Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_27.1259930430015930.0
Sklu_1926.230530212051e-168
Scas_667.2230630211951e-166
YPR058W (YMC1)30730311941e-166
CAGL0D01606g30530111761e-163
KLLA0B08503g30330010831e-149
Kwal_33.129883033009871e-135
Scas_718.53243209861e-134
YBR104W (YMC2)3293239861e-134
Kwal_56.230113033009731e-133
Sklu_1275.13113009731e-133
Sklu_2398.43093009711e-132
CAGL0K12210g3113079621e-131
KLLA0F17864g3072978761e-118
ADL264C3292833533e-39
KLLA0C13431g3283103482e-38
Scas_697.473282913438e-38
CAGL0B04543g3173143374e-37
Kwal_23.29133202963236e-35
Sklu_2127.52782803199e-35
YOR100C (CRC1)3272933211e-34
Kwal_55.213353172853096e-33
YOR130C (ORT1)2923033069e-33
Scas_632.92923012945e-31
AFR146W2812922927e-31
Kwal_33.154463052902893e-30
KLLA0E02772g2842892822e-29
Scas_714.183053042791e-28
KLLA0E13453g9062782863e-28
Sklu_2075.33452962774e-28
AGL311C3622892784e-28
KLLA0E09680g3072792737e-28
ADL049W9122782775e-27
Sklu_2359.69022772766e-27
Scas_691.43343132642e-26
YPR021C (AGC1)9022782703e-26
Kwal_47.173218812812703e-26
CAGL0B03883g3062912606e-26
CAGL0K10362g3012952571e-25
CAGL0K02365g9192782661e-25
Sklu_2334.23192892501e-24
YPL134C (ODC1)3103142465e-24
Scas_602.88852802483e-23
Sklu_2037.23103082291e-21
KLLA0F03212g3052882263e-21
YJR095W (SFC1)3222922255e-21
ACR109W2992882246e-21
YOR222W (ODC2)3072962212e-20
Kwal_26.86692962862183e-20
Kwal_47.182163333142151e-19
Kwal_0.2322742812094e-19
CAGL0J02002g3612882091e-18
Scas_640.253062942062e-18
Scas_662.123083072027e-18
CAGL0M09020g3483181975e-17
YIL134W (FLX1)3113031956e-17
KLLA0D07073g2973011921e-16
ACR260W3113231922e-16
YIL006W3732881923e-16
YJL133W (MRS3)3143101861e-15
Kwal_23.47313142961851e-15
KLLA0F04697g3072971842e-15
Scas_582.73292931815e-15
Scas_709.93652871825e-15
Scas_558.22892821805e-15
KLLA0E15532g3263251772e-14
CAGL0J04114g3032991762e-14
Scas_716.293163231753e-14
Scas_589.103163131744e-14
Sklu_2442.82752811725e-14
CAGL0H03839g2822791718e-14
Kwal_33.140503143211719e-14
CAGL0G03135g3072911702e-13
CAGL0G08910g2892791682e-13
CAGL0G01166g2952741682e-13
Scas_717.203563351683e-13
Kwal_27.120813693001684e-13
YNL003C (PET8)2842741656e-13
AGL065C3353151666e-13
YPR011C3263141649e-13
Sklu_2431.53703021641e-12
YKR052C (MRS4)3043131631e-12
Sklu_2363.23233081631e-12
CAGL0K08250g2972891621e-12
YEL006W3352951622e-12
AGL047C3162911612e-12
AAL014C2712731602e-12
Scas_379.23012021593e-12
AER366W2932941567e-12
YGR096W (TPC1)3143011551e-11
CAGL0L05742g3053071551e-11
Kwal_26.79672972871541e-11
CAGL0J01661g3272961551e-11
ADL009W3792941552e-11
CAGL0K02915g3423181542e-11
Sklu_1149.22962861523e-11
Scas_721.273743051524e-11
Kwal_55.208683802941515e-11
YNL083W5451901525e-11
Sklu_2432.52882761505e-11
KLLA0D14036g4313441516e-11
CAGL0M05225g3813021481e-10
KLLA0C11363g5173321472e-10
KLLA0E23705g3682561453e-10
CAGL0F07711g3682801428e-10
CAGL0H10538g2971891419e-10
YHR002W (LEU5)3573201419e-10
AEL253W3653001419e-10
KLLA0B12826g3192751411e-09
YLR348C (DIC1)2982791401e-09
YBR291C (CTP1)2992911401e-09
Sklu_2430.103242811401e-09
Scas_578.3*5243311402e-09
CAGL0K11616g3202791382e-09
YBR085W (AAC3)3071761382e-09
AER419W4932481392e-09
Kwal_23.30425421871393e-09
Kwal_23.43543432281373e-09
YBL030C (PET9)3181761364e-09
KLLA0D04950g2742811354e-09
Kwal_26.76533252871364e-09
Scas_489.42972971338e-09
KLLA0A09383g3662671331e-08
Kwal_27.114192981871321e-08
CAGL0J05522g5193321322e-08
CAGL0J09790g3002841302e-08
YBR192W (RIM2)3773481312e-08
Kwal_26.79723583131302e-08
YDL198C (YHM1)3002991302e-08
Scas_721.1293232781302e-08
Sklu_2374.75133331303e-08
AGR383W2933051284e-08
CAGL0F04213g3061891275e-08
YKL120W (OAC1)3241861275e-08
Scas_718.243371721275e-08
Kwal_27.116262992861251e-07
Scas_645.93912631251e-07
Kwal_14.22103152871241e-07
KLLA0D15015g3173011241e-07
Scas_702.103022761231e-07
KLLA0E18810g3772941232e-07
KLLA0E18788g3813271232e-07
Kwal_23.39653072991213e-07
KLLA0F13464g3002901204e-07
Sklu_2117.22982891195e-07
CAGL0L02079g2971871195e-07
Kwal_47.192282811401161e-06
Scas_562.123002871152e-06
AGR191W2982991142e-06
Sklu_2115.42992901133e-06
YMR056C (AAC1)3091711133e-06
AFR131C3443441125e-06
AER184W3051761116e-06
Scas_667.43081891107e-06
KLLA0E02750g3042501108e-06
Sklu_2260.53022541091e-05
Scas_705.93232931091e-05
YMR166C3682661081e-05
KLLA0E08877g2942931062e-05
Sklu_2433.84201561072e-05
Scas_669.63732761063e-05
KLLA0D04290g1881411024e-05
YGR257C (MTM1)3662601045e-05
AFR253W3441611036e-05
Kwal_27.124813041721027e-05
Scas_328.12271271009e-05
YJR077C (MIR1)3111981011e-04
AAR036W3173131001e-04
KLLA0E12353g305136992e-04
ADR036C340149992e-04
Sklu_2435.2344246992e-04
AFL196W361266992e-04
YFR045W285177982e-04
CAGL0F00231g307164982e-04
Scas_715.45305144964e-04
AGL064W296276955e-04
CAGL0C02013g329310955e-04
KLLA0D09889g364284956e-04
AFR147C315215920.001
Sklu_2127.4323213920.001
Kwal_55.21338323181910.002
Scas_673.17314207910.002
KLLA0A00979g343128910.002
KLLA0F08547g308135890.003
Sklu_1119.1307164880.004
Kwal_33.15597305203870.006
YPR128C (ANT1)32872870.006
AER450C308182860.008
YER053C300164850.009
KLLA0B14454g305187850.010
Scas_613.24177170830.011
Kwal_23.3529395265840.016
Kwal_34.15907312134820.024
CAGL0K07436g307135820.024
ABL023W309153790.060
AFR542W310134790.061
YMR241W (YHM2)314134770.088
Scas_696.9312147770.092
Kwal_23.5757307193770.10
AEL060C42990770.11
CAGL0F08305g374157760.14
Scas_687.15*328164750.19
KLLA0E22880g43679740.26
YDR470C (UGO1)502122720.43
CAGL0D04774g32268710.60
KLLA0D04312g10384670.62
YDL119C30767691.1
Kwal_55.2110632830681.2
YBR296C (PHO89)57456653.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.12599
         (300 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.12599                                                         618   0.0  
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement         468   e-168
Scas_667.22                                                           464   e-166
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...   464   e-166
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...   457   e-163
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...   421   e-149
Kwal_33.12988                                                         384   e-135
Scas_718.5                                                            384   e-134
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...   384   e-134
Kwal_56.23011                                                         379   e-133
Sklu_1275.1 , Contig c1275 314-1249                                   379   e-133
Sklu_2398.4 , Contig c2398 9476-10405                                 378   e-132
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...   375   e-131
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...   342   e-118
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...   140   3e-39
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...   138   2e-38
Scas_697.47                                                           136   8e-38
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...   134   4e-37
Kwal_23.2913                                                          129   6e-35
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement        127   9e-35
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...   128   1e-34
Kwal_55.21335                                                         123   6e-33
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...   122   9e-33
Scas_632.9                                                            117   5e-31
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...   117   7e-31
Kwal_33.15446                                                         115   3e-30
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...   113   2e-29
Scas_714.18                                                           112   1e-28
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...   114   3e-28
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement               111   4e-28
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...   111   4e-28
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...   109   7e-28
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....   111   5e-27
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                         110   6e-27
Scas_691.4                                                            106   2e-26
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...   108   3e-26
Kwal_47.17321                                                         108   3e-26
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...   104   6e-26
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...   103   1e-25
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...   107   1e-25
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement        100   1e-24
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    99   5e-24
Scas_602.8                                                            100   3e-23
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         93   1e-21
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    92   3e-21
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...    91   5e-21
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...    91   6e-21
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...    90   2e-20
Kwal_26.8669                                                           89   3e-20
Kwal_47.18216                                                          87   1e-19
Kwal_0.232                                                             85   4e-19
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    85   1e-18
Scas_640.25                                                            84   2e-18
Scas_662.12                                                            82   7e-18
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    80   5e-17
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    80   6e-17
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    79   1e-16
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    79   2e-16
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    79   3e-16
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    76   1e-15
Kwal_23.4731                                                           76   1e-15
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    75   2e-15
Scas_582.7                                                             74   5e-15
Scas_709.9                                                             75   5e-15
Scas_558.2                                                             74   5e-15
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    73   2e-14
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    72   2e-14
Scas_716.29                                                            72   3e-14
Scas_589.10                                                            72   4e-14
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          71   5e-14
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    70   8e-14
Kwal_33.14050                                                          70   9e-14
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    70   2e-13
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    69   2e-13
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    69   2e-13
Scas_717.20                                                            69   3e-13
Kwal_27.12081                                                          69   4e-13
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    68   6e-13
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    69   6e-13
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    68   9e-13
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            68   1e-12
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    67   1e-12
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          67   1e-12
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    67   1e-12
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    67   2e-12
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    67   2e-12
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    66   2e-12
Scas_379.2                                                             66   3e-12
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    65   7e-12
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    64   1e-11
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    64   1e-11
Kwal_26.7967                                                           64   1e-11
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    64   1e-11
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    64   2e-11
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    64   2e-11
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         63   3e-11
Scas_721.27                                                            63   4e-11
Kwal_55.20868                                                          63   5e-11
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    63   5e-11
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       62   5e-11
KLLA0D14036g complement(1203522..1204817) some similarities with...    63   6e-11
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    62   1e-10
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    61   2e-10
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    60   3e-10
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    59   8e-10
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    59   9e-10
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    59   9e-10
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    59   9e-10
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    59   1e-09
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    59   1e-09
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    59   1e-09
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         59   1e-09
Scas_578.3*                                                            59   2e-09
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    58   2e-09
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    58   2e-09
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    58   2e-09
Kwal_23.3042                                                           58   3e-09
Kwal_23.4354                                                           57   3e-09
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    57   4e-09
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    57   4e-09
Kwal_26.7653                                                           57   4e-09
Scas_489.4                                                             56   8e-09
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    56   1e-08
Kwal_27.11419                                                          55   1e-08
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    55   2e-08
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    55   2e-08
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    55   2e-08
Kwal_26.7972                                                           55   2e-08
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    55   2e-08
Scas_721.129                                                           55   2e-08
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       55   3e-08
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    54   4e-08
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    54   5e-08
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    54   5e-08
Scas_718.24                                                            54   5e-08
Kwal_27.11626                                                          53   1e-07
Scas_645.9                                                             53   1e-07
Kwal_14.2210                                                           52   1e-07
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    52   1e-07
Scas_702.10                                                            52   1e-07
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    52   2e-07
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    52   2e-07
Kwal_23.3965                                                           51   3e-07
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    51   4e-07
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            50   5e-07
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    50   5e-07
Kwal_47.19228                                                          49   1e-06
Scas_562.12                                                            49   2e-06
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    49   2e-06
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            48   3e-06
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    48   3e-06
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    48   5e-06
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    47   6e-06
Scas_667.4                                                             47   7e-06
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    47   8e-06
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         47   1e-05
Scas_705.9                                                             47   1e-05
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    46   1e-05
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    45   2e-05
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       46   2e-05
Scas_669.6                                                             45   3e-05
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    44   4e-05
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    45   5e-05
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    44   6e-05
Kwal_27.12481                                                          44   7e-05
Scas_328.1                                                             43   9e-05
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    44   1e-04
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    43   1e-04
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    43   2e-04
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    43   2e-04
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         43   2e-04
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    43   2e-04
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    42   2e-04
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    42   2e-04
Scas_715.45                                                            42   4e-04
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    41   5e-04
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    41   5e-04
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    41   6e-04
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    40   0.001
Sklu_2127.4 , Contig c2127 6322-7293                                   40   0.001
Kwal_55.21338                                                          40   0.002
Scas_673.17                                                            40   0.002
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    40   0.002
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    39   0.003
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             39   0.004
Kwal_33.15597                                                          38   0.006
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    38   0.006
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    38   0.008
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    37   0.009
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    37   0.010
Scas_613.24                                                            37   0.011
Kwal_23.3529                                                           37   0.016
Kwal_34.15907                                                          36   0.024
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    36   0.024
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    35   0.060
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    35   0.061
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    34   0.088
Scas_696.9                                                             34   0.092
Kwal_23.5757                                                           34   0.10 
AEL060C [2446] [Homologous to NOHBY] (525069..526358) [1290 bp, ...    34   0.11 
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    34   0.14 
Scas_687.15*                                                           33   0.19 
KLLA0E22880g complement(2033077..2034387) similar to ca|CA2800|I...    33   0.26 
YDR470C (UGO1) [1287] chr4 complement(1399694..1401202) Protein ...    32   0.43 
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    32   0.60 
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    30   0.62 
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    31   1.1  
Kwal_55.21106                                                          31   1.2  
YBR296C (PHO89) [473] chr2 complement(796754..798478) High-affin...    30   3.7  

>Kwal_27.12599
          Length = 304

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/300 (100%), Positives = 300/300 (100%)

Query: 1   MPEETSSPLLIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTT 60
           MPEETSSPLLIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTT
Sbjct: 1   MPEETSSPLLIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTT 60

Query: 61  AVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLP 120
           AVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLP
Sbjct: 61  AVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLP 120

Query: 121 QYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLS 180
           QYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLS
Sbjct: 121 QYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLS 180

Query: 181 PTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVI 240
           PTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVI
Sbjct: 181 PTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVI 240

Query: 241 KSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAM 300
           KSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAM
Sbjct: 241 KSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAM 300

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score =  468 bits (1205), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 222/302 (73%), Positives = 258/302 (85%), Gaps = 3/302 (0%)

Query: 1   MPEETSSPLLIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTT 60
           M EE  +PL+IDD+D   HDS RV KDLLAGTAGG++QVL+GQPFDTTKVRLQTS+ PTT
Sbjct: 1   MTEELPTPLIIDDLDGA-HDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTT 59

Query: 61  AVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFF--RGSSADPHKTLT 118
           A++VVKKLVKNEG RGFYKGTLTPLVGVGACVS QFGVNEAMKRFF  R  ++ P++TL 
Sbjct: 60  ALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLG 119

Query: 119 LPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRG 178
           L QYY+CGF GG ANSFLASPIEHVRIRLQTQT +G  A+F GPLDCI KL AN +LMRG
Sbjct: 120 LLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRG 179

Query: 179 LSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLD 238
           L+PT+LRE+ GC  YFLTYEAL+AN++ KG++RS++P WKLCLFGA SG TLWL +YPLD
Sbjct: 180 LTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLD 239

Query: 239 VIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFEL 298
           VIKS+MQTD+L  P +GKN++QVA+ + +  G  SFFKGFGPTMLRAAPANGATFATFEL
Sbjct: 240 VIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFEL 299

Query: 299 AM 300
           AM
Sbjct: 300 AM 301

>Scas_667.22
          Length = 306

 Score =  464 bits (1195), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 223/302 (73%), Positives = 254/302 (84%), Gaps = 2/302 (0%)

Query: 1   MPEETSSPLLIDDIDQQP-HDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPT 59
           M EE  +P LIDD++  P HD+ RV+KDLLAGTAGG+AQVLVGQPFDTTKVRLQTS+TPT
Sbjct: 1   MSEEFPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60

Query: 60  TAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADP-HKTLT 118
           TA+EV++KL+KNEG +GFYKGTLTPL+GVGACVS QFGVNEAMKRFF   + D   + L+
Sbjct: 61  TAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILS 120

Query: 119 LPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRG 178
           LPQYYICG  GG+ NSFLASPIEHVRIRLQTQT SG   EFKGPLDCI KLRA G  MRG
Sbjct: 121 LPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRG 180

Query: 179 LSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLD 238
           L+PT+LRE  GC TYFL YEA+VAN+I KG  R++VPAWKLCLFGA+SG TLW+ VYPLD
Sbjct: 181 LTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLD 240

Query: 239 VIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFEL 298
           VIKS+MQTDNLK+P  G +I  VA+ + AK G  +FFKGFGPTMLRAAPANGATFATFEL
Sbjct: 241 VIKSVMQTDNLKSPKYGNSISSVAKTLYAKGGLGAFFKGFGPTMLRAAPANGATFATFEL 300

Query: 299 AM 300
           AM
Sbjct: 301 AM 302

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score =  464 bits (1194), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 225/303 (74%), Positives = 254/303 (83%), Gaps = 3/303 (0%)

Query: 1   MPEETSSPLLIDDIDQQP-HDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPT 59
           M EE  SP LIDD+++ P HD+ RV+KDLLAGTAGG+AQVLVGQPFDTTKVRLQTS+TPT
Sbjct: 1   MSEEFPSPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60

Query: 60  TAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTL 119
           TA+EVV+KL+ NEG RGFYKGTLTPL+GVGACVS QFGVNEAMKRFF   +AD   TL+L
Sbjct: 61  TAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSL 120

Query: 120 PQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGL 179
           PQYY CG  GG+ NSFLASPIEHVRIRLQTQT SGT AEFKGPL+CI KLR N AL+RGL
Sbjct: 121 PQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGL 180

Query: 180 SPTILREAQGCATYFLTYEALVANQIGK--GIARSDVPAWKLCLFGAVSGVTLWLTVYPL 237
           +PTILRE  GC TYFL YEAL+ANQ+ K  G+ R D+PAWKLC+FGA+SG  LWL VYPL
Sbjct: 181 TPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPL 240

Query: 238 DVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
           DVIKS+MQTDNL+ P  G +I  VA+ + A  G  +FFKGFGPTMLRAAPANGATFATFE
Sbjct: 241 DVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300

Query: 298 LAM 300
           LAM
Sbjct: 301 LAM 303

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score =  457 bits (1176), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 216/301 (71%), Positives = 249/301 (82%), Gaps = 1/301 (0%)

Query: 1   MPEETSSPLLIDDIDQQP-HDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPT 59
           M EE  +P LIDD++  P  D+GRV+KDLLAGTAGG+AQVL+GQPFDTTKVRLQTS  PT
Sbjct: 1   MSEEFPTPQLIDDLEDHPGQDNGRVVKDLLAGTAGGIAQVLIGQPFDTTKVRLQTSKVPT 60

Query: 60  TAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTL 119
           +A EVVK L+KNEG +GFYKGTLTPLVGVGACVS QFGVNEAMKRFF   + D + TL+L
Sbjct: 61  SAAEVVKNLLKNEGPKGFYKGTLTPLVGVGACVSIQFGVNEAMKRFFHARNVDHNATLSL 120

Query: 120 PQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGL 179
            QYY+CG  GG+ NSFLASPIEHVRIRLQTQT SG  AEFKGP+DCI KLR+   LMRGL
Sbjct: 121 SQYYLCGLTGGMTNSFLASPIEHVRIRLQTQTGSGAQAEFKGPIDCIKKLRSQKGLMRGL 180

Query: 180 SPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDV 239
            PT+LRE  GC TYFL YEALV+ QI +G+ R+++P WKLCL+GA+SG  LWL VYP+DV
Sbjct: 181 IPTMLREGHGCGTYFLVYEALVSKQINQGLKRTEIPPWKLCLYGALSGTALWLMVYPIDV 240

Query: 240 IKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELA 299
           +KS+MQTDNL  P  GKN+IQVAR + A+ G K+FFKGFGPTMLRAAPANG TFATFELA
Sbjct: 241 VKSVMQTDNLNKPQNGKNMIQVARNLYAREGLKAFFKGFGPTMLRAAPANGGTFATFELA 300

Query: 300 M 300
           M
Sbjct: 301 M 301

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score =  421 bits (1083), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 213/300 (71%), Positives = 237/300 (79%), Gaps = 1/300 (0%)

Query: 1   MPEETSSPLLIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTT 60
           M EE  +P LIDD++  PHD+ RV+KDLLAGTAGG+AQVLVGQPFDTTKVRLQTS T T 
Sbjct: 1   MTEEFPTPQLIDDLES-PHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTN 59

Query: 61  AVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLP 120
           AV+V+K L+KNEG  GFYKGTLTPLVGVGACVS QFGVNEAMKRFF        + L+L 
Sbjct: 60  AVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLL 119

Query: 121 QYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLS 180
           QYYICG  GG  NSFLASPIEH+RIRLQTQT SG  AEFKGP+DCI KLR NG LMRGL+
Sbjct: 120 QYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLT 179

Query: 181 PTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVI 240
           PT+LRE+ GC  YFLTYEAL+ +Q+  GI R D+PAWKLCLFGA SG  LW  VYPLDVI
Sbjct: 180 PTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVI 239

Query: 241 KSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAM 300
           KS+MQTDNLK P  G NI+ V R + A+ G    FKGF PTMLRAAPAN ATFATFE AM
Sbjct: 240 KSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLRAAPANAATFATFETAM 299

>Kwal_33.12988
          Length = 303

 Score =  384 bits (987), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 183/300 (61%), Positives = 223/300 (74%), Gaps = 1/300 (0%)

