Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_27.126071521517981e-111
YPR062W (FCY1)1581506858e-94
KLLA0B08437g1521516459e-88
Scas_667.25*1541496321e-85
CAGL0D01562g1551506251e-84
ADL328C1511515721e-76
Scas_690.232561171187e-08
ACR075C2451031143e-07
YJL035C (TAD2)250931125e-07
Kwal_23.2894247931063e-06
CAGL0J01023g2591171047e-06
KLLA0C10989g23892932e-04
Kwal_47.17610321107840.003
CAGL0A00847g32947770.022
AFR023W30074720.12
AFR493C32438710.16
Scas_670.29*35736700.18
CAGL0G05852g30770690.27
YHR144C (DCD1)31270690.27
KLLA0C18403g32836680.42
Scas_677.2431670651.0
AAL030C153948641.6
Kwal_23.563229252631.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.12607
         (151 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.12607                                                         311   e-111
YPR062W (FCY1) [5491] chr16 (677160..677636) Cytosine deaminase,...   268   8e-94
KLLA0B08437g complement(750194..750652) highly similar to sp|Q12...   253   9e-88
Scas_667.25*                                                          248   1e-85
CAGL0D01562g complement(166898..167365) highly similar to sp|Q12...   245   1e-84
ADL328C [1413] [Homologous to ScYPR062W (FCY1) - SH] (123313..12...   224   1e-76
Scas_690.23                                                            50   7e-08
ACR075C [1122] [Homologous to ScYJL035C (TAD2) - SH] (497467..49...    49   3e-07
YJL035C (TAD2) [2876] chr10 complement(380165..380917) Subunit t...    48   5e-07
Kwal_23.2894                                                           45   3e-06
CAGL0J01023g complement(100059..100838) similar to sp|P47058 Sac...    45   7e-06
KLLA0C10989g complement(944739..945455) similar to sp|P47058 Sac...    40   2e-04
Kwal_47.17610                                                          37   0.003
CAGL0A00847g complement(86551..87540) similar to sp|Q9URQ3 Sacch...    34   0.022
AFR023W [3215] [Homologous to ScYHR144C (DCD1) - SH] complement(...    32   0.12 
AFR493C [3685] [Homologous to ScYLR316C (TAD3) - SH] (1325485..1...    32   0.16 
Scas_670.29*                                                           32   0.18 
CAGL0G05852g 565237..566160 similar to sp|P06773 Saccharomyces c...    31   0.27 
YHR144C (DCD1) [2432] chr8 complement(387789..388727) Deoxycytid...    31   0.27 
KLLA0C18403g 1627733..1628719 some similarities with sp|Q9URQ3 S...    31   0.42 
Scas_677.24                                                            30   1.0  
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    29   1.6  
Kwal_23.5632                                                           29   1.7  

>Kwal_27.12607
          Length = 152

 Score =  311 bits (798), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 151/151 (100%), Positives = 151/151 (100%)

Query: 1   MSKWDQKGIDLAYEEALKGYKEGGVPIGGCLINNKDGTVLGSGHNMRFQKGSATLHGEIS 60
           MSKWDQKGIDLAYEEALKGYKEGGVPIGGCLINNKDGTVLGSGHNMRFQKGSATLHGEIS
Sbjct: 1   MSKWDQKGIDLAYEEALKGYKEGGVPIGGCLINNKDGTVLGSGHNMRFQKGSATLHGEIS 60

Query: 61  TLENCGRMKGSVYKDCTLYTTLSPCDMCTGAILLYGISRCVVGENVNFKGDGERYLAERG 120
           TLENCGRMKGSVYKDCTLYTTLSPCDMCTGAILLYGISRCVVGENVNFKGDGERYLAERG
Sbjct: 61  TLENCGRMKGSVYKDCTLYTTLSPCDMCTGAILLYGISRCVVGENVNFKGDGERYLAERG 120

Query: 121 CEVKVLDDDRCKDIMKQFIEERPQDWFEDIG 151
           CEVKVLDDDRCKDIMKQFIEERPQDWFEDIG
Sbjct: 121 CEVKVLDDDRCKDIMKQFIEERPQDWFEDIG 151

