Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_27.1260225725413390.0
KLLA0B08481g26025410201e-141
Scas_667.2325825410071e-139
YPR060C (ARO7)2562549911e-137
CAGL0K12232g2602599491e-130
ADL326W2592549061e-124
Sklu_2124.1183057730.35
Kwal_55.2178874967690.99
Kwal_27.11951186944634.9
CAGL0I09614g103944635.5
Kwal_55.2117953372625.7
KLLA0E15356g69347626.1
YMR076C (PDS5)127772626.5
AER078W21738607.4
Scas_721.40183455627.7
Scas_712.1526480609.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.12602
         (254 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.12602                                                         520   0.0  
KLLA0B08481g 752482..753264 highly similar to sp|P32178 Saccharo...   397   e-141
Scas_667.23                                                           392   e-139
YPR060C (ARO7) [5489] chr16 complement(674856..675626) Chorismat...   386   e-137
CAGL0K12232g complement(1194973..1195755) highly similar to sp|P...   370   e-130
ADL326W [1415] [Homologous to ScYPR060C (ARO7) - SH] complement(...   353   e-124
Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement           33   0.35 
Kwal_55.21788                                                          31   0.99 
Kwal_27.11951                                                          29   4.9  
CAGL0I09614g 917707..920826 highly similar to tr|Q08773 Saccharo...    29   5.5  
Kwal_55.21179                                                          28   5.7  
KLLA0E15356g complement(1359509..1361590) some similarities with...    28   6.1  
YMR076C (PDS5) [4035] chr13 complement(416195..420028) Protein r...    28   6.5  
AER078W [2583] [Homologous to ScYLR407W - SH] complement(780901....    28   7.4  
Scas_721.40                                                            28   7.7  
Scas_712.15                                                            28   9.1  

>Kwal_27.12602
          Length = 257

 Score =  520 bits (1339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/254 (100%), Positives = 254/254 (100%)

Query: 1   MDFLKPETVLDLSNIRDELVKMEDTIIFNFIERSHFPTCPTVYKEKDPNLPLPDFDGSFL 60
           MDFLKPETVLDLSNIRDELVKMEDTIIFNFIERSHFPTCPTVYKEKDPNLPLPDFDGSFL
Sbjct: 1   MDFLKPETVLDLSNIRDELVKMEDTIIFNFIERSHFPTCPTVYKEKDPNLPLPDFDGSFL 60

Query: 61  DWALMHSEITHSQLRRFESPDQTPFFPDKILKPILPSIHYPRVLSSYAAEINLNQEIKAV 120
           DWALMHSEITHSQLRRFESPDQTPFFPDKILKPILPSIHYPRVLSSYAAEINLNQEIKAV
Sbjct: 61  DWALMHSEITHSQLRRFESPDQTPFFPDKILKPILPSIHYPRVLSSYAAEINLNQEIKAV 120

Query: 121 YIEQIIPMVSKFDGESWENFGSVATIDIECLQSLSRRIHFGKFVAEAKFQADRALYSKMI 180
           YIEQIIPMVSKFDGESWENFGSVATIDIECLQSLSRRIHFGKFVAEAKFQADRALYSKMI
Sbjct: 121 YIEQIIPMVSKFDGESWENFGSVATIDIECLQSLSRRIHFGKFVAEAKFQADRALYSKMI 180

Query: 181 KERDLDGIYRSITNSAVEEKILERLCLKAEVYGVDPSNKEGYRKITPEYLVKIYKELVIP 240
           KERDLDGIYRSITNSAVEEKILERLCLKAEVYGVDPSNKEGYRKITPEYLVKIYKELVIP
Sbjct: 181 KERDLDGIYRSITNSAVEEKILERLCLKAEVYGVDPSNKEGYRKITPEYLVKIYKELVIP 240

Query: 241 LTKKVEVDYLLRRL 254
           LTKKVEVDYLLRRL
Sbjct: 241 LTKKVEVDYLLRRL 254

>KLLA0B08481g 752482..753264 highly similar to sp|P32178
           Saccharomyces cerevisiae YPR060c ARO7 chorismate mutase
           singleton, start by similarity
          Length = 260

 Score =  397 bits (1020), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 187/254 (73%), Positives = 224/254 (88%)