Query: 1   MPEETSSPLLIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTT 60
           M +E + P ++DD+  +  D  R LKD+ AGT GG+AQVLVGQPFD TKVRLQTS+TPTT
Sbjct: 1   MSDELTMPQVVDDLTDK-SDIRRTLKDITAGTTGGIAQVLVGQPFDITKVRLQTSSTPTT 59

Query: 61  AVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLP 120
           A+ VV+ LVKNEGLRGFYKGT  PL+GVG CVS QFG NEAMKR+F   +     +L LP
Sbjct: 60  ALRVVQDLVKNEGLRGFYKGTTLPLIGVGLCVSSQFGTNEAMKRYFHKRNNFQSTSLRLP 119

Query: 121 QYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLS 180
           +YY CGFV G AN+FLA+PIEHVRI LQ QT S   AE++G +DCI KL   G LMRG +
Sbjct: 120 EYYACGFVSGCANAFLATPIEHVRILLQVQTKSRADAEYQGAMDCIKKLLKEGKLMRGFT 179

Query: 181 PTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVI 240
           PTILR + G   YF +YEA++ ++  KGIAR D+PAWKLCL+GA SG  LW  VYP DVI
Sbjct: 180 PTILRTSHGFGVYFTSYEAMICSEQRKGIARKDIPAWKLCLYGAFSGSLLWAMVYPFDVI 239

Query: 241 KSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAM 300
           KS+MQ+D L+ PV G N+ QVA+ +  + G K+F KGFGPTMLR+ P NGATF  FE+AM
Sbjct: 240 KSVMQSDKLRTPVYGTNVFQVAKNIYNERGPKAFVKGFGPTMLRSLPVNGATFTAFEMAM 299

>Scas_718.5
          Length = 324

 Score =  384 bits (986), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 190/320 (59%), Positives = 229/320 (71%), Gaps = 20/320 (6%)

Query: 1   MPEETSSPLLIDDIDQQ---------------PHDSGRVLKDLLAGTAGGMAQVLVGQPF 45
           M E+ SSP LI++ D +                 DS RVLKD+LAGT GG++QV+VGQPF
Sbjct: 1   MSEDFSSPQLINEFDDEMASNGNDNNGSSHSMAKDSTRVLKDILAGTCGGISQVIVGQPF 60

Query: 46  DTTKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRF 105
           DTTKVR+QTS     A+++++KLVKNEG+  FYKG+L P+VGVGACVS QFGVNEAMKRF
Sbjct: 61  DTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRF 120

Query: 106 FRG---SSADPHK--TLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFK 160
           FR    S    H+  TL L QYYICG  GGV NSFLASPIEHVRIRLQTQT +G   EFK
Sbjct: 121 FREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFK 180

Query: 161 GPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLC 220
           GPLDCI KL    +LMRGL P +LR   G   YFLTYEAL+AN+I KG  RS++ +WKLC
Sbjct: 181 GPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLC 240

Query: 221 LFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGP 280
            +G++SGV LWL +YPLDV+KS++QTD L+NP    ++  V   +  + G  +FFKGF P
Sbjct: 241 SYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAP 300

Query: 281 TMLRAAPANGATFATFELAM 300
           TMLRAAP NGATF TFEL M
Sbjct: 301 TMLRAAPVNGATFVTFELVM 320

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score =  384 bits (986), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 196/323 (60%), Positives = 239/323 (73%), Gaps = 23/323 (7%)

Query: 1   MPEETSSPLLIDDIDQQ-----PHD-----SGRVLKDLLAGTAGGMAQVLVGQPFDTTKV 50
           M EE  +P L+D+++ Q     P++     S RVLKD+ AGT GG+AQVLVGQPFDTTKV
Sbjct: 1   MSEEFPTPQLLDELEDQQKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDTTKV 60

Query: 51  RLQTSTTPTTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRG-- 108
           RLQT+TT TT +EV++ LVKNEG+  FYKG LTPL+GVG CVS QFGVNEAMKRFF+   
Sbjct: 61  RLQTATTRTTTLEVLRNLVKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYN 120

Query: 109 SSADPH-----------KTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVA 157
           +S +P+            TL L QYY+CG  GGV NSFLASPIE +RIRLQTQT++G   
Sbjct: 121 ASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDR 180

Query: 158 EFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAW 217
           EFKGP DCI KL+A G LMRGL PT++R   G  TYFL YEALVA +IG G+ R+++P W
Sbjct: 181 EFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPW 240

Query: 218 KLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKG 277
           KLCLFGA SG  LWLTVYPLDV+KS++Q D+L+ P    +I  VA+ + AK G ++FFKG
Sbjct: 241 KLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKG 300

Query: 278 FGPTMLRAAPANGATFATFELAM 300
           FGPTM+R+AP NGATF TFEL M
Sbjct: 301 FGPTMVRSAPVNGATFLTFELVM 323

>Kwal_56.23011
          Length = 303

 Score =  379 bits (973), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 180/300 (60%), Positives = 218/300 (72%), Gaps = 1/300 (0%)

Query: 1   MPEETSSPLLIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTT 60
           M EE +SP ++DD+    HD  + LKD+  GT GG+AQVLVGQPFD TKVRLQTS  PTT
Sbjct: 1   MSEELTSPQVVDDL-VDTHDFKQALKDVFCGTVGGVAQVLVGQPFDITKVRLQTSPVPTT 59

Query: 61  AVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLP 120
           A +V+K LVKNEGL  FYKGTL PL GVGACVSCQFGVNEA+K++FR    +  + L L 
Sbjct: 60  AAQVIKSLVKNEGLLAFYKGTLAPLAGVGACVSCQFGVNEALKKWFRKKDGNFDQPLALR 119

Query: 121 QYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLS 180
           QYY CGFV G AN+FLA+PIEHVRIRLQ QTAS + AE+ G LDC  KL   GALMRG +
Sbjct: 120 QYYACGFVSGTANAFLATPIEHVRIRLQLQTASSSAAEYHGSLDCARKLLKQGALMRGFT 179

Query: 181 PTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVI 240
            T LR + G   YFLTYE L+ANQ   G+ R ++PAWK+C++GA SG   W   YP DV+
Sbjct: 180 ATTLRTSHGFGIYFLTYETLIANQAHHGVLRENIPAWKVCVYGAFSGAFFWAMTYPFDVV 239

Query: 241 KSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAM 300
           KS+MQ D LKNPV G+N + VA+ +  + G ++F KGF PTMLR+ P NGATFA FE+ M
Sbjct: 240 KSVMQADKLKNPVYGRNPLAVAKAIYRERGPRAFTKGFTPTMLRSLPVNGATFAAFEITM 299

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score =  379 bits (973), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 175/300 (58%), Positives = 223/300 (74%), Gaps = 1/300 (0%)

Query: 1   MPEETSSPLLIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTT 60
           M +E ++P ++DD+   P +  + +KD+++GT+GG+AQVLVGQPFD TKVR+QTS+   T
Sbjct: 1   MSDELTTPQVVDDLSDAP-EFRKAIKDIISGTSGGIAQVLVGQPFDITKVRMQTSSGSPT 59

Query: 61  AVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLP 120
           A+EV+K LVKNEGL  FYKGTL PL+GVGACVSCQFGVNEAMKR+F   +    + L+L 
Sbjct: 60  AIEVIKNLVKNEGLLAFYKGTLVPLIGVGACVSCQFGVNEAMKRYFLRVNGYKDQHLSLL 119

Query: 121 QYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLS 180
           QYY CGFV G AN+FLA+PIEHVRIRLQ QT +   AE++G LDC+ KL    ALMRG +
Sbjct: 120 QYYTCGFVSGSANAFLATPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQKALMRGFT 179

Query: 181 PTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVI 240
            T++R + G   YFLTYEAL+ NQ   G+ R D+P WK+C+FGA SG   W   YP DV+
Sbjct: 180 ATLMRTSHGFGVYFLTYEALIMNQNKNGVLRKDIPPWKVCVFGAFSGAFFWAMTYPFDVV 239

Query: 241 KSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAM 300
           KS+MQ D L +PV GKN+ QVA+ ++A  GW +F KGF PTMLR+ P NGATFATFE+ M
Sbjct: 240 KSIMQADRLVSPVHGKNVFQVAKSIHATRGWGAFVKGFVPTMLRSLPVNGATFATFEVTM 299

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score =  378 bits (971), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 179/300 (59%), Positives = 220/300 (73%), Gaps = 1/300 (0%)

Query: 1   MPEETSSPLLIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTT 60
           M +E ++P ++DD+     D  R +KD+L+GTAGG+AQVLVGQPFD TKVR+QTS    T
Sbjct: 1   MSDELTAPQVVDDLSDS-LDYKRAIKDILSGTAGGIAQVLVGQPFDITKVRMQTSAGSAT 59

Query: 61  AVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLP 120
           AV+VV  L+KNEG+ GFYKGTL PLVGVGACVSCQFGVNEAMKR FR  + DP K L+L 
Sbjct: 60  AVDVVTSLIKNEGILGFYKGTLAPLVGVGACVSCQFGVNEAMKRRFRRMNGDPSKPLSLK 119

Query: 121 QYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLS 180
           QYY+CG   G AN+FLA+PIEHVRIRLQ QT S   AE++G LDC+ KL   GALMRG +
Sbjct: 120 QYYVCGVASGCANAFLATPIEHVRIRLQLQTKSLANAEYQGSLDCMRKLLKQGALMRGFT 179

Query: 181 PTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVI 240
            T++R   G   YF TYEAL+ANQ  KGI R D+  WK+C+FGA SG   W   YP+DV+
Sbjct: 180 ATLMRTCHGFGIYFSTYEALIANQHKKGIPRKDIAPWKVCIFGAFSGACYWAMAYPIDVV 239

Query: 241 KSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAM 300
           KS+MQ+D L +PV G N+ QVA+ +    G ++F KGF P MLR+ P NGATFATFE+ M
Sbjct: 240 KSIMQSDRLVSPVHGTNVWQVAKSIYTTRGKRAFIKGFMPAMLRSLPVNGATFATFEMTM 299

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score =  375 bits (962), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 182/307 (59%), Positives = 226/307 (73%), Gaps = 7/307 (2%)

Query: 1   MPEETSSPLLIDDIDQQPHDS--GRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTP 58
           M EE  +P L+++++  P  +  GRV+KD+ AGT GG+AQVLVGQPFDTTKVRLQTS T 
Sbjct: 1   MSEEFPTPQLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK 60

Query: 59  TTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSAD---PHK 115
              +EVV+ L++NEG   FYKG LTPL+GVG CVS QFGVNE+MKRFF   +AD   P K
Sbjct: 61  IGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQK 120

Query: 116 TLTLP--QYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANG 173
            + LP  QYY+CG  GGV NSFLA+PIEHVRIRLQTQT+ G   +FKGP DCI KL    
Sbjct: 121 HVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK 180

Query: 174 ALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLT 233
           ALMRGL PT++R   G  TYF  YEALV  +  KG  R+ +PAWKLC FGA+SG  LWLT
Sbjct: 181 ALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLT 240

Query: 234 VYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATF 293
           VYP+DV+KS++QTD+++NP    +II+  R +  ++G  +FFKGF PTM+RAAPAN ATF
Sbjct: 241 VYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATF 300

Query: 294 ATFELAM 300
            +FE+ M
Sbjct: 301 VSFEMTM 307

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score =  342 bits (876), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 164/297 (55%), Positives = 204/297 (68%), Gaps = 4/297 (1%)

Query: 7   SPLLIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVK 66
           +P +++D+    H   + LKD+ +GT GG+AQVLVGQPFD  KVRLQT     TA E + 
Sbjct: 8   TPQVVEDL-TDLHGFRKTLKDVFSGTVGGVAQVLVGQPFDIIKVRLQTMPGNATAWEAIT 66

Query: 67  KLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRG---SSADPHKTLTLPQYY 123
            LVK EG  GFYKGT+ PLVGVGACVSCQFG+NEAMKR+FR    S      TL+L QYY
Sbjct: 67  DLVKYEGFMGFYKGTMAPLVGVGACVSCQFGINEAMKRYFRDLNRSRGIYDNTLSLGQYY 126

Query: 124 ICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSPTI 183
            CGFV G AN+ LA+PIEHVRIRLQ Q  +   AE+K  LDC  KL   G+LMRG + T+
Sbjct: 127 TCGFVSGSANALLATPIEHVRIRLQLQKEALANAEYKSTLDCTEKLLKQGSLMRGFTATL 186

Query: 184 LREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSL 243
           +R + G   YFLTYE L+A+Q+  G  R D+ AWK C+FGA+SG   W   YP DV+KS+
Sbjct: 187 MRTSHGFGIYFLTYETLIASQLAHGFRREDISAWKACMFGALSGAFFWAMTYPFDVVKSV 246

Query: 244 MQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAM 300
           MQ D L NP  G N++QVA+ +  + G ++F KGF PTMLR+ P NGATFA FE+ M
Sbjct: 247 MQADKLVNPAYGTNVVQVAKNIYRERGLRAFTKGFMPTMLRSLPVNGATFAAFEVTM 303

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score =  140 bits (353), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 94/283 (33%), Positives = 143/283 (50%), Gaps = 22/283 (7%)

Query: 26  KDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNEG---------LRG 76
           K L AG  GG+  VL G PFD  KVR Q++    T   V K LV+            +RG
Sbjct: 49  KSLAAGAVGGVCAVLTGHPFDLLKVRCQSNQASGTVDAVRKILVEARAQSGLSAVNMMRG 108

Query: 77  FYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFL 136
           FYKG + PL+GV    +  F   +  K+    +  D    LT  Q    GF+  +  + +
Sbjct: 109 FYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTWN--DNSGKLTTAQLATAGFISAIPTTLV 166

Query: 137 ASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLT 196
            +P E V++ LQTQ+     +  K  L     +R+   L RG   T+ R+  G A YF +
Sbjct: 167 MAPTERVKVVLQTQSNHSLGSAAKHIL-ATGGVRS---LFRGSLATLARDGPGSALYFAS 222

Query: 197 YEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGK 256
           YEA  A    +    +++    +CL G ++GV++W+ V+P+D IK+ +Q+ N +     +
Sbjct: 223 YEATKAYLNARS-GTNELSIKNVCLAGGMAGVSMWVGVFPIDTIKTELQSSNTR-----Q 276

Query: 257 NIIQVAR-LVNAKYGWKSFFKGFGPTMLRAAPANGATFATFEL 298
            +++  R + N + G K FF G GP +LR+ PAN ATF   EL
Sbjct: 277 TMMEATRKIYNTRGGIKGFFPGIGPALLRSFPANAATFLGVEL 319

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score =  138 bits (348), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 92/310 (29%), Positives = 154/310 (49%), Gaps = 34/310 (10%)

Query: 11  IDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVK 70
           ++D+ Q        LK L AG  GG+  VL G PFD  KVR Q S    +A++ V  +++
Sbjct: 15  VNDVSQTKSQLTENLKSLAAGGVGGVCAVLTGHPFDLVKVRCQ-SNQARSAMDAVSHILQ 73

Query: 71  N----------EGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRG---------SSA 111
                        +RGFYKG + PL+GV    +  F   +  K+             ++ 
Sbjct: 74  AARQAAGPTSLNAVRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAV 133

Query: 112 DPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRA 171
           +P   LTL Q    GF+  +  + + +P E V++ LQT       A F      I + + 
Sbjct: 134 EPE--LTLSQMAAAGFISAIPTTLVTAPTERVKVVLQTTQGK---ASFLDAAKQIVRTQG 188

Query: 172 NGALMRGLSPTILREAQGCATYFLTYEALVANQIGK--GIARSDVPAWKLCLFGAVSGVT 229
             +L +G   T+ R+  G A YF +YE +    + K  G    ++    +C+ G ++GV+
Sbjct: 189 FQSLFKGSLATLSRDGPGSALYFASYE-ICKEYLNKASGHTSGELSITNVCISGGMAGVS 247

Query: 230 LWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLV-NAKYGWKSFFKGFGPTMLRAAPA 288
           +W+ V+P+D +K+ +Q+ +     + +++++V R++ N + G K FF G GP +LR+ PA
Sbjct: 248 MWVVVFPIDTVKTQLQSSS-----KRQSMLEVTRMIYNTRGGIKGFFPGVGPAILRSFPA 302

Query: 289 NGATFATFEL 298
           N ATF   EL
Sbjct: 303 NAATFLGVEL 312

>Scas_697.47
          Length = 328

 Score =  136 bits (343), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 91/291 (31%), Positives = 149/291 (51%), Gaps = 26/291 (8%)

Query: 25  LKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKN-----------EG 73
           LK L+AG  GG+  VL G PFD  KVR Q+    +T +  +K ++K+             
Sbjct: 37  LKSLVAGGVGGVCAVLTGHPFDLIKVRCQSGQASST-IHAIKIILKDARAIPTSNMLVNS 95

Query: 74  LRGFYKGTLTPLVGVGACVSCQF-GVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVA 132
           ++GFYKG + PL+GV    +  F G +   K   R  S+     LT+ Q    GF+  + 
Sbjct: 96  VKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTRSDSSSAQ--LTMGQMAAAGFISAIP 153

Query: 133 NSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCAT 192
            + + +P E +++ LQT  A+   + F G    I K     +L +G   T+ R+  G A 
Sbjct: 154 TTLVTAPTERIKVVLQTAGANSKTS-FIGAAKNIVKDGGVKSLFKGSLATLARDGPGSAL 212

Query: 193 YFLTYE---ALVANQIGKGIARS-DVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDN 248
           YF +YE     + ++     +++ +V    +CL G ++G+++WL V+P+D IK+ +Q+ +
Sbjct: 213 YFASYEISKKFLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPIDTIKTKLQSSS 272

Query: 249 LKNPVRGKNIIQVARLVNAKY-GWKSFFKGFGPTMLRAAPANGATFATFEL 298
                  ++++   R +  K  G K FF G GP +LR+ PAN ATF   EL
Sbjct: 273 -----GSQSMVAATREIYVKRGGIKGFFPGLGPALLRSFPANAATFLGVEL 318

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 82/189 (43%), Gaps = 22/189 (11%)

Query: 124 ICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALM------- 176
           + G VGGV       P + +++R Q+  AS T+   K  L     +  +  L+       
Sbjct: 41  VAGGVGGVCAVLTGHPFDLIKVRCQSGQASSTIHAIKIILKDARAIPTSNMLVNSVKGFY 100

Query: 177 RGLSPTILREAQGCATYFLTYEALVANQIGKGIA-RSDVPAWKLCL-----FGAVSGVTL 230
           +G+ P +L      A  F  Y+      +GK I  RSD  + +L +      G +S +  
Sbjct: 101 KGVIPPLLGVTPIFAVSFWGYD------VGKKIVTRSDSSSAQLTMGQMAAAGFISAIPT 154

Query: 231 WLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANG 290
            L   P + IK ++QT    +     + I  A+ +    G KS FKG   T+ R  P + 
Sbjct: 155 TLVTAPTERIKVVLQTAGANSKT---SFIGAAKNIVKDGGVKSLFKGSLATLARDGPGSA 211

Query: 291 ATFATFELA 299
             FA++E++
Sbjct: 212 LYFASYEIS 220

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score =  134 bits (337), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 99/314 (31%), Positives = 157/314 (50%), Gaps = 43/314 (13%)

Query: 13  DIDQQPHDSGRV-LKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTT--AVEVVKK-- 67
           +I +   D+ R  +K L+AG  GG+  VL G PFD  KVR Q++   +T  AV ++ K  
Sbjct: 9   NILEHKTDAFRENMKALVAGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAVSIILKEA 68

Query: 68  -------------LVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRF--FRGSSAD 112
                        L     ++GFYKG + PL+GV    +  F   +  KR   ++ +S  
Sbjct: 69  RSLSTVNGSLTTSLFFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRLVTWKQASDA 128

Query: 113 PHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGP-LDCINKLRA 171
           P   LT  Q    GF+  +  + + +P E +++ LQT +      EFKG  +     + +
Sbjct: 129 P---LTTAQMATAGFISAIPTTLVTAPTERIKVVLQTNS------EFKGSFIKAAKHIVS 179

Query: 172 NG---ALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSD---VPAWKLCLFGAV 225
            G   +L  G   T+ R+  G A YF +YE L    + K +A+ D   V    +CL G +
Sbjct: 180 TGGVKSLFNGSLATLARDGPGSALYFASYE-LSKAFLNKSVAKKDKDEVNLANVCLAGGI 238

Query: 226 SGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKY-GWKSFFKGFGPTMLR 284
           +G+++WL V+P+D IK+ +Q      P+   +++Q  + +  +  G K FF G GP +LR
Sbjct: 239 AGMSMWLVVFPIDTIKTRLQVAT--TPI---SMVQATKDIYIQRGGIKGFFPGLGPALLR 293

Query: 285 AAPANGATFATFEL 298
           + PAN ATF   EL
Sbjct: 294 SFPANAATFLGVEL 307

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 4   ETSSPLLIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVE 63
           E S   L   + ++  D   +    LAG   GM+  LV  P DT K RLQ +TTP + V+
Sbjct: 209 ELSKAFLNKSVAKKDKDEVNLANVCLAGGIAGMSMWLVVFPIDTIKTRLQVATTPISMVQ 268

Query: 64  VVKKL-VKNEGLRGFYKG 80
             K + ++  G++GF+ G
Sbjct: 269 ATKDIYIQRGGIKGFFPG 286

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 83/196 (42%), Gaps = 30/196 (15%)

Query: 124 ICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLR-ANGAL------- 175
           + G VGGV       P + +++R Q+  A  T+      L     L   NG+L       
Sbjct: 26  VAGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAVSIILKEARSLSTVNGSLTTSLFFK 85

Query: 176 ------MRGLSPTILREAQGCATYFLTYEALVANQIGKGIAR----SDVP--AWKLCLFG 223
                  +G+ P ++      A  F  Y+      IGK +      SD P    ++   G
Sbjct: 86  NSVKGFYKGVIPPLIGVTPIFAVSFWGYD------IGKRLVTWKQASDAPLTTAQMATAG 139

Query: 224 AVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTML 283
            +S +   L   P + IK ++QT++     +G + I+ A+ + +  G KS F G   T+ 
Sbjct: 140 FISAIPTTLVTAPTERIKVVLQTNS---EFKG-SFIKAAKHIVSTGGVKSLFNGSLATLA 195

Query: 284 RAAPANGATFATFELA 299
           R  P +   FA++EL+
Sbjct: 196 RDGPGSALYFASYELS 211

>Kwal_23.2913
          Length = 320

 Score =  129 bits (323), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 88/296 (29%), Positives = 144/296 (48%), Gaps = 36/296 (12%)

Query: 25  LKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTT--AVEVVKKLVKNEG-------LR 75
            + L AG  GG+  VL G PFD  KVR Q++    T  A+  V    K++        ++
Sbjct: 29  FESLAAGGVGGVCAVLTGHPFDLLKVRCQSNQASGTLDAISRVLHEAKSKSGPLPLNQIK 88