>YPR062W (FCY1) [5491] chr16 (677160..677636) Cytosine deaminase,
           catalyzes the hydrolysis of cytidine into uridine and
           ammonia [477 bp, 158 aa]
          Length = 158

 Score =  268 bits (685), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 137/150 (91%)

Query: 2   SKWDQKGIDLAYEEALKGYKEGGVPIGGCLINNKDGTVLGSGHNMRFQKGSATLHGEIST 61
           SKWDQKG+D+AYEEA  GYKEGGVPIGGCLINNKDG+VLG GHNMRFQKGSATLHGEIST
Sbjct: 8   SKWDQKGMDIAYEEAALGYKEGGVPIGGCLINNKDGSVLGRGHNMRFQKGSATLHGEIST 67

Query: 62  LENCGRMKGSVYKDCTLYTTLSPCDMCTGAILLYGISRCVVGENVNFKGDGERYLAERGC 121
           LENCGR++G VYKD TLYTTLSPCDMCTGAI++YGI RCVVGENVNFK  GE+YL  RG 
Sbjct: 68  LENCGRLEGKVYKDTTLYTTLSPCDMCTGAIIMYGIPRCVVGENVNFKSKGEKYLQTRGH 127

Query: 122 EVKVLDDDRCKDIMKQFIEERPQDWFEDIG 151
           EV V+DD+RCK IMKQFI+ERPQDWFEDIG
Sbjct: 128 EVVVVDDERCKKIMKQFIDERPQDWFEDIG 157

>KLLA0B08437g complement(750194..750652) highly similar to sp|Q12178
           Saccharomyces cerevisiae YPR062w FCY1 cytosine deaminase
           singleton, start by similarity
          Length = 152

 Score =  253 bits (645), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 119/151 (78%), Positives = 133/151 (88%)

Query: 1   MSKWDQKGIDLAYEEALKGYKEGGVPIGGCLINNKDGTVLGSGHNMRFQKGSATLHGEIS 60
           M++WD+KG+D AYEEA  GYKEGGVPIGGCLI+N  G +LGSGHNMRFQKGS TLHGE S
Sbjct: 1   MAEWDKKGMDKAYEEAAIGYKEGGVPIGGCLIDNLTGEILGSGHNMRFQKGSPTLHGETS 60

Query: 61  TLENCGRMKGSVYKDCTLYTTLSPCDMCTGAILLYGISRCVVGENVNFKGDGERYLAERG 120
           TLEN GR+KGSVYK CT+YTTLSPCDMCTGAILLYGI R VVGENVNFK  GE+YLAERG
Sbjct: 61  TLENAGRLKGSVYKHCTMYTTLSPCDMCTGAILLYGIGRVVVGENVNFKSPGEKYLAERG 120

Query: 121 CEVKVLDDDRCKDIMKQFIEERPQDWFEDIG 151
            EVKV+DD+RC +IMK FI +RP+DWFEDIG
Sbjct: 121 IEVKVVDDERCIEIMKDFIAKRPEDWFEDIG 151

>Scas_667.25*
          Length = 154

 Score =  248 bits (632), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 114/149 (76%), Positives = 129/149 (86%)

Query: 3   KWDQKGIDLAYEEALKGYKEGGVPIGGCLINNKDGTVLGSGHNMRFQKGSATLHGEISTL 62
           +WD+ G+D+A+EEA  GY EGGVPIGGCLINNKDG VLG GHNMRFQKGS TLHGEISTL
Sbjct: 5   QWDKLGMDIAFEEAANGYAEGGVPIGGCLINNKDGKVLGRGHNMRFQKGSPTLHGEISTL 64

Query: 63  ENCGRMKGSVYKDCTLYTTLSPCDMCTGAILLYGISRCVVGENVNFKGDGERYLAERGCE 122
           ENCGR++G VYKD TLYTTLSPCDMCTGAIL+YGI R V+GE+VNFK  GE YLA R  +
Sbjct: 65  ENCGRLEGKVYKDTTLYTTLSPCDMCTGAILMYGIPRVVIGESVNFKSPGEAYLASRNVQ 124