Query: 1   MDFLKPETVLDLSNIRDELVKMEDTIIFNFIERSHFPTCPTVYKEKDPNLPLPDFDGSFL 60
           MDF KPETVLDL NIRDELVKMEDTIIFNFIERSHF TC +VY+   P + LPDFDGSFL
Sbjct: 1   MDFFKPETVLDLQNIRDELVKMEDTIIFNFIERSHFATCSSVYESNVPEIKLPDFDGSFL 60

Query: 61  DWALMHSEITHSQLRRFESPDQTPFFPDKILKPILPSIHYPRVLSSYAAEINLNQEIKAV 120
           DWALM  EI HSQLRRFESPD+TPFFPDKILKPI+PS++YP++L+SYA +IN N +IK++
Sbjct: 61  DWALMKMEIVHSQLRRFESPDETPFFPDKILKPIIPSLNYPKILASYANQINYNDKIKSI 120

Query: 121 YIEQIIPMVSKFDGESWENFGSVATIDIECLQSLSRRIHFGKFVAEAKFQADRALYSKMI 180
           YI+ I+P++SK D  +WENFGSVAT DIE LQSLSRRIHFGKFVAEAKFQ+++  ++K+I
Sbjct: 121 YIKTIVPLLSKRDINTWENFGSVATRDIEALQSLSRRIHFGKFVAEAKFQSEKEKFTKLI 180

Query: 181 KERDLDGIYRSITNSAVEEKILERLCLKAEVYGVDPSNKEGYRKITPEYLVKIYKELVIP 240
            ++D+DGI  +ITNS VEEKIL+RL +KA VYGVDP+N++G RKITPEYLVKIYKE+VIP
Sbjct: 181 LDQDVDGIMTAITNSKVEEKILQRLNVKATVYGVDPTNEKGDRKITPEYLVKIYKEIVIP 240

Query: 241 LTKKVEVDYLLRRL 254
           +TK+VEVDYLLRRL
Sbjct: 241 ITKEVEVDYLLRRL 254

>Scas_667.23
          Length = 258

 Score =  392 bits (1007), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 185/254 (72%), Positives = 225/254 (88%)

Query: 1   MDFLKPETVLDLSNIRDELVKMEDTIIFNFIERSHFPTCPTVYKEKDPNLPLPDFDGSFL 60
           MDFLKP+TVL+L NIR ELVKMEDTIIF FIERSHF TC +VY+   P + +P+FDGSFL
Sbjct: 1   MDFLKPDTVLNLQNIRAELVKMEDTIIFQFIERSHFATCSSVYQPNHPGVSIPNFDGSFL 60

Query: 61  DWALMHSEITHSQLRRFESPDQTPFFPDKILKPILPSIHYPRVLSSYAAEINLNQEIKAV 120
           DWAL+H EITHSQLRRFESPD+TPFFP++ILKPILPSI+YP +L+SYA+E+N N +IK V
Sbjct: 61  DWALLHLEITHSQLRRFESPDETPFFPNEILKPILPSINYPPILASYASEVNYNDKIKKV 120

Query: 121 YIEQIIPMVSKFDGESWENFGSVATIDIECLQSLSRRIHFGKFVAEAKFQADRALYSKMI 180
           YI++I+P++SK+DG+  EN+GSVAT D E LQ+LSRRIHFGKFVAEAKFQ+ + LY ++I
Sbjct: 121 YIDRIVPLISKYDGDQKENYGSVATRDCEVLQNLSRRIHFGKFVAEAKFQSAKELYIELI 180

Query: 181 KERDLDGIYRSITNSAVEEKILERLCLKAEVYGVDPSNKEGYRKITPEYLVKIYKELVIP 240
           K +D++GI + ITNSAVEEKILERL  KAEVYGVDP+NKEG R+ITPEYLVKIYKE+VIP
Sbjct: 181 KNKDVEGIMKHITNSAVEEKILERLTKKAEVYGVDPTNKEGERRITPEYLVKIYKEIVIP 240

Query: 241 LTKKVEVDYLLRRL 254
           +TK+VEV+YLLRRL
Sbjct: 241 ITKEVEVEYLLRRL 254

>YPR060C (ARO7) [5489] chr16 complement(674856..675626) Chorismate
           mutase, required for the synthesis of both phenylalanine
           and tyrosine [771 bp, 256 aa]
          Length = 256

 Score =  386 bits (991), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 184/254 (72%), Positives = 220/254 (86%)