Query: 76  GFYKGTLTPLVGVGACVSCQFGVNEAMKRFFR---------GSSADPHKTLTLPQYYICG 126
           GFY+G + PL+GV    +  F   +  KR              S+     LT  Q  + G
Sbjct: 89  GFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKLTPLTTSQLALAG 148

Query: 127 FVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSPTILRE 186
           F   +  + + +P E V++ LQT + SG+   F G    + +     +L +G   T+ R+
Sbjct: 149 FFSAIPTTLITAPTERVKVVLQT-SESGS---FLGAARTLIREGGVRSLFQGTLATLARD 204

Query: 187 AQGCATYFLTYEA----LVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKS 242
             G A YF +YE     L  NQ    ++        +C+ G V+G+++W+ V+P+D IK+
Sbjct: 205 GPGSALYFASYEVSKRFLSRNQDTDALS-----VVSICVAGGVAGMSMWIGVFPIDTIKT 259

Query: 243 LMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFEL 298
            +Q+ +     R ++++Q AR +  + G + FF G GP ++R+ PAN ATF   E 
Sbjct: 260 KLQSSS-----RSQSMVQAAREIYTRAGLRGFFPGLGPALMRSFPANAATFLGVEF 310

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 80/195 (41%), Gaps = 30/195 (15%)

Query: 125 CGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFK----------GPLDCINKLRANGA 174
            G VGGV       P + +++R Q+  ASGT+              GPL  +N+++    
Sbjct: 34  AGGVGGVCAVLTGHPFDLLKVRCQSNQASGTLDAISRVLHEAKSKSGPLP-LNQIKG--- 89

Query: 175 LMRGLSPTILREAQGCATYFLTYEA----------LVANQIGKGIARSDVPAWKLCLFGA 224
             RG+ P +L      A  F  Y+            V +  G     + +   +L L G 
Sbjct: 90  FYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKLTPLTTSQLALAGF 149

Query: 225 VSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLR 284
            S +   L   P + +K ++QT          + +  AR +  + G +S F+G   T+ R
Sbjct: 150 FSAIPTTLITAPTERVKVVLQTSE------SGSFLGAARTLIREGGVRSLFQGTLATLAR 203

Query: 285 AAPANGATFATFELA 299
             P +   FA++E++
Sbjct: 204 DGPGSALYFASYEVS 218

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%)

Query: 16  QQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNEGLR 75
            Q  D+  V+   +AG   GM+  +   P DT K +LQ+S+   + V+  +++    GLR
Sbjct: 225 NQDTDALSVVSICVAGGVAGMSMWIGVFPIDTIKTKLQSSSRSQSMVQAAREIYTRAGLR 284

Query: 76  GFYKG 80
           GF+ G
Sbjct: 285 GFFPG 289

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score =  127 bits (319), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 94/280 (33%), Positives = 134/280 (47%), Gaps = 22/280 (7%)

Query: 26  KDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTT---PTTAVEVVKKLVKNEGL-RGFYKGT 81
           KD+L G+  G    ++  PFDT KVRLQT      PTT    +K    NEGL RGFY+G 
Sbjct: 8   KDILYGSIAGAVGKVIEYPFDTVKVRLQTQPAHMFPTT-WSCIKFTYDNEGLWRGFYQGI 66

Query: 82  LTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLT-LPQYYICGFVGGVANSFLASPI 140
            +PL G     +  F      KR       D    L+ L +    G   G   SF+ +P+
Sbjct: 67  GSPLAGAALENAVLFVSFNQAKRLL-----DVESLLSPLSKTVWAGAFAGACASFVLTPV 121

Query: 141 EHVRIRLQTQTASGTVAEFKGPLDCINKL---RANGALMRGLSPTILREAQGCATYFLTY 197
           E ++ +LQ    S T       L  I  +   R    L +G S T +RE+ G A +F TY
Sbjct: 122 ELIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTY 181

Query: 198 EALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKN 257
           E +V N +           W+L   GA +G+    +++P D IKS MQTD++       +
Sbjct: 182 E-VVKNYLASRRQAEQNTTWELLASGASAGLAFNASIFPADTIKSTMQTDHI-------D 233

Query: 258 IIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
           +    R + A+ G   F++G G T++RA PAN A F T+E
Sbjct: 234 LSSATRKIYARQGIAGFYRGLGITLIRAVPANAAIFYTYE 273

 Score = 36.6 bits (83), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 68/181 (37%), Gaps = 13/181 (7%)

Query: 26  KDLLAGTAGGMAQVLVGQPFDTTKVRLQ------TSTTPTTAVEVVKKLVKNEGLRGFYK 79
           K + AG   G     V  P +  K +LQ      T T+ T  +  +K ++   G  G ++
Sbjct: 102 KTVWAGAFAGACASFVLTPVELIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQ 161

Query: 80  GTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASP 139
           G     +      +  F   E +K +   +S    +  T  +    G   G+A +    P
Sbjct: 162 GQSGTFIRESGGGAAWFTTYEVVKNYL--ASRRQAEQNTTWELLASGASAGLAFNASIFP 219

Query: 140 IEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYEA 199
            + ++  +QT     + A  K     I   +      RGL  T++R     A  F TYE 
Sbjct: 220 ADTIKSTMQTDHIDLSSATRK-----IYARQGIAGFYRGLGITLIRAVPANAAIFYTYET 274

Query: 200 L 200
           L
Sbjct: 275 L 275

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 37/82 (45%), Gaps = 2/82 (2%)

Query: 218 KLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKG 277
           K  L+G+++G    +  YP D +K  +QT          + I+     + +  W+ F++G
Sbjct: 8   KDILYGSIAGAVGKVIEYPFDTVKVRLQTQPAHMFPTTWSCIKFT--YDNEGLWRGFYQG 65

Query: 278 FGPTMLRAAPANGATFATFELA 299
            G  +  AA  N   F +F  A
Sbjct: 66  IGSPLAGAALENAVLFVSFNQA 87

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score =  128 bits (321), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 86/293 (29%), Positives = 138/293 (47%), Gaps = 30/293 (10%)

Query: 25  LKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKN-----------EG 73
           +K  +AG  GG+  V  G PFD  KVR Q     +T V  +  ++K              
Sbjct: 36  IKSFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANST-VHAITNIIKEAKTQVKGTLFTNS 94

Query: 74  LRGFYKGTLTPLVGVGACVSCQF-GVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVA 132
           ++GFYKG + PL+GV    +  F G +   K     +       LT+ Q    GF+  + 
Sbjct: 95  VKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQMAAAGFISAIP 154

Query: 133 NSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCAT 192
            + + +P E V++ LQT +    +   K     I K     +L +G   T+ R+  G A 
Sbjct: 155 TTLVTAPTERVKVVLQTSSKGSFIQAAK----TIVKEGGIASLFKGSLATLARDGPGSAL 210

Query: 193 YFLTYEALVANQIGKGIARSD------VPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQT 246
           YF +YE +  N +     R D      V    +CL G ++G+++WL V+P+D IK+ +Q 
Sbjct: 211 YFASYE-ISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKLQA 269

Query: 247 DNLKNPVRGKNIIQVARLVN-AKYGWKSFFKGFGPTMLRAAPANGATFATFEL 298
            + +     +N++   + +   + G K FF G GP +LR+ PAN ATF   E+
Sbjct: 270 SSTR-----QNMLSATKEIYLQRGGIKGFFPGLGPALLRSFPANAATFLGVEM 317

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 83/188 (44%), Gaps = 19/188 (10%)

Query: 123 YICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALM------ 176
           ++ G VGGV   F   P + +++R Q   A+ TV      +    K +  G L       
Sbjct: 39  FVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEA-KTQVKGTLFTNSVKG 97

Query: 177 --RGLSPTILREAQGCATYFLTYEA---LVANQIGKGIARSDVPAWKLCLFGAVSGVTLW 231
             +G+ P +L      A  F  Y+    LV     +G   +++   ++   G +S +   
Sbjct: 98  FYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQG-GSNELTMGQMAAAGFISAIPTT 156

Query: 232 LTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGA 291
           L   P + +K ++QT +     +G + IQ A+ +  + G  S FKG   T+ R  P +  
Sbjct: 157 LVTAPTERVKVVLQTSS-----KG-SFIQAAKTIVKEGGIASLFKGSLATLARDGPGSAL 210

Query: 292 TFATFELA 299
            FA++E++
Sbjct: 211 YFASYEIS 218

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 39/73 (53%), Gaps = 7/73 (9%)

Query: 15  DQQP-HDSGR-----VLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKL 68
            +QP  D+G+     +L   LAG   GM+  L   P DT K +LQ S+T    +   K++
Sbjct: 224 SRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKLQASSTRQNMLSATKEI 283

Query: 69  -VKNEGLRGFYKG 80
            ++  G++GF+ G
Sbjct: 284 YLQRGGIKGFFPG 296

>Kwal_55.21335
          Length = 317

 Score =  123 bits (309), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 87/285 (30%), Positives = 134/285 (47%), Gaps = 20/285 (7%)

Query: 20  DSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPT--TAVEVVKKLVKNEG-LRG 76
           D    LKD+L G+  G A  ++  P DT KVRLQT       T+   +K   + EG ++G
Sbjct: 41  DFKDALKDILYGSIAGAAGKVIEYPLDTIKVRLQTQPAHVFPTSWSCIKYTYQKEGFVKG 100

Query: 77  FYKGTLTPLVGVGACVSCQF-GVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSF 135
           FY+G  +PLVG     +  F   N A     +  S  P     L Q  + G   G   S+
Sbjct: 101 FYQGVASPLVGAALENAVLFVTFNRAQNFLQQYESVSP-----LSQTVLSGAFAGACTSY 155

Query: 136 LASPIEHVRIRLQTQTASGTVAEFKGPLDCINKL---RANGALMRGLSPTILREAQGCAT 192
           + +P+E ++  LQ     G           +  +   +  G L +G S T +RE  G A 
Sbjct: 156 VLTPVELIKCTLQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAV 215

Query: 193 YFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNP 252
           +F TYE+L  + + +    ++   W+L   GA +GV    +++P D IKS  QT +L   
Sbjct: 216 WFTTYESL-KSYLARRRNDTENHTWELLASGASAGVAFNASIFPADTIKSTAQTQHL--- 271

Query: 253 VRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
                I+   + + A+ G    ++G G T++RAAPAN   F T+E
Sbjct: 272 ----GIVDATKRILARSGPAGLYRGLGITLIRAAPANAIVFYTYE 312

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 79/196 (40%), Gaps = 23/196 (11%)

Query: 16  QQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTS------TTPTTAVEVVKKLV 69
           QQ      + + +L+G   G     V  P +  K  LQ S      T  +     VK +V
Sbjct: 131 QQYESVSPLSQTVLSGAFAGACTSYVLTPVELIKCTLQVSNLEGATTRHSKIWPTVKHIV 190

Query: 70  KNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFF--RGSSADPHKTLTLPQYYICGF 127
           +++G+ G ++G  +  +   A  +  F   E++K +   R +  + H    L      G 
Sbjct: 191 QHKGIGGLWQGQSSTFIRECAGGAVWFTTYESLKSYLARRRNDTENHTWELLA----SGA 246

Query: 128 VGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRAN---GALMRGLSPTIL 184
             GVA +    P + ++   QTQ          G +D   ++ A      L RGL  T++
Sbjct: 247 SAGVAFNASIFPADTIKSTAQTQHL--------GIVDATKRILARSGPAGLYRGLGITLI 298

Query: 185 REAQGCATYFLTYEAL 200
           R A   A  F TYE L
Sbjct: 299 RAAPANAIVFYTYETL 314

 Score = 31.2 bits (69), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 39/85 (45%), Gaps = 4/85 (4%)

Query: 216 AWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGW-KSF 274
           A K  L+G+++G    +  YPLD IK  +QT          + I   +    K G+ K F
Sbjct: 45  ALKDILYGSIAGAAGKVIEYPLDTIKVRLQTQPAHVFPTSWSCI---KYTYQKEGFVKGF 101

Query: 275 FKGFGPTMLRAAPANGATFATFELA 299
           ++G    ++ AA  N   F TF  A
Sbjct: 102 YQGVASPLVGAALENAVLFVTFNRA 126

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score =  122 bits (306), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 94/303 (31%), Positives = 149/303 (49%), Gaps = 32/303 (10%)

Query: 11  IDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTT---PTTAVEVVKK 67
           ++D  ++    G +L D++ G+  G    ++  PFDT KVRLQT  +   PTT    +K 
Sbjct: 1   MEDSKKKGLIEGAIL-DIINGSIAGACGKVIEFPFDTVKVRLQTQASNVFPTTW-SCIKF 58

Query: 68  LVKNEGL-RGFYKGTLTPLVGVGACV---SCQFGVNEAMKRFFRGSSADPHKTLTLPQYY 123
             +NEG+ RGF++G  +PLVG  AC+   +     N+  K   + ++  P     L Q  
Sbjct: 59  TYQNEGIARGFFQGIASPLVG--ACLENATLFVSYNQCSKFLEKHTNVFP-----LGQIL 111

Query: 124 ICGFVGGVANSFLASPIEHVRIRLQT---QTASGTVAEFK--GPLDCINKLRANGALMRG 178
           I G V G   S + +P+E V+ +LQ    Q AS      K    +  I   R    L +G
Sbjct: 112 ISGGVAGSCASLVLTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQG 171

Query: 179 LSPTILREAQGCATYFLTYE----ALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTV 234
            S T +RE+ G   +F TYE    +L          R +   W+L + G  +G+    ++
Sbjct: 172 QSGTFIRESFGGVAWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASI 231

Query: 235 YPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFA 294
           +P D +KS+MQT+++       ++    + +  K+G K F++G G T+ RA PAN A F 
Sbjct: 232 FPADTVKSVMQTEHI-------SLTNAVKKIFGKFGLKGFYRGLGITLFRAVPANAAVFY 284

Query: 295 TFE 297
            FE
Sbjct: 285 IFE 287

>Scas_632.9
          Length = 292

 Score =  117 bits (294), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 92/301 (30%), Positives = 143/301 (47%), Gaps = 31/301 (10%)

Query: 12  DDIDQQPHDSG--RVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTT---PTTAVEVVK 66
           + ID     S     L D++ G+  G    ++  PFDT KVRLQT  +   PTT    +K
Sbjct: 3   ESIDHPIEKSSVQNALSDIVNGSIAGAFGKIIEYPFDTVKVRLQTQGSHIFPTTW-SCIK 61

Query: 67  KLVKNEGL-RGFYKGTLTPLVGVGACVSCQF-GVNEAMKRFFRGSSADPHKTLTLPQYYI 124
               NEG+ RGF++G  +PL G     +  F   N+      + ++  P     L    +
Sbjct: 62  YTYHNEGVWRGFFQGIGSPLFGAALENATLFVSYNQCSNVLEKFTNVSP-----LSNILL 116

Query: 125 CGFVGGVANSFLASPIEHVRIRLQT---QTA-SGTVAEFKGPLDCINKLRANG--ALMRG 178
            G   G   SF+ +P+E ++ +LQ    QTA  G +   K     +  LR  G   L +G
Sbjct: 117 SGAFAGSCASFVLTPVELIKCKLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQG 176

Query: 179 LSPTILREAQGCATYFLTYEALVANQIGKGIARSDVP--AWKLCLFGAVSGVTLWLTVYP 236
            S T +RE+ G   +F TYE +   + G    R D     W+L + GA +G+    +++P
Sbjct: 177 QSSTFIRESLGGVAWFATYEVM---KQGLKDRRKDTENKTWELLVSGASAGLAFNASIFP 233

Query: 237 LDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATF 296
            D +KS+MQT+++        +I   + V   YG   F++G G T++RA PAN   F  +
Sbjct: 234 ADTVKSMMQTEHI-------TLINAVKKVLTTYGITGFYRGLGITLIRAVPANATVFYMY 286

Query: 297 E 297
           E
Sbjct: 287 E 287

 Score = 36.2 bits (82), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 73/186 (39%), Gaps = 24/186 (12%)

Query: 28  LLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKK---------LVKNEGLRGFY 78
           LL+G   G     V  P +  K +LQ S   T     +K          +++ +G+ G +
Sbjct: 115 LLSGAFAGSCASFVLTPVELIKCKLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLW 174

Query: 79  KGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSAD-PHKTLTLPQYYICGFVGGVANSFLA 137
           +G  +  +         F   E MK+  +    D  +KT  L    + G   G+A +   
Sbjct: 175 QGQSSTFIRESLGGVAWFATYEVMKQGLKDRRKDTENKTWEL---LVSGASAGLAFNASI 231

Query: 138 SPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGAL---MRGLSPTILREAQGCATYF 194
            P + V+  +QT+  +         ++ + K+     +    RGL  T++R     AT F
Sbjct: 232 FPADTVKSMMQTEHIT--------LINAVKKVLTTYGITGFYRGLGITLIRAVPANATVF 283

Query: 195 LTYEAL 200
             YE L
Sbjct: 284 YMYETL 289

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score =  117 bits (292), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 96/292 (32%), Positives = 134/292 (45%), Gaps = 31/292 (10%)

Query: 19  HDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTT---PTTAVEVVKKLVKNEGL- 74
            D+ +  KDLL G   G    LV  PFDT KVRLQT +    PTT    V    K EGL 
Sbjct: 3   EDADKAYKDLLYGGVAGSLGKLVEYPFDTVKVRLQTQSAALFPTTW-SCVSHTYKQEGLW 61

Query: 75  RGFYKGTLTPLVGVGACVSCQF-GVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVAN 133
           RGFY+G  +P+ G     +  F   N A        S  P     L +    G + G   
Sbjct: 62  RGFYQGMASPVFGAFLEHAVLFVSFNRAQAVLENCYSCGP-----LEKVVFAGAIAGACT 116

Query: 134 SFLASPIEHVRIRLQTQTASGTVAEFKGP--------LDCINKLRANGALMRGLSPTILR 185
           S++ +P+E V+ +LQ    +G      GP        L  I K    G L +G S T +R
Sbjct: 117 SYVLTPVELVKCKLQVSNLTGV----SGPRYTAVLPTLRAIVKQNGLGGLWQGQSGTFIR 172

Query: 186 EAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQ 245
           E+ G A +F  YE L    + +    ++   W+L   GA +G     +++P D +KS MQ
Sbjct: 173 ESAGGAVWFTAYEVL-KGWLARRRGSTENTVWELLASGAGAGAAFHASIFPADTVKSTMQ 231

Query: 246 TDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
           T++L        +    R V  K+G   F++G G T+LRA PAN   F  +E
Sbjct: 232 TEHL-------GLGPAVRTVLKKHGPTGFYRGVGITLLRALPANAVIFYVYE 276

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 75/201 (37%), Gaps = 28/201 (13%)

Query: 14  IDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTP-------TTAVEVVK 66
           + +  +  G + K + AG   G     V  P +  K +LQ S          T  +  ++
Sbjct: 92  VLENCYSCGPLEKVVFAGAIAGACTSYVLTPVELVKCKLQVSNLTGVSGPRYTAVLPTLR 151

Query: 67  KLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICG 126
            +VK  GL G ++G     +   A  +  F   E +K +          T+    + +  
Sbjct: 152 AIVKQNGLGGLWQGQSGTFIRESAGGAVWFTAYEVLKGWLARRRGSTENTV----WELLA 207

Query: 127 FVGGVANSFLAS--PIEHVRIRLQTQT-----ASGTVAEFKGPLDCINKLRANGALMRGL 179
              G   +F AS  P + V+  +QT+      A  TV +  GP              RG+
Sbjct: 208 SGAGAGAAFHASIFPADTVKSTMQTEHLGLGPAVRTVLKKHGPT----------GFYRGV 257

Query: 180 SPTILREAQGCATYFLTYEAL 200
             T+LR     A  F  YE+L
Sbjct: 258 GITLLRALPANAVIFYVYESL 278

>Kwal_33.15446
          Length = 305

 Score =  115 bits (289), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 87/290 (30%), Positives = 135/290 (46%), Gaps = 13/290 (4%)

Query: 18  PHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTP---TTAVEVVKKLVKNEGL 74
           P+++   +   ++G   G+A+  VG PFDT KVRLQTS         ++ V + ++ +G+
Sbjct: 12  PNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGI 71

Query: 75  RGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANS 134
           RGFY G   PLVG     S   G     +   +       + L L    + G + G + S
Sbjct: 72  RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVS 131

Query: 135 FLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGA---LMRGLSPTILREAQGCA 191
           F+A+P+E  + +LQ Q  + T   ++GPLD I K+ A      + +GL  T++       
Sbjct: 132 FIAAPVELAKAKLQVQYDAQTT-RYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTH-FV 189

Query: 192 TYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKS-LMQTDNLK 250
            ++ +YE L+          SD  A      G  +    W T YP DVIK  ++  D   
Sbjct: 190 YWWGSYE-LLTRWFKANTNLSDT-AINFWAGGFSASFGFWTTAYPSDVIKQVILCNDKYD 247

Query: 251 NPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAM 300
             +R       A  +    G + FFKGF P+ LR+ PAN A  A+FE  +
Sbjct: 248 GSLRSWR--NAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVL 295

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score =  113 bits (282), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 84/289 (29%), Positives = 135/289 (46%), Gaps = 24/289 (8%)

Query: 20  DSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTT---PTTAVEVVKKLVKNEGL-R 75
           D    LKD+  G+  G    ++  PFDT KVRLQT      PTT    ++    +EG+ +
Sbjct: 3   DLESALKDIAYGSVAGAIGKVIEYPFDTVKVRLQTQPAHLYPTTW-SCIRSTYTDEGIWK 61

Query: 76  GFYKGTLTPLVGVGACVSCQF-GVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANS 134
           GFY+G  +PL G     +  F   N+        +   P     L +    G   G   S
Sbjct: 62  GFYQGIASPLFGAALENAVLFVSFNQCTNFLDEFTQLKP-----LTKTIYSGAFAGACAS 116

Query: 135 FLASPIEHVRIRLQTQTASGTVAEFKG------PLDCINKLRANGALMRGLSPTILREAQ 188
           F+ +P+E V+ +LQ    S ++++          +  + K +    L +G   T +RE  
Sbjct: 117 FILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECL 176

Query: 189 GCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDN 248
           G A +F TYE +         A  +   W+L + GA +GV    +V+P D +KS+ QT++
Sbjct: 177 GGAVWFTTYEIMKMKFASLHPAEKENHTWELLVSGASAGVLFNASVFPADTVKSVCQTEH 236

Query: 249 LKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
           +       +I+   + V   +G   F++G G T++RAAPAN   F T+E
Sbjct: 237 V-------SIVNALKKVLRTHGITGFYRGLGITLIRAAPANATVFYTYE 278

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 76/187 (40%), Gaps = 21/187 (11%)