Query: 123 VKVLDDDRCKDIMKQFIEERPQDWFEDIG 151
           V  +DD+RCK IMK+FI+ERPQDWFEDIG
Sbjct: 125 VVQMDDERCKTIMKKFIDERPQDWFEDIG 153

>CAGL0D01562g complement(166898..167365) highly similar to sp|Q12178
           Saccharomyces cerevisiae YPR062w FCY1 cytosine
           deaminase, hypothetical start
          Length = 155

 Score =  245 bits (625), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 129/150 (86%)

Query: 2   SKWDQKGIDLAYEEALKGYKEGGVPIGGCLINNKDGTVLGSGHNMRFQKGSATLHGEIST 61
           ++WD  G+ +AYEEA KG++EGGVPIGGCLINNKDGTVLG GHNMRFQKGS TLHGEIST
Sbjct: 5   AQWDALGMKIAYEEAAKGFEEGGVPIGGCLINNKDGTVLGRGHNMRFQKGSPTLHGEIST 64

Query: 62  LENCGRMKGSVYKDCTLYTTLSPCDMCTGAILLYGISRCVVGENVNFKGDGERYLAERGC 121
           LENCGR++G VYKD TLYTTLSPCDMCTGAILLYGI RCV+GE+ NFK  GE YL  RG 
Sbjct: 65  LENCGRLEGKVYKDTTLYTTLSPCDMCTGAILLYGIPRCVIGESDNFKSPGEEYLKSRGV 124

Query: 122 EVKVLDDDRCKDIMKQFIEERPQDWFEDIG 151
           EV  ++D+ CK IMK+FI+ RPQDWFEDIG
Sbjct: 125 EVVQMNDEPCKAIMKKFIDTRPQDWFEDIG 154

>ADL328C [1413] [Homologous to ScYPR062W (FCY1) - SH]
           (123313..123768) [456 bp, 151 aa]
          Length = 151

 Score =  224 bits (572), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 121/151 (80%), Gaps = 1/151 (0%)

Query: 1   MSKWDQKGIDLAYEEALKGYKEGGVPIGGCLINNKDGTVLGSGHNMRFQKGSATLHGEIS 60
           M++WD+KG+++AY+EAL+GY EGGVPIGGCLI+  DGTVLG G NMRFQ+ SATLHGE +
Sbjct: 1   MAQWDRKGMEIAYQEALQGYAEGGVPIGGCLIDQTDGTVLGRGRNMRFQRASATLHGETA 60

Query: 61  TLENCGRMKGSVYKDCTLYTTLSPCDMCTGAILLYGISRCVVGENVNFKGDGERYLAERG 120
            LEN GR+ G VYK CTLYTTLSPCDMC GA+LLYGI RCVVGEN  F G  E +L  RG
Sbjct: 61  ALENAGRLPGHVYKHCTLYTTLSPCDMCAGAVLLYGIPRCVVGENDTFLG-AEAHLRARG 119

Query: 121 CEVKVLDDDRCKDIMKQFIEERPQDWFEDIG 151
            EV VL D RC+ +M+QF+  RPQDW EDIG
Sbjct: 120 VEVTVLQDARCRALMQQFVAARPQDWNEDIG 150

>Scas_690.23
          Length = 256

 Score = 50.1 bits (118), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 47/117 (40%), Gaps = 10/117 (8%)

Query: 2   SKWDQKGIDLAYEEALKGYKEGGVPIGGCLINNKDGTVLGSGHNMRFQKGSATLHGEIST 61
           + W +  I LA             P+    ++     ++  G N   +  +   H E   
Sbjct: 9   ASWMESAIKLAR----YALDHDETPVASIFVHEPTNKIIAYGLNDTNKSLTGIAHAEFMG 64

Query: 62  LENCGRMKGS-----VYKDCTLYTTLSPCDMCTGAILLYGISRCVVG-ENVNFKGDG 112
           +E    M GS     ++KD  LY T+ PC MC  A+   GI + V G  N  F G+G
Sbjct: 65  IEQIKAMVGSEHLTEIFKDTVLYVTVEPCVMCASALRQLGIKKVVFGCANERFGGNG 121

