYINVAFPQ 60
            VCY+N+ FPQ
Sbjct: 99  CVCYMNLVFPQ 109

>Scas_667.26*
          Length = 126

 Score = 73.9 bits (180), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 39/83 (46%), Positives = 56/83 (67%), Gaps = 17/83 (20%)

Query: 1   MPMAAMFMRNKFLAWFALLSTVHYALTTEPD-ANA---------DQSAVVKVLMSLVSLA 50
           MPMAA+F+RN+F+AWFA++ +VHY L T+ D ANA         +Q+ ++KV M++V L 
Sbjct: 39  MPMAAIFLRNRFVAWFAVIQSVHYYLNTDEDEANAKDGKQSSSIEQTPIIKVAMAMVGLI 98

Query: 51  VCYINVAF------PQPGPADAI 67
           VCY+N+ F      PQP P+D I
Sbjct: 99  VCYMNLVFPVVNQMPQP-PSDEI 120

>ADL329W [1412] [Homologous to ScYPR063C - SH]
           complement(122957..123292) [336 bp, 111 aa]
          Length = 111

 Score = 71.6 bits (174), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 46/69 (66%), Gaps = 5/69 (7%)

Query: 1   MPMAAMFMRNKFLAWFALLSTVHYALTTEPDANADQSA-----VVKVLMSLVSLAVCYIN 55
           MPM AMFMRNKFLAWF+LL+  H  LT +P+A  D+       ++K+ M++V++ VCY  
Sbjct: 40  MPMLAMFMRNKFLAWFSLLTAWHTYLTADPNAVRDREGTEVGPIMKLGMAVVAVVVCYTG 99

Query: 56  VAFPQPGPA 64
           +  PQP P 
Sbjct: 100 MVLPQPAPG 108

>CAGL0D01540g 166233..166616 similar to tr|Q12160 Saccharomyces
           cerevisiae YPR063c, start by similarity
          Length = 127

 Score = 70.5 bits (171), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 48/72 (66%), Gaps = 11/72 (15%)

Query: 1   MPMAAMFMRNKFLAWFALLSTVHYALTTEPD---------ANA--DQSAVVKVLMSLVSL 49
           MPMAA+F++NKF+AWF+L+ +VH  L T+ +          N+  DQ  +VKV MSLV +
Sbjct: 39  MPMAAIFLKNKFIAWFSLIQSVHSYLNTDEETLEKNKSKTGNSALDQPPLVKVAMSLVGI 98

Query: 50  AVCYINVAFPQP 61
            VCY+N+ FP P
Sbjct: 99  LVCYMNLVFPTP 110

>KLLA0B08415g 749520..749885 weakly similar to sgd|S0006267
           Saccharomyces cerevisiae YPR063c hypothetical protein,
           start by similarity
          Length = 121

 Score = 66.6 bits (161), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 50/70 (71%), Gaps = 3/70 (4%)

Query: 1   MPMAAMFMRNKFLAWFALLSTVHYALTTEPD-ANADQSAVVKVLMSLVSLAVCYINVAFP 59
           MPMAAMFM+NKFLAWFA+L+T H  LT++PD +N   S  +K+ M+++++ + Y+ + FP
Sbjct: 39  MPMAAMFMKNKFLAWFAVLTTWHVFLTSQPDPSNPTDSPFMKIGMAVLAVGMNYLGLFFP 98

Query: 60  --QPGPADAI 67
             QP P   +
Sbjct: 99  GTQPPPLGVV 108

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.130    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 1,797,281
Number of extensions: 44051
Number of successful extensions: 147
Number of sequences better than 10.0: 6
Number of HSP's gapped: 143
Number of HSP's successfully gapped: 6
Length of query: 72
Length of database: 16,596,109
Length adjustment: 45
Effective length of query: 27
Effective length of database: 15,038,299
Effective search space: 406034073
Effective search space used: 406034073
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 54 (25.4 bits)