Query: 1   MDFLKPETVLDLSNIRDELVKMEDTIIFNFIERSHFPTCPTVYKEKDPNLPLPDFDGSFL 60
           MDF KPETVL+L NIRDELV+MED+IIF FIERSHF TCP+VY+   P L +P+F GSFL
Sbjct: 1   MDFTKPETVLNLQNIRDELVRMEDSIIFKFIERSHFATCPSVYEANHPGLEIPNFKGSFL 60

Query: 61  DWALMHSEITHSQLRRFESPDQTPFFPDKILKPILPSIHYPRVLSSYAAEINLNQEIKAV 120
           DWAL + EI HS++RRFESPD+TPFFPDKI K  LPSI+YP++L+ YA E+N N +IK V
Sbjct: 61  DWALSNLEIAHSRIRRFESPDETPFFPDKIQKSFLPSINYPQILAPYAPEVNYNDKIKKV 120

Query: 121 YIEQIIPMVSKFDGESWENFGSVATIDIECLQSLSRRIHFGKFVAEAKFQADRALYSKMI 180
           YIE+IIP++SK DG+   NFGSVAT DIECLQSLSRRIHFGKFVAEAKFQ+D  LY+K+I
Sbjct: 121 YIEKIIPLISKRDGDDKNNFGSVATRDIECLQSLSRRIHFGKFVAEAKFQSDIPLYTKLI 180

Query: 181 KERDLDGIYRSITNSAVEEKILERLCLKAEVYGVDPSNKEGYRKITPEYLVKIYKELVIP 240
           K +D++GI ++ITNSAVEEKILERL  KAEVYGVDP+N+ G R+ITPEYLVKIYKE+VIP
Sbjct: 181 KSKDVEGIMKNITNSAVEEKILERLTKKAEVYGVDPTNESGERRITPEYLVKIYKEIVIP 240

Query: 241 LTKKVEVDYLLRRL 254
           +TK+VEV+YLLRRL
Sbjct: 241 ITKEVEVEYLLRRL 254

>CAGL0K12232g complement(1194973..1195755) highly similar to
           sp|P32178 Saccharomyces cerevisiae YPR060c ARO7
           chorismate mutase, start by similarity
          Length = 260

 Score =  370 bits (949), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 179/259 (69%), Positives = 220/259 (84%), Gaps = 5/259 (1%)

Query: 1   MDFLKPETVLDLSNIRDELVKMEDTIIFNFIERSHFPTCPTVYKEKDPNLPLPDFDGSFL 60
           MDF KPETVL+L NIRDELVKMED+IIF FIERSHFP C  VY    P+L +PDF GSFL
Sbjct: 1   MDFTKPETVLNLQNIRDELVKMEDSIIFKFIERSHFPVCAPVYAPNHPDLNIPDFTGSFL 60

Query: 61  DWALMHSEITHSQLRRFESPDQTPFFPDKILKPILPSIHYPRVLSSYAAE-INLNQEIKA 119
           DWAL+  EITHS+LRRF+SPD+TPFFP+ I +PILP I+YP++L   A++ +N N++IK+
Sbjct: 61  DWALLQMEITHSKLRRFDSPDETPFFPNDIQEPILPRINYPKILHEKASKPVNYNEKIKS 120

Query: 120 VYIEQIIPMVSKFDGESWENFGSVATIDIECLQSLSRRIHFGKFVAEAKFQADRALYSKM 179
           +YI++I+P++S  DG+S EN+GSVAT D+ECLQSLSRRIHFGKFVAEAKFQ+D  LY+KM
Sbjct: 121 IYIKEIVPLISNSDGDSKENYGSVATRDMECLQSLSRRIHFGKFVAEAKFQSDIDLYTKM 180

Query: 180 IKERDLDGIYRSITNSAVEEKILERLCLKAEVYGVDPS----NKEGYRKITPEYLVKIYK 235
           I+E+D+DGI  SITN+AVEEKILERL  KA+VYGVDP+    + E  R+ITPEYLVKIYK
Sbjct: 181 IREKDVDGIMSSITNAAVEEKILERLVRKADVYGVDPTTPVDSSEKVRRITPEYLVKIYK 240

Query: 236 ELVIPLTKKVEVDYLLRRL 254
           E+VIP+TK+VEVDYLLRRL
Sbjct: 241 EIVIPITKEVEVDYLLRRL 259

>ADL326W [1415] [Homologous to ScYPR060C (ARO7) - SH]
           complement(124969..125748) [780 bp, 259 aa]
          Length = 259