>ACR075C [1122] [Homologous to ScYJL035C (TAD2) - SH]
           (497467..498204) [738 bp, 245 aa]
          Length = 245

 Score = 48.5 bits (114), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 44/103 (42%), Gaps = 5/103 (4%)

Query: 22  EGGVPIGGCLINNKDGTVLGSGHNMRFQKGSATLHGEISTL----ENCGRMKGSVYKDCT 77
            G  P+    ++     ++  G N   +  +   H E   +    E  G    S++K+ T
Sbjct: 21  HGETPVACVFVHTPSDQIIAYGMNDTNRSLTGIAHAEFGAIAQVQELFGEQDASIFKEVT 80

Query: 78  LYTTLSPCDMCTGAILLYGISRCVVG-ENVNFKGDGERYLAER 119
           +Y T+ PC MC  A+   GI R + G  N  F G+G     +R
Sbjct: 81  VYVTVEPCVMCASALKQLGIGRVIFGCGNERFGGNGSILAVQR 123

>YJL035C (TAD2) [2876] chr10 complement(380165..380917) Subunit
           tRNA[Ala]-specific adenosine deaminase [753 bp, 250 aa]
          Length = 250

 Score = 47.8 bits (112), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 42/93 (45%), Gaps = 6/93 (6%)

Query: 26  PIGGCLINNKDGTVLGSGHNMRFQKGSATLHGEISTLENCGRMKGS-----VYKDCTLYT 80
           P+    ++   G V+  G N   +  +   H E   ++    M GS     V+KD TLY 
Sbjct: 24  PVACIFVHTPTGQVMAYGMNDTNKSLTGVAHAEFMGIDQIKAMLGSRGVVDVFKDITLYV 83

Query: 81  TLSPCDMCTGAILLYGISRCVVG-ENVNFKGDG 112
           T+ PC MC  A+    I + V G  N  F G+G
Sbjct: 84  TVEPCIMCASALKQLDIGKVVFGCGNERFGGNG 116

>Kwal_23.2894
          Length = 247

 Score = 45.4 bits (106), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 42/93 (45%), Gaps = 5/93 (5%)

Query: 25  VPIGGCLINNKDGTVLGSGHNMRFQKGSATLHGE---ISTLE-NCGRMKGSVYKDCTLYT 80
            P+    ++     +L  G N   +  +   H E   IS ++   G    SVYKD  LY 
Sbjct: 26  TPVACIFVHAPTNQILAYGMNDTNRSLTGIAHAEFMGISQIQAKFGVQNTSVYKDIILYV 85

Query: 81  TLSPCDMCTGAILLYGISRCVVG-ENVNFKGDG 112
           T+ PC MC  A+   GI + + G  N  F G+G
Sbjct: 86  TVEPCIMCASALKQLGIQKVIFGCGNDRFGGNG 118

>CAGL0J01023g complement(100059..100838) similar to sp|P47058
           Saccharomyces cerevisiae YJL035c TAD2, hypothetical
           start
          Length = 259

 Score = 44.7 bits (104), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 50/117 (42%), Gaps = 11/117 (9%)

Query: 7   KGIDLAYEEALKGYKEGGVPIGGCLINNKDGTVLGSGHNMRFQKGSATLHGE---ISTLE 63
           K ID A + A      G  P+    ++ K  +V+  G N      S T H E   +  L 
Sbjct: 6   KHIDSALKLARYALDHGETPVACVFVHEKSDSVVAYGLNDTNDSLSGTAHAEFVAMRMLR 65

Query: 64  NCGRMKG-------SVYKDCTLYTTLSPCDMCTGAILLYGISRCVVG-ENVNFKGDG 112
           +  + +G        ++K+   Y T+ PC MC  A+   GI + V G  N  F G+G
Sbjct: 66  DAVQAQGYASVQLKQLFKEIVCYVTVEPCIMCASALKQMGIHKIVFGCGNDRFGGNG 122

>KLLA0C10989g complement(944739..945455) similar to sp|P47058
           Saccharomyces cerevisiae YJL035c TAD2 tRNA-specific
           adenosine deaminase 2 singleton, start by similarity
          Length = 238