Query: 26  KDLLAGTAGGMAQVLVGQPFDTTKVRLQTS---------TTPTTAVEVVKKLVKNEGLRG 76
           K + +G   G     +  P +  K +LQ S         T  T+    +K ++K +GL G
Sbjct: 103 KTIYSGAFAGACASFILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLG 162

Query: 77  FYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFL 136
            ++G L+  V      +  F   E MK  F        +  T  +  + G   GV  +  
Sbjct: 163 LWQGQLSTFVRECLGGAVWFTTYEIMKMKFASLHPAEKENHTW-ELLVSGASAGVLFNAS 221

Query: 137 ASPIEHVRIRLQTQTASGTVAEFKGPLDCINK-LRANG--ALMRGLSPTILREAQGCATY 193
             P + V+   QT+  S         ++ + K LR +G     RGL  T++R A   AT 
Sbjct: 222 VFPADTVKSVCQTEHVS--------IVNALKKVLRTHGITGFYRGLGITLIRAAPANATV 273

Query: 194 FLTYEAL 200
           F TYE L
Sbjct: 274 FYTYETL 280

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 2/79 (2%)

Query: 28  LLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYKGTLTPLVG 87
           L++G + G+       P DT K   QT     + V  +KK+++  G+ GFY+G    L+ 
Sbjct: 208 LVSGASAGVLFNASVFPADTVKSVCQTE--HVSIVNALKKVLRTHGITGFYRGLGITLIR 265

Query: 88  VGACVSCQFGVNEAMKRFF 106
                +  F   E +K+ F
Sbjct: 266 AAPANATVFYTYETLKKMF 284

>Scas_714.18
          Length = 305

 Score =  112 bits (279), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 87/304 (28%), Positives = 135/304 (44%), Gaps = 42/304 (13%)

Query: 22  GRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTT---PTTAVEVVKKLVKNEG-LRGF 77
           G  L+++LAG+  G     +  PFDT KVRLQT      P+T    +K   +NEG L GF
Sbjct: 10  GAALREILAGSIAGAIGKFIEYPFDTVKVRLQTQEAYMFPSTW-SCIKYTYENEGILEGF 68

Query: 78  YKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLA 137
           Y+G  +PL+G     +  F        F    +      + L      GF G  A SF+ 
Sbjct: 69  YQGIESPLIGAALENAILFLAYNQCSSFLNAFTEFSAFLIILIS---AGFAGSCA-SFVL 124

Query: 138 SPIEHVRIRLQTQT------------------------ASGTVAEFKGPLDCINKLRANG 173
           +P+E ++ +LQ                             G        +  I K +   
Sbjct: 125 TPVELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGLF 184

Query: 174 ALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLT 233
            L +G S T +RE+ G   +F TYE +   Q  +         W+L + GA +G+    +
Sbjct: 185 GLWQGQSSTFIRESIGSVVWFATYELM--KQTLRDPKSEVNTTWQLLISGATAGLAFNGS 242

Query: 234 VYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATF 293
           V+P D +KS+MQT++L        +++  R +  + G   F++G G T+LRA P+N A F
Sbjct: 243 VFPADTVKSIMQTEHLA-------LMETVRSILERDGVAGFYRGLGITLLRAVPSNAAVF 295

Query: 294 ATFE 297
            T+E
Sbjct: 296 YTYE 299

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/203 (22%), Positives = 79/203 (38%), Gaps = 37/203 (18%)

Query: 124 ICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALM----RGL 179
           + G + G    F+  P + V++RLQTQ A      F     CI     N  ++    +G+
Sbjct: 17  LAGSIAGAIGKFIEYPFDTVKVRLQTQEAY----MFPSTWSCIKYTYENEGILEGFYQGI 72

Query: 180 SPTILREAQGCATYFLTYEALVANQIGKGI-ARSDVPAWKLCLFGA-VSGVTLWLTVYPL 237
              ++  A   A  FL Y     NQ    + A ++  A+ + L  A  +G      + P+
Sbjct: 73  ESPLIGAALENAILFLAY-----NQCSSFLNAFTEFSAFLIILISAGFAGSCASFVLTPV 127

Query: 238 DVIKSLMQTDNLKNPV----------------------RGKNIIQVARLVNAKYGWKSFF 275
           ++IK  +Q  NL   +                      R   II   + +  + G    +
Sbjct: 128 ELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGLFGLW 187

Query: 276 KGFGPTMLRAAPANGATFATFEL 298
           +G   T +R +  +   FAT+EL
Sbjct: 188 QGQSSTFIRESIGSVVWFATYEL 210

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 62/144 (43%), Gaps = 12/144 (8%)

Query: 59  TTAVEVVKKLVKNEGLRGFYKGTLTPLV--GVGACVSCQFGVNEAMKRFFRGSSADPHKT 116
           T  +  +K ++K +GL G ++G  +  +   +G+ V   F   E MK+  R   ++ + T
Sbjct: 168 TRIIPTIKSIIKEKGLFGLWQGQSSTFIRESIGSVV--WFATYELMKQTLRDPKSEVNTT 225

Query: 117 LTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALM 176
               Q  I G   G+A +    P + V+  +QT+  +         +  I +        
Sbjct: 226 W---QLLISGATAGLAFNGSVFPADTVKSIMQTEHLA-----LMETVRSILERDGVAGFY 277

Query: 177 RGLSPTILREAQGCATYFLTYEAL 200
           RGL  T+LR     A  F TYE L
Sbjct: 278 RGLGITLLRAVPSNAAVFYTYEKL 301

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score =  114 bits (286), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 83/278 (29%), Positives = 128/278 (46%), Gaps = 16/278 (5%)

Query: 31  GTAGGMAQVLVGQPFDTTKVRLQT---STTPTTAVEVVKKLVKNEGLRGFYKGTLTPLVG 87
           G+  G     V  P D  K R+Q    S     +++ V K+ + +G+RG Y G    L+G
Sbjct: 511 GSIAGCIGATVVYPIDLVKTRMQAQRNSVQYKNSIDCVVKIFQTKGIRGLYSGLGPQLIG 570

Query: 88  VGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRL 147
           V    + +  VN+ M+++F   S    +T+   Q  + G   G       +P+E V+IRL
Sbjct: 571 VAPEKAIKLTVNDFMRQYFMNKS----RTIKWYQEILSGATAGACQVVFTNPLEIVKIRL 626

Query: 148 QTQTASGTVAEFKGP-LDCINKLRANG--ALMRGLSPTILREAQGCATYFLTYEALVANQ 204
           Q +  S  V E   P L  +  +R  G   L +G +  +LR+    A YF TY  L  + 
Sbjct: 627 QMR--SDYVGENARPQLGAVGIIRQLGLRGLYKGAAACLLRDVPFSAIYFPTYAHLKKDV 684

Query: 205 IG----KGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQ 260
                     R+ +  W+L L G ++G+       P DVIK+ +Q D  K       +I 
Sbjct: 685 FNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQIDPRKGETTYTGVIH 744

Query: 261 VARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFEL 298
            AR +  +   KSFFKG    +LR++P  G T A FE+
Sbjct: 745 AARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAFEM 782

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 41/167 (24%), Positives = 72/167 (43%), Gaps = 18/167 (10%)

Query: 2   PEETSSPLLIDDIDQQPHDSGRVLK---DLLAGTAGGMAQVLVGQPFDTTKVRLQTSTT- 57
           PE+     + D + Q   +  R +K   ++L+G   G  QV+   P +  K+RLQ  +  
Sbjct: 573 PEKAIKLTVNDFMRQYFMNKSRTIKWYQEILSGATAGACQVVFTNPLEIVKIRLQMRSDY 632

Query: 58  -------PTTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKR-FFRGS 109
                     AV ++++L    GLRG YKG    L+      +  F     +K+  F   
Sbjct: 633 VGENARPQLGAVGIIRQL----GLRGLYKGAAACLLRDVPFSAIYFPTYAHLKKDVFNFD 688

Query: 110 SADPHKTLTLPQY--YICGFVGGVANSFLASPIEHVRIRLQTQTASG 154
             D +K   L  +   + G + G+  ++L +P + ++ RLQ     G
Sbjct: 689 PNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQIDPRKG 735

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 30/102 (29%), Positives = 45/102 (44%), Gaps = 9/102 (8%)

Query: 12  DDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQT-----STTPTTAVEVVK 66
           D  D+   +  +  + LLAG   GM    +  PFD  K RLQ       TT T  +   +
Sbjct: 688 DPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQIDPRKGETTYTGVIHAAR 747

Query: 67  KLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRG 108
            ++K E ++ F+KG    ++      S QFG   A    F+G
Sbjct: 748 TILKEESIKSFFKGGPARVLR----SSPQFGFTLAAFEMFQG 785

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 39/183 (21%), Positives = 76/183 (41%), Gaps = 22/183 (12%)

Query: 123 YICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKL---RANGALMRGL 179
           +  G + G   + +  PI+ V+ R+Q Q  S    ++K  +DC+ K+   +    L  GL
Sbjct: 508 FTLGSIAGCIGATVVYPIDLVKTRMQAQRNS---VQYKNSIDCVVKIFQTKGIRGLYSGL 564

Query: 180 SPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDV 239
            P ++  A   A      + +    + K      +  ++  L GA +G    +   PL++
Sbjct: 565 GPQLIGVAPEKAIKLTVNDFMRQYFMNKS---RTIKWYQEILSGATAGACQVVFTNPLEI 621

Query: 240 IKSLMQT------DNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATF 293
           +K  +Q       +N +  +    II+       + G +  +KG    +LR  P +   F
Sbjct: 622 VKIRLQMRSDYVGENARPQLGAVGIIR-------QLGLRGLYKGAAACLLRDVPFSAIYF 674

Query: 294 ATF 296
            T+
Sbjct: 675 PTY 677

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score =  111 bits (277), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 94/296 (31%), Positives = 141/296 (47%), Gaps = 14/296 (4%)

Query: 13  DIDQQP-HDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTT---AVEVVKKL 68
           DI Q P  ++   +   ++G   G+A+  VG PFDT KVRLQTS   T     ++ V K 
Sbjct: 48  DIQQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKT 107

Query: 69  VKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFV 128
              +G+RGFY G   PLVG     S   G     +   +       + L L    I G +
Sbjct: 108 FTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVM 167

Query: 129 GGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKL-RANG--ALMRGLSPTILR 185
            G + SF+A+P+E  + +LQ Q  + T  ++ GP+D I K+  +NG   L +GL+ T++ 
Sbjct: 168 AGWSVSFIAAPVELAKAKLQVQYDAKT-TKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIF 226

Query: 186 EAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSL-M 244
                  ++ +YE L+     +    SD  A      G  +    W T YP DVIK + +
Sbjct: 227 RTN-FVFWWGSYE-LLTRWFKEHTNMSDT-AINFWSGGFSASFGFWTTAYPSDVIKQVVL 283

Query: 245 QTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAM 300
             D      R   +   A+ +    G++ FFKGF P+ LR+ PAN A  A FE  +
Sbjct: 284 CNDKYDGTFRSWKL--AAKDIWRTRGYRGFFKGFVPSFLRSFPANAAALAAFEFVL 337

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score =  111 bits (278), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 86/289 (29%), Positives = 135/289 (46%), Gaps = 25/289 (8%)

Query: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQ------TSTTPTTAVEVVKKLVKNEGLRGFYKG 80
           +L+AG   G+ + L   P DT KVR+Q        T P   +     +   EGL  FYKG
Sbjct: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKG 119

Query: 81  TLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHK-TLTLPQYYICGFVGGVANSFLA-S 138
               ++G+   ++ +F   E    F+R   AD     ++    ++ G   GV  + L  +
Sbjct: 120 LGAVVIGIIPKMAIRFSSYE----FYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVN 175

Query: 139 PIEHVRIRLQTQTASGTVAE--FKGPLDC---INKLRANGALMRGLSPTILREAQGCATY 193
           P+E V+IRLQ Q   G   +  ++  +     I K    GAL RG+S T  R+A      
Sbjct: 176 PMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGAN 235

Query: 194 FLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTD----NL 249
           F  Y  L+  ++ +     ++P+W+  L G VSG     +  PLD IK+ +Q D    NL
Sbjct: 236 FTVYSKLM-ERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNL 294

Query: 250 KNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFEL 298
            N VR   I  + R +  + G+++ +KG  P ++R AP    TF  +E 
Sbjct: 295 SNWVR---ITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEF 340

 Score = 35.4 bits (80), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 34/86 (39%), Gaps = 6/86 (6%)

Query: 29  LAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVK------KLVKNEGLRGFYKGTL 82
           L G   G        P DT K RLQ   +       V+      +LV+ EG R  YKG  
Sbjct: 262 LIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGIT 321

Query: 83  TPLVGVGACVSCQFGVNEAMKRFFRG 108
             ++ V    +  F V E ++R   G
Sbjct: 322 PRVMRVAPGQAVTFTVYEFVRRHLEG 347

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score =  109 bits (273), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 92/279 (32%), Positives = 130/279 (46%), Gaps = 11/279 (3%)

Query: 28  LLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTT---AVEVVKKLVKNEGLRGFYKGTLTP 84
            +AG   G+A+  VG PFDT KVRLQTS   T     ++ V K  +N+G+RGFY G   P
Sbjct: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPP 86

Query: 85  LVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVR 144
           LVG     S   G     +           + L L    I G + G + SF+A PIE  +
Sbjct: 87  LVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAK 146

Query: 145 IRLQTQTASGTVAEFKGPLDCINKL-RANG--ALMRGLSPTILREAQGCATYFLTYEALV 201
            +LQ Q    T   +KGPLD I K+  A G   L +GL  T++        ++ +YE L+
Sbjct: 147 AKLQVQ-YDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTH-FVYWWGSYE-LL 203

Query: 202 ANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQV 261
                +    S+  A      G  +    W T YP DV+K ++  ++  +         V
Sbjct: 204 TRWFRENTKMSEA-AINFWAGGFSASFGFWTTAYPSDVVKQVVLCNDKYDGSFKSWRTAV 262

Query: 262 ARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAM 300
             +  +K G   FFKGF P+ LR+ PAN A  A FE  +
Sbjct: 263 KDIYQSK-GINGFFKGFVPSFLRSFPANAAALAAFEFVL 300

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score =  111 bits (277), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 82/278 (29%), Positives = 130/278 (46%), Gaps = 16/278 (5%)

Query: 31  GTAGGMAQVLVGQPFDTTKVRLQTS---TTPTTAVEVVKKLVKNEGLRGFYKGTLTPLVG 87
           G+  G    +V  P D  K R+Q     +    +++ + K++  EG+RG Y G    L+G
Sbjct: 531 GSVAGCIGAMVVYPIDMVKTRMQAQRDFSKYKNSIDCLLKILSKEGVRGLYSGLGPQLIG 590

Query: 88  VGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRL 147
           V    + +  VN+ M    R + A     L+LP   I G   G       +P+E V+IRL
Sbjct: 591 VAPEKAIKLTVNDHM----RATLAGRDGKLSLPCEIISGATAGACQVVFTNPLEIVKIRL 646

Query: 148 QTQTASGTVAEF-KGPLDCINKLRANG--ALMRGLSPTILREAQGCATYFLTYEALVANQ 204
           Q +  S  VA+  +  ++ I+ ++  G   L RG    +LR+    A YF TY  + +N 
Sbjct: 647 QVK--SDYVADAARNSVNAISVIKNLGLIGLYRGAGACLLRDIPFSAIYFPTYAHIKSNV 704

Query: 205 IG----KGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQ 260
                     R+ +  W+L + G ++G+       P DVIK+ +Q D  K       I  
Sbjct: 705 FNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGESVYNGIWD 764

Query: 261 VARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFEL 298
            AR +  + G KSFFKG    +LR++P  G T A +E+
Sbjct: 765 AARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAYEI 802

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 41/183 (22%), Positives = 77/183 (42%), Gaps = 22/183 (12%)

Query: 123 YICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANG---ALMRGL 179
           +  G V G   + +  PI+ V+ R+Q Q      +++K  +DC+ K+ +      L  GL
Sbjct: 528 FTLGSVAGCIGAMVVYPIDMVKTRMQAQR---DFSKYKNSIDCLLKILSKEGVRGLYSGL 584

Query: 180 SPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDV 239
            P ++  A   A      + + A   G+   +  +P   +   GA +G    +   PL++
Sbjct: 585 GPQLIGVAPEKAIKLTVNDHMRATLAGRD-GKLSLPCEIIS--GATAGACQVVFTNPLEI 641

Query: 240 IKSLMQ------TDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATF 293
           +K  +Q       D  +N V   ++I+         G    ++G G  +LR  P +   F
Sbjct: 642 VKIRLQVKSDYVADAARNSVNAISVIK-------NLGLIGLYRGAGACLLRDIPFSAIYF 694

Query: 294 ATF 296
            T+
Sbjct: 695 PTY 697

 Score = 38.5 bits (88), Expect = 0.005,   Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 41/100 (41%), Gaps = 16/100 (16%)

Query: 28  LLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAV-----EVVKKLVKNEGLRGFYKGTL 82
           L++G   GM    +  PFD  K RLQ       +V     +  + ++K EG++ F+KG  
Sbjct: 724 LVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGESVYNGIWDAARTILKEEGIKSFFKGGP 783

Query: 83  TPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQY 122
             ++      S QFG   A    F       H     P+Y
Sbjct: 784 ARVLR----SSPQFGFTLAAYEIF-------HNLFPAPRY 812

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score =  110 bits (276), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 79/277 (28%), Positives = 125/277 (45%), Gaps = 14/277 (5%)

Query: 31  GTAGGMAQVLVGQPFDTTKVRLQTSTTPT---TAVEVVKKLVKNEGLRGFYKGTLTPLVG 87
           G+  G     V  P D  K R+Q   + +    +++   K+   EG+RG Y G    L+G
Sbjct: 525 GSIAGCIGATVVYPIDLVKTRMQAQRSFSQYKNSIDCFAKIFSREGIRGIYSGLGPQLIG 584

Query: 88  VGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRL 147
           V    + +  VN+ M    RG   D H  L      + G   G       +P+E V+IRL
Sbjct: 585 VAPEKAIKLTVNDYM----RGRLMDKHANLKWYFEILSGACAGACQVVFTNPLEVVKIRL 640

Query: 148 QTQT--ASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYEALVANQI 205
           Q ++  A   +      L  I +L   G L +G++  ++R+    A YF TY  L  +  
Sbjct: 641 QVRSEYAGDVLKSQVTALGVIKQLGIKG-LYKGIAACLMRDVPFSAIYFPTYAHLKKDVF 699

Query: 206 G----KGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQV 261
                    R+ +  W+L + G ++G+       P DVIK+ +Q D  K   R + I   
Sbjct: 700 KYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGETRYEGIFHA 759

Query: 262 ARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFEL 298
           AR +  +  +KSFFKG    +LR++P  G T A +E+
Sbjct: 760 ARTILKEESFKSFFKGGSARVLRSSPQFGFTLAAYEI 796

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 43/186 (23%), Positives = 79/186 (42%), Gaps = 19/186 (10%)

Query: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQTST--------TPTTAVEVVKKLVKNEGLRGFY 78
           ++L+G   G  QV+   P +  K+RLQ  +        +  TA+ V+K+L    G++G Y
Sbjct: 615 EILSGACAGACQVVFTNPLEVVKIRLQVRSEYAGDVLKSQVTALGVIKQL----GIKGLY 670

Query: 79  KGTLTPLVGVGACVSCQFGVNEAMKR-FFRGSSADPHKTLTLPQY--YICGFVGGVANSF 135
           KG    L+      +  F     +K+  F+    D  +   L  +   + G + G+  ++
Sbjct: 671 KGIAACLMRDVPFSAIYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAY 730

Query: 136 LASPIEHVRIRLQTQTASGTVAEFKGPLDC---INKLRANGALMRGLSPTILREAQGCAT 192
           L +P + ++ RLQ     G    ++G       I K  +  +  +G S  +LR +     
Sbjct: 731 LTTPFDVIKTRLQIDPRKGE-TRYEGIFHAARTILKEESFKSFFKGGSARVLRSSPQFGF 789

Query: 193 YFLTYE 198
               YE
Sbjct: 790 TLAAYE 795

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 40/183 (21%), Positives = 78/183 (42%), Gaps = 22/183 (12%)

Query: 123 YICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANG---ALMRGL 179
           +  G + G   + +  PI+ V+ R+Q Q    + +++K  +DC  K+ +      +  GL
Sbjct: 522 FTLGSIAGCIGATVVYPIDLVKTRMQAQR---SFSQYKNSIDCFAKIFSREGIRGIYSGL 578

Query: 180 SPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDV 239
            P ++  A   A      + +    + K    +++  +   L GA +G    +   PL+V
Sbjct: 579 GPQLIGVAPEKAIKLTVNDYMRGRLMDK---HANLKWYFEILSGACAGACQVVFTNPLEV 635

Query: 240 IKSLMQT------DNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATF 293
           +K  +Q       D LK+ V    +I+       + G K  +KG    ++R  P +   F
Sbjct: 636 VKIRLQVRSEYAGDVLKSQVTALGVIK-------QLGIKGLYKGIAACLMRDVPFSAIYF 688

Query: 294 ATF 296
            T+
Sbjct: 689 PTY 691

 Score = 35.0 bits (79), Expect = 0.070,   Method: Composition-based stats.
 Identities = 20/74 (27%), Positives = 32/74 (43%), Gaps = 5/74 (6%)

Query: 12  DDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQT-----STTPTTAVEVVK 66
           D  D++  +  +  + L+AG   GM    +  PFD  K RLQ       T         +
Sbjct: 702 DPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGETRYEGIFHAAR 761

Query: 67  KLVKNEGLRGFYKG 80
            ++K E  + F+KG
Sbjct: 762 TILKEESFKSFFKG 775

>Scas_691.4
          Length = 334

 Score =  106 bits (264), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 85/313 (27%), Positives = 140/313 (44%), Gaps = 34/313 (10%)

Query: 15  DQQPHDS-GRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTT-----PTTAVEVVKKL 68
            + P+D     L +L+AG   G+ + L   P DT KVR+Q +       P   +   + +
Sbjct: 3   QKNPNDKKSSPLINLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPHGFITTGRNI 62

Query: 69  VKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPH-KTLTLPQYYICGF 127
             +EG    YKG    ++G+   ++ +F   E    F+R +  D   +T+T    ++ G 
Sbjct: 63  YSHEGFLALYKGLGAVVIGIIPKMAIRFSSYE----FYRNALTDKETRTITTGNTFLAGV 118

Query: 128 VGGVANSFLA-SPIEHVRIRLQTQ------------TASGTVAEFKGP--------LDCI 166
             G+  + L  +P+E V+IRLQ Q            +A+GT A    P           I
Sbjct: 119 GAGITEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTI 178