 Score =  353 bits (906), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 166/254 (65%), Positives = 204/254 (80%)

Query: 1   MDFLKPETVLDLSNIRDELVKMEDTIIFNFIERSHFPTCPTVYKEKDPNLPLPDFDGSFL 60
           MDFL P++VL+L +IR ELV+MEDTIIFNFIERS+FPTCP VY      LPLPDFDGSFL
Sbjct: 1   MDFLDPKSVLNLDHIRHELVRMEDTIIFNFIERSYFPTCPVVYHANHERLPLPDFDGSFL 60

Query: 61  DWALMHSEITHSQLRRFESPDQTPFFPDKILKPILPSIHYPRVLSSYAAEINLNQEIKAV 120
           DWA MH E+T SQLRRFE+PDQ PF+P  IL PILP + YP++L+ YA +IN N  IKA+
Sbjct: 61  DWAHMHMEMTQSQLRRFEAPDQVPFYPGSILPPILPPVQYPKLLAPYAPQINYNDRIKAI 120

Query: 121 YIEQIIPMVSKFDGESWENFGSVATIDIECLQSLSRRIHFGKFVAEAKFQADRALYSKMI 180
           Y++ ++P+VS  +G SWEN GSV + DI+CLQ+LSRRIHFGKFVAEAKFQ +   Y+ +I
Sbjct: 121 YLDSVVPLVSLGEGTSWENLGSVTSCDIDCLQALSRRIHFGKFVAEAKFQLEPEKYTALI 180

Query: 181 KERDLDGIYRSITNSAVEEKILERLCLKAEVYGVDPSNKEGYRKITPEYLVKIYKELVIP 240
           K RD+DGI  SITN  VE+KIL+RL  KA VYGVDP ++   +++TPEYL KIYKE VIP
Sbjct: 181 KNRDVDGIMDSITNKFVEDKILKRLQAKATVYGVDPLDRNCSKRVTPEYLAKIYKEYVIP 240

Query: 241 LTKKVEVDYLLRRL 254
           +TK+VEV+YLLRRL
Sbjct: 241 ITKEVEVEYLLRRL 254

>Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement
          Length = 1830

 Score = 32.7 bits (73), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 142 SVATIDIECLQSLSRRIHFGKFVAEAKFQADRALYSKMIKERDLDGIYRSITNSAVE 198
           S+ TID E L +L+R ++ G +VAE +++A +  ++    E  LD    SI  +A +
Sbjct: 289 SIVTIDFEPLLALARCLYEGAWVAE-RYEATKDFFATNPPESSLDPTVTSIIKTATK 344

>Kwal_55.21788
          Length = 749

 Score = 31.2 bits (69), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 33/67 (49%)

Query: 185 LDGIYRSITNSAVEEKILERLCLKAEVYGVDPSNKEGYRKITPEYLVKIYKELVIPLTKK 244
           LD   ++    A   K +E++ ++     +D S  + YR   PE +V+ YK+ ++P   K
Sbjct: 239 LDAQRKAFEEVAKATKGVEKMTIETSESRLDDSEDDDYRPSIPEPVVRSYKKAIVPTKPK 298

Query: 245 VEVDYLL 251
             +D  L
Sbjct: 299 KPIDLEL 305

>Kwal_27.11951
          Length = 1869

 Score = 28.9 bits (63), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 143 VATIDIECLQSLSRRIHFGKFVAEAKFQADRALYSKMIKERDLD 186
           V  +D E L  L+R ++ G +VAE +++A R  ++K   E  LD
Sbjct: 330 VVEVDFEPLLELARCLYEGAWVAE-RYEATRDFFAKNPSESSLD 372

>CAGL0I09614g 917707..920826 highly similar to tr|Q08773
           Saccharomyces cerevisiae YOR304w ISW2 or sp|P38144
           Saccharomyces cerevisiae YBR245c ISW1, hypothetical
           start
          Length = 1039

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 4/44 (9%)

Query: 166 EAKFQA-DRALYSKMIKERDLDGIYRSITNSAVEEKILERLCLK 208
           +A  QA DRA     I ++    +YR +T +A+EEK+LER   K
Sbjct: 540 QADLQAMDRA---HRIGQKKQVHVYRFVTENAIEEKVLERAAQK 580