 Score = 40.4 bits (93), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 40/92 (43%), Gaps = 4/92 (4%)

Query: 25  VPIGGCLINNKDGTVLGSGHNMRFQKGSATLHGEISTLENCGRMKGS---VYKDCTLYTT 81
            P+    +++K   V+  G N   +  S   H E   ++      G+   +  +  LY T
Sbjct: 24  TPVACIFVHSKLNKVIAYGMNGTNESISGISHAEFMGIKQIQEKYGTDPKILSEVVLYVT 83

Query: 82  LSPCDMCTGAILLYGISRCVVG-ENVNFKGDG 112
           + PC MC  A+   GI + V G  N  F G+G
Sbjct: 84  VEPCIMCASALKQLGIKKVVFGCGNERFGGNG 115

>Kwal_47.17610
          Length = 321

 Score = 37.0 bits (84), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 47/107 (43%), Gaps = 14/107 (13%)

Query: 6   QKGIDLAYEEALKGYKEGGVPIGGCLINNKDG-TVLGSG---------HN-MRFQKGSAT 54
           QK  D ++EE+  G K   +P+    +N K+  TV  +          H+ MR  +  A 
Sbjct: 166 QKICDKSFEESKSGNK---IPVVSAFVNPKNQETVFATDCRYEDSPLDHSIMRGIRSVAA 222

Query: 55  LHGEISTLENCGRMKGSVYKDCTLYTTLSPCDMCTGAILLYGISRCV 101
           L  +       G  +  +  D  +YTT  PC MC  A++   I RC+
Sbjct: 223 LEQKRKNEAKRGSEETYLCLDFDVYTTHEPCSMCAMALIHSRIKRCI 269

>CAGL0A00847g complement(86551..87540) similar to sp|Q9URQ3
           Saccharomyces cerevisiae YLR316c TAD3, hypothetical
           start
          Length = 329

 Score = 34.3 bits (77), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query: 61  TLENCGRM-KGSVYKDCTLYTTLSPCDMCTGAILLYGISRCVVGENV 106
           +LE+C  + +  +  D  +YTT  PC MC+ A++   I RC+  E +
Sbjct: 236 SLEDCNNVPQNYLCLDFDVYTTHEPCSMCSMALIHSRIKRCIFIEQM 282

>AFR023W [3215] [Homologous to ScYHR144C (DCD1) - SH]
           complement(483186..484088) [903 bp, 300 aa]
          Length = 300

 Score = 32.3 bits (72), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 32/74 (43%), Gaps = 2/74 (2%)

Query: 55  LHGEISTLENCGRMKGSVYKDCTLYTTLSPCDMCTGAILLYGISRCVVGENVNFKGDGER 114
           LH E + L   GR +  V +   LY    PC  C+  I+  GI+  V  +      D  +
Sbjct: 220 LHAEENALLEAGRER--VGEGAVLYCDTCPCLTCSVKIVQTGITEVVYSQTYRMDSDSFK 277

Query: 115 YLAERGCEVKVLDD 128
            L   G +V+ L D
Sbjct: 278 VLRAGGVKVRQLQD 291

>AFR493C [3685] [Homologous to ScYLR316C (TAD3) - SH]
           (1325485..1326459) [975 bp, 324 aa]
          Length = 324

 Score = 32.0 bits (71), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 20/38 (52%)

Query: 64  NCGRMKGSVYKDCTLYTTLSPCDMCTGAILLYGISRCV 101
           + GR    +  D  +YTT  PC MC  A++   I RC+
Sbjct: 235 SVGRTDTYLCLDFDVYTTHEPCSMCAMALIHSRIKRCI 272

>Scas_670.29*
          Length = 357

 Score = 31.6 bits (70), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 20/36 (55%)

Query: 75  DCTLYTTLSPCDMCTGAILLYGISRCVVGENVNFKG 110
           D  +YTT  PC MC+ A++   I RC+  + +   G
Sbjct: 279 DFDVYTTHEPCSMCSMALIHSRIRRCIFLQQMEKTG 314

>CAGL0G05852g 565237..566160 similar to sp|P06773 Saccharomyces
           cerevisiae YHR144c DCD1 deoxycytidylate deaminase, start
           by similarity
          Length = 307