Query: 167 NKLRANGALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVS 226
            K    GAL RG+S T  R+A      F  Y  L  + + K   R  +P+W+    G +S
Sbjct: 179 VKEEGAGALYRGVSLTAARQATNQGANFTVYSYL-KDYLQKYHNRESLPSWETSCIGLIS 237

Query: 227 GVTLWLTVYPLDVIKSLMQTD-NLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRA 285
           G     +  PLD IK+ +Q D ++ +    K I  +   +  + G+++ +KG  P ++R 
Sbjct: 238 GAIGPFSNAPLDTIKTRLQKDKSISSNSAWKKIYIIGTQLIKEEGFRALYKGITPRVMRV 297

Query: 286 APANGATFATFEL 298
           AP    TF  +E 
Sbjct: 298 APGQAVTFTVYEF 310

 Score = 35.0 bits (79), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 43/88 (48%), Gaps = 15/88 (17%)

Query: 44  PFDTTKVRLQ-----TSTTPTTAVEVV-KKLVKNEGLRGFYKGTLTPLVGVGACVSCQFG 97
           P DT K RLQ     +S +    + ++  +L+K EG R  YKG    ++ V    +  F 
Sbjct: 247 PLDTIKTRLQKDKSISSNSAWKKIYIIGTQLIKEEGFRALYKGITPRVMRVAPGQAVTFT 306

Query: 98  VNEAMKR------FFRGS--SADPHKTL 117
           V E +++      FF GS  SA P KTL
Sbjct: 307 VYEFVRKHLETLNFFGGSGPSAKP-KTL 333

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score =  108 bits (270), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 77/278 (27%), Positives = 123/278 (44%), Gaps = 15/278 (5%)

Query: 31  GTAGGMAQVLVGQPFDTTKVRLQTSTTPT---TAVEVVKKLVKNEGLRGFYKGTLTPLVG 87
           G+  G     V  P D  K R+Q   +      +++ + K++  EG++G Y G    L+G
Sbjct: 537 GSIAGCIGATVVYPIDFIKTRMQAQRSLAQYKNSIDCLLKIISREGIKGLYSGLGPQLIG 596

Query: 88  VGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRL 147
           V    + +  VN+    F R    D +  L+L    I G   G       +P+E V+IRL
Sbjct: 597 VAPEKAIKLTVND----FMRNRLTDKNGKLSLFPEIISGASAGACQVIFTNPLEIVKIRL 652

Query: 148 QTQT---ASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYEALVANQ 204
           Q Q+           +     + KL   G L  G++  ++R+    A YF TY  L  + 
Sbjct: 653 QVQSDYVGENIQQANETATQIVKKLGLRG-LYNGVAACLMRDVPFSAIYFPTYAHLKKDL 711

Query: 205 I----GKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQ 260
                     R+ +  W+L   GA++G+       P DVIK+ +Q D  K   +   I  
Sbjct: 712 FDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDPRKGETKYNGIFH 771

Query: 261 VARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFEL 298
             R +  +  ++SFFKG G  +LR++P  G T A +EL
Sbjct: 772 AIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAYEL 809

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 37/143 (25%), Positives = 62/143 (43%), Gaps = 16/143 (11%)

Query: 24  VLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTST---------TPTTAVEVVKKLVKNEGL 74
           +  ++++G + G  QV+   P +  K+RLQ  +            TA ++VKKL    GL
Sbjct: 624 LFPEIISGASAGACQVIFTNPLEIVKIRLQVQSDYVGENIQQANETATQIVKKL----GL 679

Query: 75  RGFYKGTLTPLVGVGACVSCQFGVNEAMKR-FFRGSSADPHKTLTLPQYYI--CGFVGGV 131
           RG Y G    L+      +  F     +K+  F     D  K   L  + +   G + G+
Sbjct: 680 RGLYNGVAACLMRDVPFSAIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGM 739

Query: 132 ANSFLASPIEHVRIRLQTQTASG 154
             +FL +P + ++ RLQ     G
Sbjct: 740 PAAFLTTPFDVIKTRLQIDPRKG 762

>Kwal_47.17321
          Length = 881

 Score =  108 bits (270), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 80/281 (28%), Positives = 127/281 (45%), Gaps = 14/281 (4%)

Query: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQTS---TTPTTAVEVVKKLVKNEGLRGFYKGTLT 83
           + L G+  G        P D  K R+Q     +    +++   K+   EG+RG Y G   
Sbjct: 503 NFLLGSVAGCIGATAVYPIDLVKTRMQAQRNFSQYKNSIDCFVKIFSREGIRGIYSGLGP 562

Query: 84  PLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHV 143
            LVGV    + +  VN+ +++       D +  LTLP   I G   G       +P+E V
Sbjct: 563 QLVGVAPEKAIKLTVNDYVRKLL----MDENNRLTLPLEIISGAAAGACQVIFTNPLEIV 618

Query: 144 RIRLQTQTASGTVAEFKGPLDCINKLRANG--ALMRGLSPTILREAQGCATYFLTYEALV 201
           +IRLQ ++        K  L  +  +++ G   L +GL   ++R+    A YF TY  L 
Sbjct: 619 KIRLQVRSEYADSLP-KSQLTALGVVKSLGLRGLYKGLVACLMRDVPFSAIYFPTYAHLK 677

Query: 202 ANQIG----KGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKN 257
            +           R+ +  W+L   G ++G+       P DVIK+ +Q D  K   R   
Sbjct: 678 RDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGETRYTG 737

Query: 258 IIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFEL 298
           I+  AR +  +  +KSFFKG G  +LR++P  G T A +E+
Sbjct: 738 ILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAYEI 778

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score =  104 bits (260), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 88/291 (30%), Positives = 132/291 (45%), Gaps = 23/291 (7%)

Query: 28  LLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA-------VEVVKKLVKNEGLRGFYKG 80
            +AG   G+A+  VG PFDT KVRLQTS   + A       ++ V K +KN+G+RG Y G
Sbjct: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72

Query: 81  TLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPI 140
              PL G     S   G     +          H  L L    I G + G   SF+A+P+
Sbjct: 73  FTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAAPV 132

Query: 141 EHVRIRLQTQTASGTVAEFKGPLDCINKLRANG-----------ALMRGLSPTILREAQG 189
           E  + +LQ Q  + T  ++ GP+D + K+   G           +L +GL  T++  +  
Sbjct: 133 ELAKAKLQVQYDAKT-TKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRSN- 190

Query: 190 CATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNL 249
              ++ +YE L+     K    S  PA      G  +    W + YP DV+K ++  ++ 
Sbjct: 191 FVFWWGSYE-LITQWFQKNTNLS-APAINFWAGGLSASFGFWTSAYPSDVVKQVVLCND- 247

Query: 250 KNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAM 300
           K     K+       +  + G   FFKGF P+ LR+ PAN A  A FE  +
Sbjct: 248 KYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPANAAALAAFEFVL 298

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score =  103 bits (257), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 83/295 (28%), Positives = 130/295 (44%), Gaps = 34/295 (11%)

Query: 25  LKDLLAGTAGGMAQVLVGQPFDTTKVRLQTS---TTPTTAVEVVKKLVKNEGL-RGFYKG 80
            +D+L G+  G    ++  PFDT KVRLQT      P T    +    KNEG+ +GF++G
Sbjct: 14  FRDILYGSIAGALGKVIEYPFDTVKVRLQTQGRHVFPDTW-SCITYTYKNEGIIKGFFQG 72

Query: 81  TLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPI 140
             +PL G     +  F       +F +  +        L    I G   G   SF+ +P+
Sbjct: 73  IASPLAGAAIENAALFLSYNQCSKFLQHYT----NVSDLTNILISGAFAGSCASFVLTPV 128

Query: 141 EHVRIRLQTQT---------ASGTVAEFKG----PLDCINKLRANGALMRGLSPTILREA 187
           E ++ +LQ               TV E        +  + K R    L +G S T +RE+
Sbjct: 129 ELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFIRES 188

Query: 188 QGCATYFLTYEALVA-----NQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKS 242
            G   +F TYE +       + I      +D   W+L   GA +G+    +++P D +KS
Sbjct: 189 FGGVAWFATYELMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPADTVKS 248

Query: 243 LMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
           +MQT++L      K I         + G + F++G G T++RA PAN   F  +E
Sbjct: 249 MMQTEHLGLKTAIKKIF-------VEKGLRGFYRGLGITLIRAIPANATVFYVYE 296

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 78/194 (40%), Gaps = 30/194 (15%)

Query: 124 ICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSPTI 183
           + G + G     +  P + V++RLQTQ        F     CI     N  +++G    I
Sbjct: 18  LYGSIAGALGKVIEYPFDTVKVRLQTQGRH----VFPDTWSCITYTYKNEGIIKGFFQGI 73

Query: 184 LREAQGCA----TYFLTYEALVANQIGKGIAR----SDVPAWKLCLFGAVSGVTLWLTVY 235
                G A      FL+Y     NQ  K +      SD+    + + GA +G      + 
Sbjct: 74  ASPLAGAAIENAALFLSY-----NQCSKFLQHYTNVSDLT--NILISGAFAGSCASFVLT 126

Query: 236 PLDVIKSLMQTDNLK---------NPV--RGKNIIQVARLVNAKYGWKSFFKGFGPTMLR 284
           P+++IK  +Q  NL+         N V  R   II   + V    G+   ++G   T +R
Sbjct: 127 PVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFIR 186

Query: 285 AAPANGATFATFEL 298
            +    A FAT+EL
Sbjct: 187 ESFGGVAWFATYEL 200

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 72/199 (36%), Gaps = 37/199 (18%)

Query: 28  LLAGTAGGMAQVLVGQPFDTTKVRLQTSTTP----------------TTAVEVVKKLVKN 71
           L++G   G     V  P +  K +LQ S                   T  +  ++ ++KN
Sbjct: 111 LISGAFAGSCASFVLTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKN 170

Query: 72  EGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFF--RGSSADP-----HKTLTLPQYYI 124
            G  G ++G     +         F   E MK++   R +  DP     +KT  L     
Sbjct: 171 RGFIGLWQGQSGTFIRESFGGVAWFATYELMKKYLKSRHNIEDPSLPNDNKTWEL---LA 227

Query: 125 CGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGAL---MRGLSP 181
            G   G+A +    P + V+  +QT        E  G    I K+     L    RGL  
Sbjct: 228 SGASAGLAFNASIFPADTVKSMMQT--------EHLGLKTAIKKIFVEKGLRGFYRGLGI 279

Query: 182 TILREAQGCATYFLTYEAL 200
           T++R     AT F  YE L
Sbjct: 280 TLIRAIPANATVFYVYETL 298

 Score = 33.1 bits (74), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 3/88 (3%)

Query: 18  PHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNEGLRGF 77
           P+D+ +  + L +G + G+A      P DT K  +QT          +KK+   +GLRGF
Sbjct: 217 PNDN-KTWELLASGASAGLAFNASIFPADTVKSMMQTEHLGLKTA--IKKIFVEKGLRGF 273

Query: 78  YKGTLTPLVGVGACVSCQFGVNEAMKRF 105
           Y+G    L+      +  F V E + + 
Sbjct: 274 YRGLGITLIRAIPANATVFYVYETLSKL 301

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score =  107 bits (266), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 83/278 (29%), Positives = 123/278 (44%), Gaps = 15/278 (5%)

Query: 31  GTAGGMAQVLVGQPFDTTKVRLQTSTTPT---TAVEVVKKLVKNEGLRGFYKGTLTPLVG 87
           G+  G     +  P D  K R+Q   + +    +++   K++  EG+RG Y G    L+G
Sbjct: 550 GSVAGCIGATIVYPIDFVKTRMQAQRSLSQYKNSIDCFLKILSREGIRGVYSGLGPQLIG 609

Query: 88  VGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRL 147
           V    + +  VN+ M    R    D +  L L    I G   G       +P+E V+IRL
Sbjct: 610 VAPEKAIKLTVNDYM----RNKLKDKNGKLGLLSEIISGASAGACQVIFTNPLEIVKIRL 665

Query: 148 QTQ---TASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYEALVANQ 204
           Q +    A          L  I +L   G L +G +  +LR+    A YF TY  L  + 
Sbjct: 666 QVKGEYVAENAENAKLTALQIIKRLGLPG-LYKGAAACLLRDVPFSAIYFPTYAHLKRDL 724

Query: 205 IG----KGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQ 260
                     RS +  W+L   GA++G+       P DVIK+ +Q D  K     K II 
Sbjct: 725 FNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRLQIDPKKGETIYKGIIH 784

Query: 261 VARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFEL 298
            AR +  +  +KSFFKG    +LR++P  G T A +EL
Sbjct: 785 AARTILREESFKSFFKGGAARVLRSSPQFGFTLAAYEL 822

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 36/143 (25%), Positives = 64/143 (44%), Gaps = 16/143 (11%)

Query: 24  VLKDLLAGTAGGMAQVLVGQPFDTTKVRLQ---------TSTTPTTAVEVVKKLVKNEGL 74
           +L ++++G + G  QV+   P +  K+RLQ               TA++++K+L    GL
Sbjct: 637 LLSEIISGASAGACQVIFTNPLEIVKIRLQVKGEYVAENAENAKLTALQIIKRL----GL 692

Query: 75  RGFYKGTLTPLVGVGACVSCQFGVNEAMKR-FFRGSSADPHKTLTLPQYYI--CGFVGGV 131
            G YKG    L+      +  F     +KR  F     D +K   L  + +   G + G+
Sbjct: 693 PGLYKGAAACLLRDVPFSAIYFPTYAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGM 752

Query: 132 ANSFLASPIEHVRIRLQTQTASG 154
             ++L +P + ++ RLQ     G
Sbjct: 753 PAAYLTTPFDVIKTRLQIDPKKG 775

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score =  100 bits (250), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 78/289 (26%), Positives = 132/289 (45%), Gaps = 23/289 (7%)

Query: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQ-------TSTTPTTAVEVVKKLVKNEGLRGFYK 79
           +L+AG   G+ + L   P DT KVR+Q           P   ++  + +   EGL   YK
Sbjct: 13  NLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIYTEEGLLALYK 72

Query: 80  GTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHK-TLTLPQYYICGFVGGVANSFLA- 137
           G    ++G+   ++ +F   E    F+R + AD    +++    ++ G   G   + L  
Sbjct: 73  GLGAVVIGIIPKMAIRFSSYE----FYRSALADKQTGSVSTGNTFLAGVGAGTTEAVLVV 128

Query: 138 SPIEHVRIRLQTQTASGTVA---EFKGPLDC---INKLRANGALMRGLSPTILREAQGCA 191
           +P+E V+IRLQ Q      A    ++  L     I K    GAL RG+S T  R+A    
Sbjct: 129 NPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAARQATNQG 188

Query: 192 TYFLTYEALVANQIGKGIARSD-VPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLK 250
             F  Y  L   +  +   ++D +P+W+    G +SG     +  PLD IK+ +Q D   
Sbjct: 189 ANFTVYSKL--KEFLQEHHKTDALPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKST 246

Query: 251 NPVRG-KNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFEL 298
             + G   I+ + + +  + G+++ +KG  P ++R AP    TF  +E 
Sbjct: 247 ANMSGWSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEF 295

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 99.4 bits (246), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 84/314 (26%), Positives = 133/314 (42%), Gaps = 40/314 (12%)

Query: 11  IDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTP------------ 58
           +  ID +P      +    AG   G++++LV  P D  K R+Q   T             
Sbjct: 1   MTSIDNRPLP---FIYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAA 57

Query: 59  ----TTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPH 114
               T  ++ + K+VK EG    YKG  +P++      + +F  N+  + F++     P+
Sbjct: 58  VDHYTGVMDCLTKIVKKEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPN 117

Query: 115 KTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANG- 173
             +T       G   G   +F+ +P E V+IRLQ        ++FK P++ +      G 
Sbjct: 118 GEMTQKIAIYSGASAGAVEAFVVAPFELVKIRLQDVN-----SQFKTPIEVVKNSVVKGG 172

Query: 174 --ALMRGLSPTILREAQGCATY----FLTYEALVANQIGKGIARSDVPAWKLCLFGAVSG 227
             +L  GL  TI R     A Y    F   + L A +      R+D+ A      GA+ G
Sbjct: 173 VLSLFNGLEATIWRHVLWNAGYFGIIFQIRKLLPAAKTSTEKTRNDLIA------GAIGG 226

Query: 228 VTLWLTVYPLDVIKSLMQTDNLKNPVRGKNI-IQVARLVNAKYGWKSFFKGFGPTMLRAA 286
               L   P DV+KS +Q  +   P+R  N  +    LV  + G+K+ +KGF P ++R A
Sbjct: 227 TVGCLLNTPFDVVKSRIQRSS--GPLRKYNWSLPSVLLVYREEGFKALYKGFAPKVMRLA 284

Query: 287 PANGATFATFELAM 300
           P  G     F   M
Sbjct: 285 PGGGLLLVVFTNVM 298

>Scas_602.8
          Length = 885

 Score =  100 bits (248), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 82/280 (29%), Positives = 124/280 (44%), Gaps = 16/280 (5%)

Query: 29  LAGTAGGMAQVLVGQPFDTTKVRLQTSTTPT---TAVEVVKKLVKNEGLRGFYKGTLTPL 85
           L   AG +   LV  P D  K R+Q   + T    +++ + K+   EG+RG Y G    L
Sbjct: 504 LGSVAGCIGATLV-YPIDFIKTRMQAQRSLTKYKNSIDCLVKIFGKEGIRGLYSGLGPQL 562

Query: 86  VGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRI 145
           +GV    + +  VN+    F R S  D    L L    + G   G       +P+E V+I
Sbjct: 563 IGVAPEKAIKLTVND----FMRKSLVDKKGNLQLGAEVLSGATAGACQVVFTNPLEIVKI 618

Query: 146 RLQTQTASGTVAEFKGPL---DCINKLRANGALMRGLSPTILREAQGCATYFLTYEALVA 202
           RLQ ++        K  L     I +L+  G L +G+   +LR+    A YF TY  L  
Sbjct: 619 RLQVKSEYTNAMIPKSQLTAFQIIKELKLIG-LYKGVGACLLRDVPFSAIYFPTYAHLKK 677

Query: 203 NQI----GKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNI 258
           N           R  +  W+L   GA++GV       P DVIK+ +Q +      R   I
Sbjct: 678 NVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQIEPGVGETRYTGI 737

Query: 259 IQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFEL 298
           +   R +  +  ++SFFKG    ++R++P  G T A +EL
Sbjct: 738 LHAVRTILKEESFRSFFKGGAARVMRSSPQFGFTLAAYEL 777

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 63/147 (42%), Gaps = 30/147 (20%)

Query: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPT---------TAVEVVKKLVKNEGLRGF 77
           ++L+G   G  QV+   P +  K+RLQ  +  T         TA +++K+L     L G 
Sbjct: 595 EVLSGATAGACQVVFTNPLEIVKIRLQVKSEYTNAMIPKSQLTAFQIIKEL----KLIGL 650

Query: 78  YKGTLTPLVGVGACV-------SCQFGVNEAMKRF---FRGSSADPHKTLTLPQYYICGF 127
           YK       GVGAC+       +  F     +K+    F  +  D    L   +    G 
Sbjct: 651 YK-------GVGACLLRDVPFSAIYFPTYAHLKKNVFQFDPNDKDKRDRLKTWELLTAGA 703

Query: 128 VGGVANSFLASPIEHVRIRLQTQTASG 154
           + GV  +FL +P + ++ RLQ +   G
Sbjct: 704 LAGVPAAFLTTPFDVIKTRLQIEPGVG 730

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 33/75 (44%), Gaps = 5/75 (6%)

Query: 11  IDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQT-----STTPTTAVEVV 65
            D  D+   D  +  + L AG   G+    +  PFD  K RLQ       T  T  +  V
Sbjct: 682 FDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQIEPGVGETRYTGILHAV 741

Query: 66  KKLVKNEGLRGFYKG 80
           + ++K E  R F+KG
Sbjct: 742 RTILKEESFRSFFKG 756

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 92.8 bits (229), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 84/308 (27%), Positives = 136/308 (44%), Gaps = 37/308 (12%)

Query: 20  DSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQ---TSTTPTTAVEVVKKLVKNEGLRG 76
           D   V K++++G   G    +   P D  KVRLQ   T+  P    +VVK++VK+     
Sbjct: 4   DFSPVQKEMISGLTAGTITTVSTHPLDLVKVRLQLLATNKKPQGYYDVVKRIVKDSKQHS 63

Query: 77  F----YKGTLTPLVGVGACVSCQFGV------------NEAMKRFFRGSSADPHKTLTLP 120
           F    Y+G    L+G        FG+            N  +KRF   ++ +  K +T  
Sbjct: 64  FFRETYRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRF--NNTMNNDKEMTSL 121

Query: 121 QYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKL-RANG--ALMR 177
            Y +   + GVA S L +PI  ++ R+ + T+      ++  +D I KL R  G     R
Sbjct: 122 MYLLAAAMSGVATSVLTNPIWVIKTRIMS-TSFVDSRSYRSTVDGIKKLYRIEGLAGFWR 180

Query: 178 GLSPTILREAQGCATYFLTYEAL-----VANQIGKGIARSDVPAWKLCLFGAVSGVTLWL 232
           GL P++   +QG A YF  Y+ L      A  + K    S++    +     +  VT   
Sbjct: 181 GLVPSLFGVSQG-AIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLSKMVSVT--- 236

Query: 233 TVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKY---GWKSFFKGFGPTMLRAAPAN 289
            VYPL ++KS +Q+  +   +  K   +V +L+   Y   G    +KG    ++RA P+ 
Sbjct: 237 AVYPLQLLKSNLQSFEVSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANLIRAVPST 296

Query: 290 GATFATFE 297
             TF  +E
Sbjct: 297 CITFCVYE 304

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 91.7 bits (226), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 76/288 (26%), Positives = 131/288 (45%), Gaps = 22/288 (7%)

Query: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA-------VEVVKKLVKNEGLRGFYK 79
           +L+AG   G+ + L   P DT KVR+Q       +       ++   ++ +NEG   FYK
Sbjct: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72

Query: 80  GTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHK-TLTLPQYYICGFVGGVANSFLAS 138
           G    ++G+   ++ +F   E    F+R   AD     ++    +I G   G+  + +  
Sbjct: 73  GLGAVVIGITPKMAIRFSSYE----FYRTLLADKETGKVSTGNTFIAGVGAGITEAVVVV 128

Query: 139 PIEHV-RIRLQTQTASGT--VAEFKGPLD-CINKLRANG--ALMRGLSPTILREAQGCAT 192
               V +IRLQ Q  +      ++K  +  C   ++  G  AL RG+S T  R+A     
Sbjct: 129 NPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGA 188