>Kwal_55.21179
          Length = 533

 Score = 28.5 bits (62), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 31/72 (43%), Gaps = 5/72 (6%)

Query: 32  ERSHFPTCPTVYKEKDPNL-----PLPDFDGSFLDWALMHSEITHSQLRRFESPDQTPFF 86
           E+  F  C  VY      L      +P      LD   ++ ++   +   F S D  PFF
Sbjct: 82  EKLFFQWCRKVYGSFKAKLLYCIASIPYETSLALDCLDVYMQLLEQEATYFASQDGAPFF 141

Query: 87  PDKILKPILPSI 98
           P+K LK ++ S+
Sbjct: 142 PNKTLKALIVSL 153

>KLLA0E15356g complement(1359509..1361590) some similarities with
           sp|Q8NIZ7 Neurospora crassa Related to
           peptide-n4-(n-acetyl-beta-d-glucosaminyl)
           asparaginaseamidase N, hypothetical start
          Length = 693

 Score = 28.5 bits (62), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%)

Query: 127 PMVSKFDGESWENFGSVATIDIECLQS-LSRRIHFGKFVAEAKFQAD 172
           P++S  D  SW   GSV  +DI+  +S LS +   G+ V   K+  D
Sbjct: 555 PIISLVDKASWNLVGSVRMLDIDVSKSELSYKATVGRTVDRLKYIKD 601

>YMR076C (PDS5) [4035] chr13 complement(416195..420028) Protein
           required for sister chromatid cohesion and chromosome
           condensation functions [3834 bp, 1277 aa]
          Length = 1277

 Score = 28.5 bits (62), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 16/72 (22%), Positives = 37/72 (51%), Gaps = 14/72 (19%)

Query: 107 YAAEINLNQEIKAVYIEQIIP--------------MVSKFDGESWENFGSVATIDIECLQ 152
           Y  ++N+N+++ +V  E ++P              ++S FD +++ +F +     I+   
Sbjct: 458 YINDLNINEQVDSVIFEYLLPFEPDNDKRVHRLLTVLSHFDKKAFTSFFAFNARQIKISF 517

Query: 153 SLSRRIHFGKFV 164
           ++S+ I F KF+
Sbjct: 518 AISKYIDFSKFL 529

>AER078W [2583] [Homologous to ScYLR407W - SH]
           complement(780901..781554) [654 bp, 217 aa]
          Length = 217

 Score = 27.7 bits (60), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 11/38 (28%), Positives = 26/38 (68%), Gaps = 3/38 (7%)

Query: 218 NKEGYRKITPEYLVKIYKELVI---PLTKKVEVDYLLR 252
           ++  +RKI P Y  +IY++LV+   PL++ + ++ +++
Sbjct: 160 HRASFRKIKPHYYPRIYRKLVLDDRPLSQPINLEDVMK 197

>Scas_721.40
          Length = 1834

 Score = 28.5 bits (62), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 142 SVATIDIECLQSLSRRIHFGKFVAEAKFQADRALYSKMIKERDLDGIYRSITNSA 196
           ++  ID E L  L+R ++ G +VAE ++ A +    K    +  D + +SI +SA
Sbjct: 293 NITKIDFEPLLELARCLYEGPWVAE-RYSAVKDFLQKNPSSKGFDHVVKSIIDSA 346

>Scas_712.15
          Length = 264

 Score = 27.7 bits (60), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 5/80 (6%)

Query: 105 SSYAAEINLNQEIKAVYIEQIIPMVSKFDGESWEN-FGSVATIDIECLQSLSRRIHFGKF 163
           S+Y A  N    +K VY   + P+   F  ES  +   S  + D+     ++  IH    
Sbjct: 102 SNYEARPN----VKQVYHTAVSPVSGDFGHESASSSINSEKSQDMRIATQVNPAIHDPNV 157

Query: 164 VAEAKFQADRALYSKMIKER 183
            A+  F  +   YS+++K R
Sbjct: 158 TADQPFYVNAKQYSRILKRR 177

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.139    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,881,904
Number of extensions: 397707
Number of successful extensions: 1047
Number of sequences better than 10.0: 25
Number of HSP's gapped: 1044
Number of HSP's successfully gapped: 25
Length of query: 254
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 155
Effective length of database: 13,168,927
Effective search space: 2041183685
Effective search space used: 2041183685
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 60 (27.7 bits)