 Score = 31.2 bits (69), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 2/70 (2%)

Query: 55  LHGEISTLENCGRMKGSVYKDCTLYTTLSPCDMCTGAILLYGISRCVVGENVNFKGDGER 114
           LH E + L   GR    V ++ TLY    PC  C+  I+  GI+  V  +         +
Sbjct: 227 LHAEENALLEAGR--DRVGQNATLYCDTCPCLTCSVKIVQTGITEVVYSQTYRMDDASFK 284

Query: 115 YLAERGCEVK 124
            L E G +V+
Sbjct: 285 VLREAGIKVR 294

>YHR144C (DCD1) [2432] chr8 complement(387789..388727)
           Deoxycytidylate deaminase [939 bp, 312 aa]
          Length = 312

 Score = 31.2 bits (69), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 2/70 (2%)

Query: 55  LHGEISTLENCGRMKGSVYKDCTLYTTLSPCDMCTGAILLYGISRCVVGENVNFKGDGER 114
           LH E + L   GR +  V ++ TLY    PC  C+  I+  GIS  V  ++     +  +
Sbjct: 232 LHAEENALLEAGRDR--VGQNATLYCDTCPCLTCSVKIVQTGISEVVYSQSYRMDEESFK 289

Query: 115 YLAERGCEVK 124
            L   G  V+
Sbjct: 290 VLKNAGITVR 299

>KLLA0C18403g 1627733..1628719 some similarities with sp|Q9URQ3
           Saccharomyces cerevisiae YLR316c TAD3 subunit of
           tRNA-specific adenosine-34 deaminase singleton,
           hypothetical start
          Length = 328

 Score = 30.8 bits (68), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 20/36 (55%)

Query: 75  DCTLYTTLSPCDMCTGAILLYGISRCVVGENVNFKG 110
           D  +YT+  PC MC+ A++   + RC+    ++  G
Sbjct: 250 DFDVYTSHEPCSMCSMALIHSRVKRCIFINPMSVSG 285

>Scas_677.24
          Length = 316

 Score = 29.6 bits (65), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 28/70 (40%), Gaps = 2/70 (2%)

Query: 55  LHGEISTLENCGRMKGSVYKDCTLYTTLSPCDMCTGAILLYGISRCVVGENVNFKGDGER 114
           LH E + L   GR +  V    TLY    PC  C+  I+  GI   V  +      +  +
Sbjct: 236 LHAEENALLEAGRDRVGV--KATLYCDTCPCLTCSVKIVQTGIKEVVYSQTYRMDEESFK 293

Query: 115 YLAERGCEVK 124
            L   G  V+
Sbjct: 294 VLTSAGINVR 303

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 29.3 bits (64), Expect = 1.6,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 25/48 (52%)

Query: 53   ATLHGEISTLENCGRMKGSVYKDCTLYTTLSPCDMCTGAILLYGISRC 100
            +TL   +  L+N  +++ ++  +     T+  CD+C GAI+  G   C
Sbjct: 1192 STLQSRLKYLQNLTKLEQALKDNMRFNCTICLCDICDGAIIGRGHFYC 1239

>Kwal_23.5632
          Length = 292

 Score = 28.9 bits (63), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 23/52 (44%), Gaps = 3/52 (5%)

Query: 86  DMCTGAILLYGISRCVVGENV---NFKGDGERYLAERGCEVKVLDDDRCKDI 134
           D+C G  +L      +VG N        D   YLA RGCE K   +D  KD 
Sbjct: 230 DVCAGWCILKETGGRIVGANPGEWEVSVDNRTYLAVRGCESKKQQEDYIKDF 281

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.140    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,242,845
Number of extensions: 214957
Number of successful extensions: 432
Number of sequences better than 10.0: 26
Number of HSP's gapped: 431
Number of HSP's successfully gapped: 26
Length of query: 151
Length of database: 16,596,109
Length adjustment: 92
Effective length of query: 59
Effective length of database: 13,411,253
Effective search space: 791263927
Effective search space used: 791263927
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 57 (26.6 bits)