Query: 193 YFLTYEALVANQIGKGIARSD-VPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKN 251
            F  Y  L   +  +G    + +P+W+  L G +SG     +  PLD IK+ +Q D    
Sbjct: 189 NFTVYSKL--KEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTK 246

Query: 252 PVRG-KNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFEL 298
            + G K I  + + +  + G+++ +KG  P ++R AP    TF  +E 
Sbjct: 247 NMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEF 294

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 91.3 bits (225), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 78/292 (26%), Positives = 131/292 (44%), Gaps = 27/292 (9%)

Query: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQ--------TSTTPTTAVEVVKKLVKNEGLRGFY 78
           +L+AG   G+ + L   P DT KVR+Q            P   ++  + + + EG    Y
Sbjct: 13  NLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALY 72

Query: 79  KGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHK-TLTLPQYYICGFVGGVANSFLA 137
           KG    ++G+   ++ +F   E    F+R    +     ++    ++ G   G+  + L 
Sbjct: 73  KGLGAVVIGIIPKMAIRFSSYE----FYRTLLVNKESGIVSTGNTFVAGVGAGITEAVLV 128

Query: 138 -SPIEHVRIRLQTQ--TASGTVA--EFKGPLDC---INKLRANGALMRGLSPTILREAQG 189
            +P+E V+IRLQ Q  T S   A  ++   +     I K     AL RG+S T  R+A  
Sbjct: 129 VNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATN 188

Query: 190 CATYFLTYEALVANQIGKGIARSDV-PAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTD- 247
               F  Y  L   +  +   + DV P+W+    G +SG     +  PLD IK+ +Q D 
Sbjct: 189 QGANFTVYSKL--KEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDK 246

Query: 248 --NLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
             +L+     K II +   +  + G+++ +KG  P ++R AP    TF  +E
Sbjct: 247 SISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYE 298

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score = 90.9 bits (224), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 78/288 (27%), Positives = 129/288 (44%), Gaps = 30/288 (10%)

Query: 25  LKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTP------TTAVEVVKKLVKNEGLRGFY 78
           L    AG   G++++LV  P D  K R+Q           T  V+ +KK+V  EG+   Y
Sbjct: 12  LYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLY 71

Query: 79  KGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLAS 138
           KG  +P++      + +F  N+  ++ ++   A   + L+ P   + G   G   +F+  
Sbjct: 72  KGISSPILMEAPKRATKFACNDEFQKLYK--QAFGVEKLSQPLSMLAGASAGCVEAFVVV 129

Query: 139 PIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANG---ALMRGLSPTILREAQGCATYF- 194
           P E V+IRLQ  ++S     +KGP+D + K+ A     A+  GL  T+ R A     YF 
Sbjct: 130 PFELVKIRLQDASSS-----YKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFG 184

Query: 195 LTYEAL----VANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQ-TDNL 249
           + ++A      A+   + I    +     C  G +          P DV+KS +Q T  +
Sbjct: 185 IIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST-------PFDVVKSRIQNTAVI 237

Query: 250 KNPVRGKNIIQVARL-VNAKYGWKSFFKGFGPTMLRAAPANGATFATF 296
              VR  N    + L +  + G+++ +KGF P +LR  P  G     F
Sbjct: 238 PGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 87/193 (45%), Gaps = 19/193 (9%)

Query: 109 SSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINK 168
           SS+D  K+L     +  G V GV+   +  P++ V+ R+Q Q   G    + G +DC+ K
Sbjct: 2   SSSDT-KSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKK 60

Query: 169 LRAN---GALMRGLSPTILREAQGCATYFLT---YEALVANQIGKGIARSDVPAWKLCLF 222
           + A    G L +G+S  IL EA   AT F     ++ L       G+ +   P   L   
Sbjct: 61  IVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAF--GVEKLSQPLSMLA-- 116

Query: 223 GAVSGVTLWLTVYPLDVIKSLMQ--TDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGP 280
           GA +G      V P +++K  +Q  + + K PV       V R + A+ G  + + G   
Sbjct: 117 GASAGCVEAFVVVPFELVKIRLQDASSSYKGPV------DVVRKIVAREGVLAMYNGLES 170

Query: 281 TMLRAAPANGATF 293
           T+ R A  NG  F
Sbjct: 171 TLWRHALWNGGYF 183

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 15/77 (19%)

Query: 24  VLKDLLAGTAGGMAQVLVGQPFDTTKVRLQ-TSTTPTTAVEVVKK----------LVKNE 72
           +  DL++ + G     ++  PFD  K R+Q T+  P     VV+K          + + E
Sbjct: 203 ITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPG----VVRKYNWSLPSLLTIYREE 258

Query: 73  GLRGFYKGTLTPLVGVG 89
           G R  YKG +  ++ +G
Sbjct: 259 GFRALYKGFVPKVLRLG 275

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 89.7 bits (221), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 74/296 (25%), Positives = 137/296 (46%), Gaps = 39/296 (13%)

Query: 25  LKDLLAGTAGGMAQVLVGQPFDTTKVRLQTS-TTPTTA------------VEVVKKLVKN 71
           +   ++G   G++++ V  P D  K R Q   TTPT A            ++ +KK+VK 
Sbjct: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKK 72

Query: 72  EGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRG--SSADPHKTLTLPQYYICGFVG 129
           EG    Y+G  +P++      + +F  N+  ++ F+   ++ +  + +++      G   
Sbjct: 73  EGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIA----AGASA 128

Query: 130 GVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALM---RGLSPTILRE 186
           G+  + +  P E ++IR+Q   +S     + GP+DC+ K   N  +M   +G+  T+ R 
Sbjct: 129 GMTEAAVIVPFELIKIRMQDVKSS-----YLGPMDCLKKTIKNEGIMGLYKGIESTMWRN 183

Query: 187 AQGCATYF-LTYEALVANQIGKGIA---RSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKS 242
           A     YF + Y+   +  + K      R+D+ A      GA+ G    +   P DV+KS
Sbjct: 184 ALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIA------GAIGGTVGTMLNTPFDVVKS 237

Query: 243 LMQT-DNLKNPVRGKNIIQVARLV-NAKYGWKSFFKGFGPTMLRAAPANGATFATF 296
            +Q+ D + + V+  N    + LV   + G+++ +KGF P + R AP        F
Sbjct: 238 RIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293

 Score = 55.8 bits (133), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 83/180 (46%), Gaps = 8/180 (4%)

Query: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQ-TSTTPTTAVEVVKKLVKNEGLRGFYKGTLTPL 85
            + AG + GM +  V  PF+  K+R+Q   ++    ++ +KK +KNEG+ G YKG  + +
Sbjct: 121 SIAAGASAGMTEAAVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTM 180

Query: 86  VGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRI 145
                     FGV   ++     +     KT       I G +GG   + L +P + V+ 
Sbjct: 181 WRNALWNGGYFGVIYQVRNSMPVAKTKGQKT---RNDLIAGAIGGTVGTMLNTPFDVVKS 237

Query: 146 RLQTQTA-SGTVAEFKGPLDCINKL-RANG--ALMRGLSPTILREAQGCATYFLTYEALV 201
           R+Q+  A S  V ++   L  +  + R  G  AL +G  P + R A G +   + +  ++
Sbjct: 238 RIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMM 297

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 39/88 (44%), Gaps = 7/88 (7%)

Query: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVK-------KLVKNEGLRGFYK 79
           DL+AG  GG    ++  PFD  K R+Q+    ++AV+           + + EG R  YK
Sbjct: 214 DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYK 273

Query: 80  GTLTPLVGVGACVSCQFGVNEAMKRFFR 107
           G +  +  +    S    V   M  FFR
Sbjct: 274 GFVPKVCRLAPGGSLMLVVFTGMMNFFR 301

>Kwal_26.8669
          Length = 296

 Score = 88.6 bits (218), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 77/286 (26%), Positives = 126/286 (44%), Gaps = 28/286 (9%)

Query: 30  AGTAGGMAQVLVGQPFDTTKVRLQTSTTP------TTAVEVVKKLVKNEGLRGFYKGTLT 83
           AG   G++++LV  P D  K R+Q   +          V+ +K++V  EG    YKG  +
Sbjct: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74

Query: 84  PLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHV 143
           P++      + +F  N+  ++ ++        T +L    + G   G   +F+  P E V
Sbjct: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLS--ILSGASAGCCEAFVVVPFELV 132

Query: 144 RIRLQTQTASGTVAEFKGPLDCINKLRANG---ALMRGLSPTILREAQGCATYF---LTY 197
           +IRLQ  ++S     +KGP+D + K+ A     A+  GL  T+ R     A YF      
Sbjct: 133 KIRLQDVSSS-----YKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQV 187

Query: 198 EALVANQIGKG-IARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQ-TDNLKNPVRG 255
            AL+     K    R+D+ A      G++ G    L   P DV+KS +Q T  +    R 
Sbjct: 188 RALLPEAKSKSQQTRNDLIA------GSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARK 241

Query: 256 KNIIQVARL-VNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAM 300
            N    +   +  + G+++ +KGF P +LR  P  G     F   M
Sbjct: 242 YNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCM 287

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 78/168 (46%), Gaps = 8/168 (4%)

Query: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQ-TSTTPTTAVEVVKKLVKNEGLRGFYKGTLTPL 85
            +L+G + G  +  V  PF+  K+RLQ  S++    ++VV+K++  EG+   Y G  + L
Sbjct: 111 SILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTL 170

Query: 86  VGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRI 145
              G   +  FG+   ++     + +   +T       I G +GG   S +++P + V+ 
Sbjct: 171 WRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRN---DLIAGSIGGTIGSLMSTPFDVVKS 227

Query: 146 RLQ-TQTASGTVAEFKG---PLDCINKLRANGALMRGLSPTILREAQG 189
           R+Q T   +G   ++      +  I K     AL +G  P +LR   G
Sbjct: 228 RIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPG 275

 Score = 56.6 bits (135), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 85/187 (45%), Gaps = 24/187 (12%)

Query: 119 LPQYY--ICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRA-NGA- 174
           LP +Y    G V G++   +  P++ V+ R+Q Q + G   ++KG +DCI ++ A  GA 
Sbjct: 7   LPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGAS 66

Query: 175 -LMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKL-----CLFGAVSGV 228
            L +G+S  +L EA   AT F        N   + I + +    KL      L GA +G 
Sbjct: 67  RLYKGISSPVLMEAPKRATKF------ACNDEFQKIYKREFGVEKLTQSLSILSGASAGC 120

Query: 229 TLWLTVYPLDVIKSLMQ--TDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAA 286
                V P +++K  +Q  + + K P      I V R + A+ G  + + G   T+ R  
Sbjct: 121 CEAFVVVPFELVKIRLQDVSSSYKGP------IDVVRKIIAQEGVLAMYNGLESTLWRHG 174

Query: 287 PANGATF 293
             N   F
Sbjct: 175 VWNAGYF 181

>Kwal_47.18216
          Length = 333

 Score = 87.4 bits (215), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 77/314 (24%), Positives = 133/314 (42%), Gaps = 47/314 (14%)

Query: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA-------VEVVKKLVKNEGLRGFYK 79
           +L+AG   G+ + L   P DT KVR+Q  +            +   + +   EG    YK
Sbjct: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72

Query: 80  GTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHK-TLTLPQYYICGFVGGVANSFLA- 137
           G    ++G+   ++ +F   E    FFR   AD     ++    ++ G   G+  + +  
Sbjct: 73  GLGAVVIGIIPKMAIRFTSYE----FFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVV 128

Query: 138 SPIEHVRIRLQTQTA---------SGTVA--------------------EFKGPLDC--- 165
           +P+E V+IRLQ Q           +G+V                     +++  +     
Sbjct: 129 NPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNAIQAAYV 188

Query: 166 INKLRANGALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAV 225
           I K     AL RG+S T  R+A      F  Y  L  +++ +      +P+W+  L G +
Sbjct: 189 IVKEEGPRALYRGVSLTAARQATNQGANFTVYSTL-KSRLQEYHQTDMLPSWETSLIGLI 247

Query: 226 SGVTLWLTVYPLDVIKSLMQTDNLKNPVRG-KNIIQVARLVNAKYGWKSFFKGFGPTMLR 284
           SG     +  PLD IK+ +Q D   +   G   I+ + R +  + G+++ +KG  P ++R
Sbjct: 248 SGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMR 307

Query: 285 AAPANGATFATFEL 298
            AP    TF  +EL
Sbjct: 308 VAPGQAVTFTVYEL 321

 Score = 35.4 bits (80), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 6/74 (8%)

Query: 44  PFDTTKVRLQTSTTPTT------AVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFG 97
           P DT K RLQ   + +        + + ++L++ EG R  YKG    ++ V    +  F 
Sbjct: 258 PLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFT 317

Query: 98  VNEAMKRFFRGSSA 111
           V E +++   G +A
Sbjct: 318 VYELIRKKLEGLTA 331

>Kwal_0.232
          Length = 274

 Score = 85.1 bits (209), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 81/281 (28%), Positives = 111/281 (39%), Gaps = 27/281 (9%)

Query: 20  DSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYK 79
           D    +  LLAG A G +  L   P DT K RLQ +               N G  G Y+
Sbjct: 2   DRSSFITSLLAGAAAGTSTDLFFFPIDTLKTRLQAA----------GGFFANGGYLGVYR 51

Query: 80  GTLTPLVGVGACVSCQFGVNEAMKRFFR-------GSSADPHKTLTLPQYYICGFVGGVA 132
           G  + +V      S  F   + MK + R        SS    +T T   +      G +A
Sbjct: 52  GLGSAVVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETAT---HMFSSSAGEIA 108

Query: 133 NSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCAT 192
              +  P E ++ R QT  +  ++   K  L   N       L RG S T++RE      
Sbjct: 109 ACMVRVPAEVIKQRTQTHKSDSSLQTLKKLLQNENGEGIRRNLYRGWSTTVMREIPFTCI 168

Query: 193 YFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNP 252
            F  YE L       G  R  V  W+    G V+G     T  PLDV+K+ +   +   P
Sbjct: 169 QFPLYEFLKKQWAISG-GREQVAPWQGAFCGCVAGGIAAATTTPLDVLKTRLMLSHTSVP 227

Query: 253 VRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATF 293
           V     + +AR + A  GWK FF G GP  +  + A GA F
Sbjct: 228 V-----LHLARQIYATEGWKVFFSGVGPRTVWIS-AGGAIF 262

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 1/71 (1%)

Query: 33  AGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACV 92
           AGG+A      P D  K RL  S T    + + +++   EG + F+ G     V + A  
Sbjct: 201 AGGIAAATT-TPLDVLKTRLMLSHTSVPVLHLARQIYATEGWKVFFSGVGPRTVWISAGG 259

Query: 93  SCQFGVNEAMK 103
           +   GV E + 
Sbjct: 260 AIFLGVYETVH 270

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 85.1 bits (209), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 73/288 (25%), Positives = 126/288 (43%), Gaps = 27/288 (9%)

Query: 29  LAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVE---------VVKKLVKNEGLRGFYK 79
           ++G   G+   +V  P D  K RLQ     T   E          +  +V++EG+RG YK
Sbjct: 73  ISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYK 132

Query: 80  GTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASP 139
           G +  ++G        F V E  K   R +S++     +   +       G  ++ + +P
Sbjct: 133 GLVPIIMGYFPTWMIYFSVYEFCKDNLRTNSSN----WSFVSHSFSAITAGAVSTVVTNP 188

Query: 140 IEHVRIRLQTQTASGT-VAEFKGPLDCINKL---RANGALMRGLSPTILREAQGCATYFL 195
           I  V+ RL  QT  G+    ++G  D   K+       AL  GL P++L      A +F 
Sbjct: 189 IWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPSLLGLLH-VAIHFP 247

Query: 196 TYEALVAN----QIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKN 251
            YE L  +    Q  +    S +   +L L  +VS +   +  YP +++++ +Q   LK+
Sbjct: 248 VYERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILRTRLQ---LKS 304

Query: 252 --PVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
             P   + +I + ++   + G   F+ GFG  + R  PA+  T  +FE
Sbjct: 305 DLPSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFE 352

>Scas_640.25
          Length = 306

 Score = 84.0 bits (206), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 76/294 (25%), Positives = 131/294 (44%), Gaps = 33/294 (11%)

Query: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQ----------TSTTPTTAVEVVKKLVKNEGLRG 76
             +AG   G+++++V  P D  K R+Q          ++T     ++ + ++VK EG   
Sbjct: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75

Query: 77  FYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFL 136
            YKG  +P++      + +F  N+   + ++  S    K LT     + G   G+  + +
Sbjct: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWK--SVFGTKQLTQQISVLSGASAGITEALV 133

Query: 137 ASPIEHVRIRLQTQTASGTVAEFKGPLDCINK-LRANG--ALMRGLSPTILREAQGCATY 193
             P E V+IRLQ        ++FKGP++ +   ++ +G   L  G+  T+ R A   A Y
Sbjct: 134 IVPFELVKIRLQDVN-----SKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGY 188

Query: 194 ----FLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTD-- 247
               F   E L   +  +   R+D     LC  G V G    +   P DV+KS +Q+D  
Sbjct: 189 FGVIFQVRELLPVAKSKQEKTRND-----LCA-GFVGGTFGVMFNTPFDVVKSRIQSDGN 242

Query: 248 NLKNPVRGKNIIQVARL-VNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAM 300
            + N VR  N    + + +  + G+++ +KGF P +LR  P        F   M
Sbjct: 243 EIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVM 296

>Scas_662.12
          Length = 308

 Score = 82.4 bits (202), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 71/307 (23%), Positives = 134/307 (43%), Gaps = 34/307 (11%)

Query: 19  HDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVE------VVKKLVKNE 72
           H+   + K++++G + G    L+  P D  KVRLQ   T TT         ++ +L+ N 
Sbjct: 2   HELTPIQKEIISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNS 61

Query: 73  G-----------LRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQ 121
                       ++  Y+G    L+G     S  F +  + K +   ++   +   T+  
Sbjct: 62  KKMGSQGPIYNLIKESYRGLPINLLGNAVAWSLYFTIYNSTKDYMFQNNYLHNNNTTI-- 119

Query: 122 YYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRAN---GALMRG 178
           +   G + G++ + L +P+  ++ R+ + T+      +K        L       A+  G
Sbjct: 120 FLTSGLISGISTTLLTNPLWVIKTRIMS-TSRHHKDSYKSIRHGFKSLLTKEGPKAIWMG 178

Query: 179 LSPTILREAQGCATYFLTYEALVAN---QIGKGIARSDVPAWKLCLFGAVSGVTLWLTVY 235
           L P++L  +QG A YF+ Y+ L  +    + K    +     K+ L  ++S +   ++VY
Sbjct: 179 LLPSLLGVSQG-AIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLSVMSVY 237

Query: 236 PLDVIKSLMQ-----TDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANG 290
           P  ++KS +Q     T+N+  P    + I + R +    G K  +KG    +LRA P+  
Sbjct: 238 PFQLLKSNLQTFRSVTNNI--PQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAIPSTC 295

Query: 291 ATFATFE 297
            TF  +E
Sbjct: 296 ITFCIYE 302

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 80.5 bits (197), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 77/318 (24%), Positives = 123/318 (38%), Gaps = 51/318 (16%)

Query: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQ--------------------------------- 53
           +L+AG   G+ + L   P DT KVR+Q                                 
Sbjct: 14  NLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGGDA 73

Query: 54  -TSTTPTTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSAD 112
             +  P   +   + +   EG    YKG    ++G+   ++ +F   E    F+R   AD
Sbjct: 74  TAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYE----FYRTLLAD 129

Query: 113 PHK-TLTLPQYYICGFVGGVANSFLA-SPIEHVRIRLQTQTASGTVAEFKGPLD------ 164
                ++    +I G   GV  + L  +P+E V+IRLQ Q  +      K          
Sbjct: 130 KQTGVVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAG 189

Query: 165 -CINKLRANGALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFG 223
             I K     AL RG+S T  R+A      F  Y  L    + +      +P+W+    G
Sbjct: 190 YTIIKEEGISALYRGVSLTAARQATNQGANFTVYSKL-REFLQEYHGTETLPSWETSCIG 248

Query: 224 AVSGVTLWLTVYPLDVIKSLMQTD---NLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGP 280
            +SG     +  PLD IK+ +Q D   + K     K I  +   +  + G+++ +KG  P
Sbjct: 249 LISGAIGPFSNAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGITP 308

Query: 281 TMLRAAPANGATFATFEL 298
            ++R AP    TF  +E 
Sbjct: 309 RVMRVAPGQAVTFTVYEF 326

 Score = 32.3 bits (72), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 31/69 (44%), Gaps = 8/69 (11%)

Query: 44  PFDTTKVRLQTSTTPTTAVE--------VVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQ 95
           P DT K RLQ   + +   E        +  +L+K EG R  YKG    ++ V    +  
Sbjct: 261 PLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGITPRVMRVAPGQAVT 320

Query: 96  FGVNEAMKR 104
           F V E ++R
Sbjct: 321 FTVYEFVRR 329

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 79.7 bits (195), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 76/303 (25%), Positives = 131/303 (43%), Gaps = 39/303 (12%)

Query: 26  KDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVE-----VVKKLVKNEGLRG---- 76
           K++++G + G    LV  P D  KVRLQ S T           V+K+++++    G    
Sbjct: 11  KEVISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSANSGRSVT 70

Query: 77  --FYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADP-----------HKTLTLPQYY 123
              Y+G    L G        FG+    K     S A P           HK  +L  Y 
Sbjct: 71  NELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSLI-YL 129

Query: 124 ICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINK-LRANG--ALMRGLS 180
             G   G+  + L +PI  ++ R+ + T+ G    +    + + + LR +G   L +GL 
Sbjct: 130 SAGASSGLMTAILTNPIWVIKTRIMS-TSKGAQGAYTSMYNGVQQLLRTDGFQGLWKGLV 188

Query: 181 PTILREAQGCATYFLTYEALVANQI------GKGIARSDVPAWKLCLFGAVSGVTLWLTV 234
           P +   +QG A YF  Y+ L   ++      G  I  +++   ++   G +  VTL   V
Sbjct: 189 PALFGVSQG-ALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVSVTL---V 244

Query: 235 YPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFA 294
           YP  ++KS +Q+   +   +   +  + +L+ A  G+   +KG    ++RA P+   TF 
Sbjct: 245 YPFQLLKSNLQS--FRANEQKFRLFPLIKLIIANDGFVGLYKGLSANLVRAIPSTCITFC 302

Query: 295 TFE 297
            +E
Sbjct: 303 VYE 305

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 38/93 (40%), Gaps = 10/93 (10%)

Query: 114 HKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANG 173
           H+   L +  I G   G   + +  P++ +++RLQ    S   A + GP   I ++  + 
Sbjct: 4   HQWTPLQKEVISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHY-GPFMVIKEIIRSS 62

Query: 174 A---------LMRGLSPTILREAQGCATYFLTY 197
           A         L RGLS  +   A     YF  Y
Sbjct: 63  ANSGRSVTNELYRGLSINLFGNAIAWGVYFGLY 95

 Score = 29.3 bits (64), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 29/74 (39%), Gaps = 3/74 (4%)

Query: 34  GGMAQVLVGQPFDTTKVRLQTSTTPTTAVEV---VKKLVKNEGLRGFYKGTLTPLVGVGA 90
           G M  V +  PF   K  LQ+         +   +K ++ N+G  G YKG    LV    
Sbjct: 236 GKMVSVTLVYPFQLLKSNLQSFRANEQKFRLFPLIKLIIANDGFVGLYKGLSANLVRAIP 295

Query: 91  CVSCQFGVNEAMKR 104
                F V E +K 
Sbjct: 296 STCITFCVYENLKH 309

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 78.6 bits (192), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 78/301 (25%), Positives = 127/301 (42%), Gaps = 31/301 (10%)

Query: 15  DQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTT------AVEVVKKL 68
           DQ+P      +   +AG   G++++LV  P D  K  +Q   +  +        + +K++
Sbjct: 3   DQKPLP---FVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQI 59

Query: 69  VKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFV 128
              EG    YKG  +P++      + +F  N+  ++ ++       + LT P   + G  
Sbjct: 60  AAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFG--AEKLTQPLSILSGAS 117

Query: 129 GGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCI-NKLRANG--ALMRGLSPTILR 185
            G+  SF+  P E V+IRLQ  ++     +F  P+  + N +   G  A+  GL  T+ R
Sbjct: 118 AGICESFVVVPFELVKIRLQDVSS-----KFTSPIAVVKNIVEKEGILAMYNGLESTMWR 172

Query: 186 EAQGCATYF---LTYEALVANQIGKG-IARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIK 241
                A YF       AL+     K    R+D+      L G V G    L   P DV+K
Sbjct: 173 HGIWNAGYFGIIFQVRALLPKASTKSEQTRNDL------LAGTVGGTLSSLLSTPFDVVK 226

Query: 242 SLMQTDNLKNPVRGKNIIQVARL--VNAKYGWKSFFKGFGPTMLRAAPANGATFATFELA 299
           S +Q   +   V  K       L  +  + G+K+ +KGF P +LR  P  G     F   
Sbjct: 227 SRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGV 286

Query: 300 M 300
           M
Sbjct: 287 M 287

 Score = 40.4 bits (93), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 40/88 (45%), Gaps = 7/88 (7%)

Query: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQ-TSTTP------TTAVEVVKKLVKNEGLRGFYK 79
           DLLAGT GG    L+  PFD  K R+Q T+  P        +   +  + K EG +  YK
Sbjct: 204 DLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYK 263

Query: 80  GTLTPLVGVGACVSCQFGVNEAMKRFFR 107
           G +  ++ +G        V   +  FFR
Sbjct: 264 GFVPKVLRLGPGGGILLVVFTGVMDFFR 291

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 78.6 bits (192), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/323 (21%), Positives = 123/323 (38%), Gaps = 69/323 (21%)

Query: 13  DIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTT---------PTTAVE 63
           D +  P ++  V + L AG   G+ +  +  P D  K R+Q  +T         P+  + 
Sbjct: 7   DYEALPENAPLVYQ-LAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLA 65

Query: 64  VVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMK-RFFRGSSADPHKTLTLPQY 122
            + K+   EG    +KG  + ++G G   +  F   E  K R         H+ L   + 
Sbjct: 66  QIAKISTTEGSLALWKGVQSVVLGAGPAHAVYFATYEMCKSRLIDPEDRQTHQPL---KT 122

Query: 123 YICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSPT 182
            + G +  VA   L +P + ++ RLQ             P D + K              
Sbjct: 123 ALSGTLATVAADALMNPFDTIKQRLQLH-----------PSDSMTKCAVR---------- 161

Query: 183 ILREAQGCATYFLTYEALVANQIGKGI--------------ARSDVPAWKLCLFGAVSGV 228
            + + +G A +F +Y   +A  I                    ++   W  CL G +SG 
Sbjct: 162 -MYQREGIAAFFYSYPTTIAMNIPFAALNFVIYESSTKIFNPSNNYNPWIHCLCGGISGA 220

Query: 229 TLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQ------------VARLVNAKYGWKSFFK 276
           T      PLD +K+++Q       +RG + +Q             A  ++  YGW  FF+
Sbjct: 221 TCAAITTPLDCVKTVLQ-------IRGADSVQSQLFKEADTFRKAASAIHKTYGWSGFFR 273

Query: 277 GFGPTMLRAAPANGATFATFELA 299
           G  P ++   PA   ++ ++E A
Sbjct: 274 GLKPRIISNMPATAISWTSYEFA 296

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 83/196 (42%), Gaps = 16/196 (8%)

Query: 10  LIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLV 69
           LID  D+Q H   + LK  L+GT   +A   +  PFDT K RLQ   +  +  +   ++ 
Sbjct: 108 LIDPEDRQTH---QPLKTALSGTLATVAADALMNPFDTIKQRLQLHPS-DSMTKCAVRMY 163

Query: 70  KNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVG 129
           + EG+  F+    T +       +  F + E+  + F     +P        + +CG + 
Sbjct: 164 QREGIAAFFYSYPTTIAMNIPFAALNFVIYESSTKIF-----NPSNNYNPWIHCLCGGIS 218

Query: 130 GVANSFLASPIEHVRIRLQTQTASGTVAE-------FKGPLDCINKLRANGALMRGLSPT 182
           G   + + +P++ V+  LQ + A    ++       F+     I+K        RGL P 
Sbjct: 219 GATCAAITTPLDCVKTVLQIRGADSVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPR 278

Query: 183 ILREAQGCATYFLTYE 198
           I+      A  + +YE
Sbjct: 279 IISNMPATAISWTSYE 294

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 78.6 bits (192), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 73/288 (25%), Positives = 118/288 (40%), Gaps = 29/288 (10%)

Query: 29  LAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTT--------AVEVVKKLVKNEGLRGFYKG 80
           L+G   G    +   P D  K RLQ     T          +  +  +V++EG RG YKG
Sbjct: 82  LSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKG 141

Query: 81  TLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYI-----CGFVGGVANSF 135
            +  ++G        F V E  K+FF G           PQ+            G A++ 
Sbjct: 142 LVPIVLGYFPTWMIYFSVYEFSKKFFHG---------IFPQFDFVAQSCAAITAGAASTT 192

Query: 136 LASPIEHVRIRLQTQTASGTV-AEFKGPLDCINKL---RANGALMRGLSPTILREAQGCA 191
           L +PI  V+ RL  Q+  G     +KG  D   KL       AL  GL P++L      A
Sbjct: 193 LTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGLFH-VA 251

Query: 192 TYFLTYEALVA--NQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNL 249
            +F  YE L    +   +    + +   +L +  +VS +      YP +++++ MQ  + 
Sbjct: 252 IHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQLKSD 311

Query: 250 KNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
                 + +  + +   A+ G K F+ GF   ++R  PA+  T  +FE
Sbjct: 312 IPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFE 359

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 76.3 bits (186), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 73/310 (23%), Positives = 126/310 (40%), Gaps = 38/310 (12%)

Query: 8   PLLIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQT----STTPTTAVE 63
           P+ + D +  P     +   L+AG   G+ +  V  P D  K R+Q+    S +    + 
Sbjct: 18  PMDLPDYEALP-THAPLYHQLIAGAFAGIMEHSVMFPIDALKTRIQSANAKSLSAKNMLS 76

Query: 64  VVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSS----ADPHKTLTL 119
            +  +  +EG    +KG  + ++G G   +  FG  E  K+    SS      P KT   
Sbjct: 77  QISHISTSEGTLALWKGVQSVILGAGPAHAVYFGTYEFCKKNLIDSSDTQTHHPFKTA-- 134

Query: 120 PQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGL 179
               I G     A+  L +P + ++ R+Q  T++      K     I +     A     
Sbjct: 135 ----ISGACATTASDALMNPFDTIKQRIQLNTSASVWQTTKQ----IYQSEGLAAFYYSY 186

Query: 180 SPTILREAQGCATYFLTYEALV-----ANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTV 234
             T++      A  F+ YE+       +N+    I          CL G++SG T     
Sbjct: 187 PTTLVMNIPFAAFNFVIYESSTKFLNPSNEYNPLIH---------CLCGSISGSTCAAIT 237

Query: 235 YPLDVIKSLMQ-----TDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPAN 289
            PLD IK+++Q     T +L+   +     + A  +   YGWK F++G+ P ++   PA 
Sbjct: 238 TPLDCIKTVLQIRGSQTVSLEIMRKADTFSKAASAIYQVYGWKGFWRGWKPRIVANMPAT 297

Query: 290 GATFATFELA 299
             ++  +E A
Sbjct: 298 AISWTAYECA 307

>Kwal_23.4731
          Length = 314

 Score = 75.9 bits (185), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/296 (24%), Positives = 121/296 (40%), Gaps = 26/296 (8%)

Query: 26  KDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA---VEVVKKLVKNEG-----LRGF 77
           ++++AG A G    +   P D  K+RLQ     T +    EV+K ++++        R  
Sbjct: 15  REIIAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVIKTIIRDSKADSNVFREA 74

Query: 78  YKGTLTPLVGVGACVSCQFGVNEAMKRF-FR----------GSSADPHKTLTLPQYYICG 126
           Y+G    L+G        FG+    K   +R           SS    K +    Y    
Sbjct: 75  YRGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLYLASA 134

Query: 127 FVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRAN---GALMRGLSPTI 183
            + G+  + L +PI  ++ R+ + T+S     +K   D I K+ A+       RGL P++
Sbjct: 135 ALSGLGTAILTNPIWVIKTRIMS-TSSQASERYKTTWDGIRKVYAHEGFSGFWRGLVPSL 193

Query: 184 LREAQGCATYFLTYEALVANQIGKGIARSDVPAWKL--CLFGAVSGVTLWLTVYPLDVIK 241
              AQG A YF  Y++L      +     D     L      +VS +     VYP  ++K
Sbjct: 194 FGVAQG-AIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSVSKMLSVTAVYPFQLLK 252

Query: 242 SLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
           S +Q+              + + ++ K G +  +KG    +LRA P+   TF  +E
Sbjct: 253 SNLQSFAAVEKRDSYRFWNLVKSIHQKEGLQGLYKGLSANLLRAIPSTCITFCIYE 308

 Score = 31.6 bits (70), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 79/204 (38%), Gaps = 19/204 (9%)

Query: 109 SSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCI-- 166
           SSA       L +  I G   G   +    P++ V++RLQ    +     +K  +  I  
Sbjct: 3   SSAMASDFTPLQREIIAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVIKTIIR 62

Query: 167 -NKLRAN--GALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVP-------- 215
            +K  +N      RGL   ++  +     YF  Y          G+A+   P        
Sbjct: 63  DSKADSNVFREAYRGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKD 122

Query: 216 -AWKLCLF---GAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGW 271
            A    L+    A+SG+   +   P+ VIK+ + + + +   R K      R V A  G+
Sbjct: 123 KAMGPSLYLASAALSGLGTAILTNPIWVIKTRIMSTSSQASERYKTTWDGIRKVYAHEGF 182

Query: 272 KSFFKGFGPTMLRAAPANGATFAT 295
             F++G  P++     A GA + T
Sbjct: 183 SGFWRGLVPSLF--GVAQGAIYFT 204

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 68/297 (22%), Positives = 132/297 (44%), Gaps = 34/297 (11%)

Query: 26  KDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTT---PTTAVEVVKKLVKN-----EGLRGF 77
           K++++G   G    +V  P D  K+RLQ +     P++    V++++K+     + L+  
Sbjct: 14  KEIISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQVQRIIKDGSGTQQLLKEA 73

Query: 78  YKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADP--------HKTLTLPQYYICGFVG 129
           Y+G    ++G        FG+    K      S++P         + +T   Y +     
Sbjct: 74  YRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYLVSAGAS 133

Query: 130 GVANSFLASPIEHVRIR-LQTQTASGTVAEFKGPLDCINKLRANGAL---MRGLSPTILR 185
           G+A + L +P+  ++ R + T+++ G    +   L+ I ++     L    RGL P++  
Sbjct: 134 GLATALLTNPMWVIKTRIMSTKSSQG----YTSILNAITRIYTEEGLKTFWRGLVPSLFG 189

Query: 186 EAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTL-----WLTVYPLDVI 240
             QG A YF  Y+ L    +     R+D+   +L     +  ++L       +VYPL ++
Sbjct: 190 VTQG-ALYFAIYDTLKLKYLHD---RNDIQERRLNAVETIGIISLSKMISVSSVYPLQLL 245

Query: 241 KSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
           K+ +QT   ++    K +  + R +    G   F+KG    ++RA P+   TF  +E
Sbjct: 246 KTNLQTFRTEHNENSK-MNSLIRSIWHTNGIAGFYKGLFANLVRAIPSTCITFGVYE 301

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 25/66 (37%), Gaps = 4/66 (6%)

Query: 44  PFDTTKVRLQTSTTPTTAVEVVKKLVKN----EGLRGFYKGTLTPLVGVGACVSCQFGVN 99
           P    K  LQT  T       +  L+++     G+ GFYKG    LV         FGV 
Sbjct: 241 PLQLLKTNLQTFRTEHNENSKMNSLIRSIWHTNGIAGFYKGLFANLVRAIPSTCITFGVY 300

Query: 100 EAMKRF 105
           E  K  
Sbjct: 301 EHFKHI 306

>Scas_582.7
          Length = 329

 Score = 74.3 bits (181), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 69/293 (23%), Positives = 118/293 (40%), Gaps = 35/293 (11%)

Query: 26  KDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTT------PTTAVEVVKKLVKNEGLRGFYK 79
             LLAG   G+ +     P D  K R+Q++TT       T+ ++ + K+   EG    +K
Sbjct: 38  HQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLALWK 97

Query: 80  GTLTPLVGVGACVSCQFGVNEAMK-RFFRGSSADPHKTLTLPQYYICGFVGGVANSFLAS 138
           G  + ++G G   +  F   E  K      S  + H+ + +    + G    VA+ F  +
Sbjct: 98  GVQSVILGAGPAHAVYFATYEFTKAHLIPDSQRETHQPIKVA---VSGATATVASDFFMN 154

Query: 139 PIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYE 198
           P + ++ R+Q         +       I  L    A       TI       A  F+ YE
Sbjct: 155 PFDTIKQRMQISDLKK--EKVYNVAKKIYNLEGLSAFYYSYPTTIAMNIPFAAFNFMIYE 212

Query: 199 ALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNI 258
           +  A++    +   + P    CL G +SG        PLD IK+++Q       +RG ++
Sbjct: 213 S--ASKFFNPLHHYN-PLIH-CLCGGISGAIAAAVTTPLDCIKTVIQ-------IRGSSV 261

Query: 259 IQVARLVNAK------------YGWKSFFKGFGPTMLRAAPANGATFATFELA 299
           + +  +  A             YGWK F++G  P +L   PA   ++  +E A
Sbjct: 262 VSLEVMKKANTFKKATSAILMVYGWKGFWRGLQPRILANMPATAISWTAYECA 314

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 76/184 (41%), Gaps = 8/184 (4%)

Query: 119 LPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINK---LRANGAL 175
           L    + G   G+       PI+ ++ R+Q+ T  GT       +  I+K   +  + AL
Sbjct: 36  LSHQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLAL 95

Query: 176 MRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVY 235
            +G+   IL      A YF TYE   A+ I      +  P  K+ + GA + V     + 
Sbjct: 96  WKGVQSVILGAGPAHAVYFATYEFTKAHLIPDSQRETHQPI-KVAVSGATATVASDFFMN 154

Query: 236 PLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFAT 295
           P D IK  MQ  +LK     + +  VA+ +    G  +F+  +  T+    P     F  
Sbjct: 155 PFDTIKQRMQISDLKK----EKVYNVAKKIYNLEGLSAFYYSYPTTIAMNIPFAAFNFMI 210

Query: 296 FELA 299
           +E A
Sbjct: 211 YESA 214

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 81/203 (39%), Gaps = 16/203 (7%)

Query: 4   ETSSPLLIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAV- 62
           E +   LI D  ++ H   + +K  ++G    +A      PFDT K R+Q S      V 
Sbjct: 118 EFTKAHLIPDSQRETH---QPIKVAVSGATATVASDFFMNPFDTIKQRMQISDLKKEKVY 174

Query: 63  EVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQY 122
            V KK+   EGL  FY    T +       +  F + E+  +FF     +P        +
Sbjct: 175 NVAKKIYNLEGLSAFYYSYPTTIAMNIPFAAFNFMIYESASKFF-----NPLHHYNPLIH 229

Query: 123 YICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAE-------FKGPLDCINKLRANGAL 175
            +CG + G   + + +P++ ++  +Q + +S    E       FK     I  +      
Sbjct: 230 CLCGGISGAIAAAVTTPLDCIKTVIQIRGSSVVSLEVMKKANTFKKATSAILMVYGWKGF 289

Query: 176 MRGLSPTILREAQGCATYFLTYE 198
            RGL P IL      A  +  YE
Sbjct: 290 WRGLQPRILANMPATAISWTAYE 312

>Scas_709.9
          Length = 365

 Score = 74.7 bits (182), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 67/287 (23%), Positives = 117/287 (40%), Gaps = 24/287 (8%)

Query: 29  LAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTT-------AVEVVKKLVKNEGLRGFYKGT 81
           L+G   G    ++  P D TK RLQ     +         +  +  +V +EG+RG YKG 
Sbjct: 69  LSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGLYKGL 128

Query: 82  LTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIE 141
           +  ++G        F V E  K  +      P+       +       G A++ L +PI 
Sbjct: 129 IPIILGYFPTWMIYFSVYEFAKDLY--PRVLPNSDFI--SHSCSAITAGAASTVLTNPIW 184

Query: 142 HVRIRLQTQTASG-TVAEFKGPLDCINKLRANG---ALMRGLSPTILREAQGCATYFLTY 197
            V+ RL  QT  G +   ++G +D   K+        L  GL P++       A +F  Y
Sbjct: 185 VVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMFGLLH-VAIHFPVY 243

Query: 198 EALVANQI-------GKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLK 250
           E L  N++       G       +   +L +  + S +   +  YP +++++ MQ  + K
Sbjct: 244 EKL-KNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILRTRMQLKSDK 302

Query: 251 NPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
             +    ++ + +      G   F+ GF   +LR  PA+  T  +FE
Sbjct: 303 LLISKHKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSFE 349

>Scas_558.2
          Length = 289

 Score = 73.9 bits (180), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 115/282 (40%), Gaps = 38/282 (13%)

Query: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYKGTLTPLV 86
            LL+G A G +  LV  P DT K RLQ                +N G  G Y+G  + +V
Sbjct: 9   SLLSGAAAGTSTDLVFFPIDTLKTRLQAK----------GGFFQNGGYHGIYRGLGSAVV 58

Query: 87  GVGACVSCQFGVNEAMKRFFR---------GSSADPHKTLTLPQYYICGFVGGVANSFLA 137
                 S  F   ++MK   R           +  PH   T+  + I   +G +A   + 
Sbjct: 59  ASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIV-HMIASSMGELAACLVR 117

Query: 138 SPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLTY 197
            P E ++ R Q  + + +   F+  L   N+      L RG S TI+RE       F  Y
Sbjct: 118 VPAEVIKQRTQVHSTNSSWQTFRTILKNENQEGIIRNLYRGWSTTIMREIPFTCIQFPLY 177

Query: 198 E------ALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKN 251
           E      AL  N++G       +  WK  + G+++G     T  PLD +K+ +  +    
Sbjct: 178 EFMKKEWALYDNEVG------HLKPWKGAICGSIAGGIAAATTTPLDFLKTRLMLNKDSI 231

Query: 252 PVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATF 293
           P++      + R +  + G+K FF G  P  +  + A GA F
Sbjct: 232 PIK-----SLIRNIYKEEGFKIFFSGIYPRTMWIS-AGGAIF 267

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 36/85 (42%), Gaps = 3/85 (3%)

Query: 33  AGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACV 92
           AGG+A      P D  K RL  +        +++ + K EG + F+ G     + + A  
Sbjct: 206 AGGIAAATT-TPLDFLKTRLMLNKDSIPIKSLIRNIYKEEGFKIFFSGIYPRTMWISAGG 264

Query: 93  SCQFGVNEAMKRFFRGSSADPHKTL 117
           +   GV E M   F   S +  KT+
Sbjct: 265 AIFLGVYETMH--FMLQSLEETKTI 287

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 72.8 bits (177), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/325 (21%), Positives = 127/325 (39%), Gaps = 52/325 (16%)

Query: 11  IDDIDQQP-HDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTST------------- 56
           I +ID +   D+  +   L+AG   G+ +  +  P D  K R+Q  +             
Sbjct: 6   IQEIDYEALPDTAPLSYQLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGG 65

Query: 57  --------TPTTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMK-RFFR 107
                      T ++ + ++   EG    ++G  + ++G G   +  F   E  K +   
Sbjct: 66  AGAASGGAGAGTLLQQISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLID 125

Query: 108 GSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCIN 167
               + H+ L      + G    VA   L +P + ++ RLQ Q+ S   + ++   + I 
Sbjct: 126 AKDFNTHQPLKTA---VSGVAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAFN-IY 181

Query: 168 KLRANGALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDV-PAWKLCLFGAVS 226
           K     A       T+       A  F+ YE+       K    ++    W  CL G ++
Sbjct: 182 KNEGPMAFFYSYPTTLAMNIPFAALNFVIYESST-----KFFNPTNAYNPWIHCLCGGIA 236

Query: 227 GVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQV------------ARLVNAKYGWKSF 274
           G T      PLD IK+++Q       +RG + + V            A+ +   YGWK F
Sbjct: 237 GATCAAVTTPLDCIKTVLQ-------IRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGF 289

Query: 275 FKGFGPTMLRAAPANGATFATFELA 299
           ++G  P ++   PA   ++ ++E A
Sbjct: 290 WRGLQPRVISNIPATAISWTSYEFA 314

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 72.4 bits (176), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/299 (24%), Positives = 129/299 (43%), Gaps = 37/299 (12%)

Query: 25  LKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA--------VEVVKKLVKNEGLRG 76
           +   ++G A G++++LV  P D  K R+Q      T         ++ + ++VK EG   
Sbjct: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68

Query: 77  FYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQY--YICGFVGGVANS 134
            YKG  +P++      + +F  N++ ++ F+    D +    L Q    + G + GV  +
Sbjct: 69  LYKGISSPMLMEAPKRATKFACNDSYQKMFK----DLYGVDKLTQQISILSGSLAGVTEA 124

Query: 135 FLASPIEHVRIRLQTQTASGTVAEFKGPLDCINK-LRANG--ALMRGLSPTILREAQGCA 191
            +  P E V+IRLQ        ++F GP++ + K +R  G  +L  GL  T+ R A    
Sbjct: 125 CVIVPFELVKIRLQDVN-----SKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNG 179

Query: 192 TYFLTYEALVANQIGKGIARSDVPAWKLC---LFGAVSGVTLWLTVYP-LDVIKSLMQTD 247
            YF      V  QI   + ++     K     + G + G   + T +  L V+KS +Q+ 
Sbjct: 180 GYF-----GVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSG 234

Query: 248 NLKNPVRGKNIIQVARL------VNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAM 300
                  G  + +          + ++ G+ + +KGF P +LR  P  G     F   M
Sbjct: 235 ATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMM 293

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 83/189 (43%), Gaps = 16/189 (8%)

Query: 114 HKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVA--EFKGPLDCINKL-- 169
            K L     ++ G   GV+   +  P++ V+ R+Q Q  SGT +   + G +DC+ ++  
Sbjct: 3   EKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVK 62

Query: 170 -RANGALMRGLSPTILREAQGCATYFL---TYEALVANQIGKGIARSDVPAWKLCLFGAV 225
                 L +G+S  +L EA   AT F    +Y+ +  +  G       +      L G++
Sbjct: 63  REGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQIS----ILSGSL 118

Query: 226 SGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRA 285
           +GVT    + P +++K  +Q  N K     + + +  R    + G  S + G   TM R 
Sbjct: 119 AGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIR----ETGILSLYNGLESTMWRN 174

Query: 286 APANGATFA 294
           A  NG  F 
Sbjct: 175 AFWNGGYFG 183

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 83/202 (41%), Gaps = 21/202 (10%)

Query: 11  IDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA-VEVVKKLV 69
           +D + QQ          +L+G+  G+ +  V  PF+  K+RLQ   +     +EVV K +
Sbjct: 104 VDKLTQQI--------SILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTI 155

Query: 70  KNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVG 129
           +  G+   Y G  + +          FGV   ++     +  +  KT       I G +G
Sbjct: 156 RETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKT---TNDLIAGTIG 212

Query: 130 GVAN-SFLASPIEHVRIRLQ----TQTASGTVA-EFKGPLDCINKLRAN---GALMRGLS 180
           G    S   + +  V+ R+Q    T  A GTV  ++      + K+ +     AL +G  
Sbjct: 213 GYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFI 272

Query: 181 PTILREAQGCATYFLTYEALVA 202
           P ILR   G     + +  ++A
Sbjct: 273 PKILRLGPGGGIMLVVFNGMMA 294

 Score = 28.5 bits (62), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 38/100 (38%), Gaps = 12/100 (12%)

Query: 20  DSGRVLKDLLAGTAGGMAQVLVGQP-FDTTKVRLQTSTTPTTAVEVVK-----------K 67
           ++ +   DL+AGT GG  +           K R+Q+  T T A   V            K
Sbjct: 198 NTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFK 257

Query: 68  LVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFR 107
           +   EG    YKG +  ++ +G        V   M  FF+
Sbjct: 258 IYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQ 297

>Scas_716.29
          Length = 316

 Score = 72.0 bits (175), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 75/323 (23%), Positives = 138/323 (42%), Gaps = 43/323 (13%)

Query: 11  IDDIDQQPHDSG--------RVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQ-----TSTT 57
           + +ID   H++         +V + L+AG+  G+    V  P DT K+RLQ     T   
Sbjct: 1   MTNIDDGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQA 60

Query: 58  PTTAVEVVKKLVKNE-GLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKT 116
           P+  ++++K ++ NE GLR F+KG +   +        QF         F G ++D +  
Sbjct: 61  PSGLLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLF-GETSDMNGQ 119

Query: 117 LTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANG--A 174
           L   Q  + G + G+ +SF++ P + +R R     A+  VA       C       G   
Sbjct: 120 L---QSLVVGALAGMTSSFVSYPTDVLRTRF---IANQDVALSSLSHGCKEIWNMEGIPG 173

Query: 175 LMRGLSPTILREAQGCATYFLTYEA--LVANQIGKGIARSDVPAWKLCLFGAVSGVTLWL 232
             RG + ++       +  F TYE+  +  ++  K    SD   +      ++SGVT  +
Sbjct: 174 FFRGCTASMFTITLSASILFGTYESIKIYCDEYSK---ESDYTNYLRYSASSISGVTSKM 230

Query: 233 TVYPLDVIKSLMQT-------DNLKNPV--------RGKNIIQVARLVNAKYGWKSFFKG 277
             YPLD I+  +Q         N++N +        +G + I++   +  + G  S ++G
Sbjct: 231 VTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQG 290

Query: 278 FGPTMLRAAPANGATFATFELAM 300
              ++ +  P+   +   +E  M
Sbjct: 291 VSMSLCKTVPSTVVSLWAYETVM 313

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 62/149 (41%), Gaps = 4/149 (2%)

Query: 6   SSPLLIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRL--QTSTTPTTAVE 63
           SS    +++  +  D    L+ L+ G   GM    V  P D  + R         ++   
Sbjct: 101 SSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSH 160

Query: 64  VVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYY 123
             K++   EG+ GF++G    +  +    S  FG  E++K +    S +   T  L   Y
Sbjct: 161 GCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLR--Y 218

Query: 124 ICGFVGGVANSFLASPIEHVRIRLQTQTA 152
               + GV +  +  P++ +R R+Q + +
Sbjct: 219 SASSISGVTSKMVTYPLDTIRRRIQVRNS 247

>Scas_589.10
          Length = 316

 Score = 71.6 bits (174), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 80/313 (25%), Positives = 124/313 (39%), Gaps = 48/313 (15%)

Query: 14  IDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTP----TTAVEVVK--- 66
           ID+ P     + +  ++G   GM++ ++  P D  K R Q         T++V V K   
Sbjct: 4   IDKDPVKLPFIYQ-FISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPE 62

Query: 67  ---------KLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNE-----AMKRFFRGSSAD 112
                    K++K EG +  YKG   PL+      + +F  NE      MK+F      +
Sbjct: 63  HSSILSCLSKILKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKF---KLKE 119

Query: 113 PHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRAN 172
              T+TL    + G   G+  S +  P E V+IRLQ        ++++ P+ C   +  N
Sbjct: 120 VTSTVTL----LAGTFAGITESLIVVPFELVKIRLQDAQ-----SDYRSPIRCTRTIIEN 170

Query: 173 GALM---RGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPA-----WKLCLFGA 224
             L     G   TI R     A+YF     L+  Q+ K I R+             L GA
Sbjct: 171 QGLFGIYAGFESTIWRNTIWNASYF----GLIF-QVKKFIPRAKSTTKFQGIRNDFLVGA 225

Query: 225 VSGVTLWLTVYPLDVIKSLMQ-TDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTML 283
           ++G        P DV+K+ MQ +    + +      Q   L+    G K  +KG  P + 
Sbjct: 226 IAGCMSCFLSVPFDVVKTRMQGSKKTSSGMCYGWAWQSVFLIYRTEGIKGIYKGILPIIC 285

Query: 284 RAAPANGATFATF 296
           R  P  G     F
Sbjct: 286 RYGPGGGLLLVVF 298

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 41/91 (45%), Gaps = 12/91 (13%)

Query: 24  VLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTT------AVEVVKKLVKNEGLRGF 77
           +  D L G   G     +  PFD  K R+Q S   ++      A + V  + + EG++G 
Sbjct: 217 IRNDFLVGAIAGCMSCFLSVPFDVVKTRMQGSKKTSSGMCYGWAWQSVFLIYRTEGIKGI 276

Query: 78  YKGTLTPLV-----GVGACVSCQFGVNEAMK 103
           YKG L P++     G G  +    GVNE  +
Sbjct: 277 YKGIL-PIICRYGPGGGLLLVVFNGVNELFR 306

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 44/86 (51%), Gaps = 11/86 (12%)

Query: 223 GAVSGVTLWLTVYPLDVIKSLMQ---------TDNLKNPVRGKN--IIQVARLVNAKYGW 271
           GAV+G++  + +YPLDV+K+  Q         T ++  P + ++  I+     +  + G+
Sbjct: 20  GAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILKEEGF 79

Query: 272 KSFFKGFGPTMLRAAPANGATFATFE 297
           K+ +KG  P +L   P     FA+ E
Sbjct: 80  KNLYKGMSPPLLMEVPKRAVKFASNE 105

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 70.9 bits (172), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 76/281 (27%), Positives = 115/281 (40%), Gaps = 27/281 (9%)

Query: 20  DSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYK 79
           DS   L  L +G A G +  L   P DT K RLQ                 N G +G Y+
Sbjct: 2   DSSSFLVSLASGAAAGTSTDLAFFPIDTLKTRLQAK----------GGFFANGGYKGVYR 51

Query: 80  GTLTPLVGVGACVSCQFGVNEAMKRF-------FRGSSADPHKTLTLPQYYICGFVGGVA 132
           G  + ++      S  F   ++MK +       +  S+     TL+   +     +G V+
Sbjct: 52  GLGSAVIASAPSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLS---HMFSSSIGEVS 108

Query: 133 NSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCAT 192
              +  P E ++ R QT   + +   F   L   N       L RG + TI+RE      
Sbjct: 109 ACLVRVPAEVIKQRTQTHKTNSSWQTFTKILQNENGEGVLRNLYRGWNTTIMREIPFTCI 168

Query: 193 YFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNP 252
            F  YE L      K   +  V  W+  + G+V+G     T  PLDV+K+ +   +   P
Sbjct: 169 QFPLYEFL-KKTWAKRNGQDHVAPWQGSVCGSVAGAIAAATTTPLDVLKTRLMLSHKSIP 227

Query: 253 VRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATF 293
           V      Q+A+ + A+ G+K FF G GP  +  + A GA F
Sbjct: 228 V-----AQLAKNIYAEEGFKVFFSGVGPRTMWIS-AGGAIF 262

 Score = 28.1 bits (61), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 25/65 (38%)

Query: 44  PFDTTKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMK 103
           P D  K RL  S       ++ K +   EG + F+ G     + + A  +   GV E + 
Sbjct: 211 PLDVLKTRLMLSHKSIPVAQLAKNIYAEEGFKVFFSGVGPRTMWISAGGAIFLGVYETVH 270

Query: 104 RFFRG 108
               G
Sbjct: 271 SILSG 275

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 70.5 bits (171), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 80/279 (28%), Positives = 116/279 (41%), Gaps = 34/279 (12%)

Query: 25  LKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYKGTLTP 84
           L  LL+G A G +  LV  P DT K RLQ                +N G RG Y+G  + 
Sbjct: 6   LISLLSGAAAGTSTDLVFFPIDTLKTRLQAK----------GGFFRNGGYRGVYRGLGSA 55

Query: 85  LVGVGACVSCQFGVNEAMKR----FFRG--SSADPHKTLTLPQYYICGFVGGVANSFLAS 138
           +V      S  F   +  K     FFRG   S++    +T   +     +G +A   +  
Sbjct: 56  VVASAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVT---HMFSSSMGEIAACMVRV 112

Query: 139 PIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYE 198
           P E V+ R QT  +  +    +  L   N       L RG S TI+RE       F  YE
Sbjct: 113 PAEVVKQRSQTHASHSSWETLREILKNENGEGVRRNLYRGWSTTIMREIPFTCIQFPLYE 172

Query: 199 ALVANQIGKGIARSD-VPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKN 257
            +   ++   +  SD V  WK  + G+++G     T  PLD +K+ +        +  K 
Sbjct: 173 YM--KKVWAELDESDRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRL--------MLCKK 222

Query: 258 IIQVARLVNAKY---GWKSFFKGFGPTMLRAAPANGATF 293
            I +  LV+  Y   G+K FF G GP  +  + A GA F
Sbjct: 223 SIPLGTLVSTIYKEEGFKVFFSGVGPRTMWIS-AGGAIF 260

>Kwal_33.14050
          Length = 314

 Score = 70.5 bits (171), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 72/321 (22%), Positives = 128/321 (39%), Gaps = 57/321 (17%)

Query: 12  DDIDQQPHDSGRVL-KDLLAGTAGGMAQVLVGQPFDTTKVRLQT-----------STTPT 59
           ++ID +   +   L   L AG   G+ +  +  P D  K R+Q            +  P+
Sbjct: 3   EEIDYESLPTNAPLTHQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPS 62

Query: 60  TAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPH--KTL 117
             V+ + ++   EG    +KG  + ++G G   +  F   E  K +      DP   +T 
Sbjct: 63  NIVQQIARISTTEGSMALWKGVQSVILGAGPAHAVYFATYEMCKSYL----IDPQDFQTH 118

Query: 118 TLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMR 177
              +    G    VA   L +P + ++ R+Q +T S              K R     M 
Sbjct: 119 QPLKTAASGIAATVAADLLMNPFDTIKQRMQLRTFS--------------KDR-----MW 159

Query: 178 GLSPTILREAQGCATYFLTYEALVANQI-----GKGIARSDVPAWK---------LCLFG 223
            ++  I R  +G A +F +Y   +A  I        I  S    +           CL G
Sbjct: 160 SVASRIYRN-EGLAAFFYSYPTTIAMNIPFAAFNFAIYESATKFFNPENTYNPLIHCLCG 218

Query: 224 AVSGVTLWLTVYPLDVIKSLMQ---TDNLKNPV--RGKNIIQVARLVNAKYGWKSFFKGF 278
            +SG T      PLD IK+++Q   ++++ +P+  +     + A  ++  YGW  F++G 
Sbjct: 219 GISGATCAAITTPLDCIKTVLQVRGSESVVDPLFRQADTFSRAASAISKVYGWSGFWRGL 278

Query: 279 GPTMLRAAPANGATFATFELA 299
            P ++   PA   ++  +E A
Sbjct: 279 KPRIISNMPATAISWTAYECA 299

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 84/203 (41%), Gaps = 16/203 (7%)

Query: 4   ETSSPLLIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTST-TPTTAV 62
           E     LID  D Q H   + LK   +G A  +A  L+  PFDT K R+Q  T +     
Sbjct: 103 EMCKSYLIDPQDFQTH---QPLKTAASGIAATVAADLLMNPFDTIKQRMQLRTFSKDRMW 159

Query: 63  EVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQY 122
            V  ++ +NEGL  F+    T +       +  F + E+  +FF     +P  T     +
Sbjct: 160 SVASRIYRNEGLAAFFYSYPTTIAMNIPFAAFNFAIYESATKFF-----NPENTYNPLIH 214

Query: 123 YICGFVGGVANSFLASPIEHVRIRLQTQTASGTV-------AEFKGPLDCINKLRANGAL 175
            +CG + G   + + +P++ ++  LQ + +   V         F      I+K+      
Sbjct: 215 CLCGGISGATCAAITTPLDCIKTVLQVRGSESVVDPLFRQADTFSRAASAISKVYGWSGF 274

Query: 176 MRGLSPTILREAQGCATYFLTYE 198
            RGL P I+      A  +  YE
Sbjct: 275 WRGLKPRIISNMPATAISWTAYE 297

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/291 (23%), Positives = 121/291 (41%), Gaps = 24/291 (8%)

Query: 28  LLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYKGTLTPLVG 87
           L+AG+  G+       P DT K++LQ +     A  V+  ++K EG+RGF+KG +   + 
Sbjct: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA-NVLINILKREGIRGFWKGNVPGSIM 77

Query: 88  VGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYIC--GFVGGVANSFLASPIEHVRI 145
                  QFG    +  F RG   D + +   PQ Y C  G + G+ +S  + P + +R 
Sbjct: 78  YIIYGGAQFGSYTYIGSFLRGG-LDLNIS---PQLYSCLVGSLAGMTSSLASYPFDVLRT 133

Query: 146 RLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYEAL--VAN 203
           R     + G + + +  +  I           G   +++      A  F  YE++     
Sbjct: 134 RFAAN-SQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTE 192

Query: 204 QIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVR--------- 254
           +  K   R D       L G +SG T  L  +PLD ++  +Q  N  N  R         
Sbjct: 193 ERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDI 252

Query: 255 -----GKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAM 300
                 +  + V   +  + G  S ++G   +++++ P+   +  ++EL M
Sbjct: 253 YKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYELFM 303

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 82/202 (40%), Gaps = 22/202 (10%)

Query: 25  LKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTP--TTAVEVVKKLVKNEGLRGFYKGTL 82
           L   L G+  GM   L   PFD  + R   ++        + +  +  +EGL GF+ G  
Sbjct: 108 LYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCG 167

Query: 83  TPLVGVGACVSCQFGVNEAMKRFF--RGSSADPHKTLTLPQYYICGFVGGVANSFLASPI 140
           + ++ +G   +  FGV E++K F   R   +D     TL    + G + G  +     P+
Sbjct: 168 SSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLN-ELAGPISGFTSKLATFPL 226

Query: 141 EHVRIRLQTQTASGTVAEFKGPLDCINKLRANG----------------ALMRGLSPTIL 184
           + VR R+Q + +       +     I K   N                 +L RG++ +++
Sbjct: 227 DTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLI 286

Query: 185 REAQGCATYFLTYEALVANQIG 206
           +     A    +YE L  N++G
Sbjct: 287 KSVPSTAISLWSYE-LFMNKLG 307

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 69.3 bits (168), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 65/279 (23%), Positives = 120/279 (43%), Gaps = 12/279 (4%)

Query: 26  KDLLAGTAGGMAQVLVGQPFDTTKVRLQ---TSTTPTTAVEVVKKLVKNE--GLRGFYKG 80
           K++++G   G    L+  P D  KVRLQ   TSTT      +  ++V ++    R  Y+G
Sbjct: 10  KEVISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKGYRNLWSEIVGSDLSLTRELYRG 69

Query: 81  TLTPLVGVGACVSCQFGVNEAMKRFF--RGSSADPHKTLTLPQYYICGFVGGVANSFLAS 138
               LVG        F      K +           K L+   Y       G+  + L +
Sbjct: 70  LTVNLVGNTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASSGMLTTVLTN 129

Query: 139 PIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYE 198
           P+  ++ R+ ++ A+  +   K   D I      G L +GL P ++  +QG A +F  Y+
Sbjct: 130 PLWVIKTRMMSK-ANSDLTSMKVLRDLIKNDGVQG-LWKGLVPALVGVSQG-ALHFTCYD 186

Query: 199 ALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNI 258
            L    + K     ++   +     +VS +     VYP  ++KS +Q+   +       +
Sbjct: 187 TLKHKLVLKNRDSDEITNLETIAVTSVSKMLSTSAVYPFQLLKSNLQS--FQASENDFKL 244

Query: 259 IQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
           + +++++ ++ G   F+KG    +LR+ P+   TF  +E
Sbjct: 245 LPLSKMIYSRSGLLGFYKGLSANLLRSVPSTCITFCIYE 283

 Score = 35.8 bits (81), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 53/133 (39%), Gaps = 5/133 (3%)

Query: 119 LPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCI--NKLRANGALM 176
           L +  I G   G   + +  P++  ++RLQ    S T   ++     I  + L     L 
Sbjct: 8   LQKEVISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKGYRNLWSEIVGSDLSLTRELY 67

Query: 177 RGLSPTILREAQGCATYFLTYEA---LVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLT 233
           RGL+  ++        YF +Y      + N   +     D+ +W      A SG+   + 
Sbjct: 68  RGLTVNLVGNTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASSGMLTTVL 127

Query: 234 VYPLDVIKSLMQT 246
             PL VIK+ M +
Sbjct: 128 TNPLWVIKTRMMS 140

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 69.3 bits (168), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/274 (24%), Positives = 118/274 (43%), Gaps = 12/274 (4%)

Query: 31  GTAGGMAQVLVGQPFDTTKVRLQTSTTPT-TAVEVVKKLVKNEGLRGFYKGTLTPLVGVG 89
           G A G+  V+   P D TKVRLQ +  P  T V++++ ++KNEG+ G Y G    L+   
Sbjct: 13  GGAAGIFAVMNTHPLDLTKVRLQAAPIPKPTIVQMLRSILKNEGIVGLYAGLSASLLRQC 72

Query: 90  ACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQT 149
              + +FG+ +A+K          +    L    + G +GG+A +F     + + IR+Q 
Sbjct: 73  TYTTARFGMYDALKEHVIPRDKLTNMWYLLGASMVSGALGGLAGNF----ADLINIRMQN 128

Query: 150 QTA--SGTVAEFKGPLDCINKL-RANGA---LMRGLSPTILREAQGCATYFLTYEALVAN 203
            +A        +K  +D + K+ +A GA    + G  P ++R     A+  +TY+     
Sbjct: 129 DSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMTASQVVTYDMFKNF 188

Query: 204 QIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVAR 263
            + K        +  L     ++G        P DVIK+++   + K      +  ++  
Sbjct: 189 LVTKYNMDPKKNSTHLT-SSLLAGFVATTVCSPADVIKTIVMNAHKKPGHNHDSSFKILM 247

Query: 264 LVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
               K G    F+G+ P+  R AP     F   E
Sbjct: 248 EAINKEGPSFMFRGWVPSFTRLAPFTMLIFFAME 281

>Scas_717.20
          Length = 356

 Score = 69.3 bits (168), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 72/335 (21%), Positives = 129/335 (38%), Gaps = 58/335 (17%)

Query: 15  DQQPHDSGRVLKDLLAGTAGGM----AQVLVGQPFDTTKVRLQTSTTPTTAV-------- 62
           +Q P D   +     +G AGG+    A+ L+  P D  K+  QTS    T          
Sbjct: 20  NQMPIDKNSLEYITRSGLAGGISGSCAKTLIA-PLDRIKILFQTSNPHYTKYAGSLVGLK 78

Query: 63  EVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQY 122
           E  K +  N+G+RGF++G    L+ +    + +F   E ++     S         L   
Sbjct: 79  EAAKHIWLNDGIRGFFQGHSVTLMRIFPYAAVKFVAYEQIRNTLIPSKEYESHWRRL--- 135

Query: 123 YICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINK------LRANGAL- 175
            + G + G+ + F   P++ +R+RL   T    ++   G +  I K      L A G + 
Sbjct: 136 -MSGSLAGLCSVFTTYPLDLIRVRLAYVTEHKRIS-LLGLVKTIYKEPASTTLEAKGYIP 193

Query: 176 ---------MRGLSPTILREAQGCATYFLTYEAL------------------VANQIGKG 208
                     RG +PT+L         F  ++ L                   + Q  + 
Sbjct: 194 NWFAHWCNFYRGYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQEERH 253

Query: 209 IARSDVP--AWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLK----NPVRGKNIIQVA 262
                +P   W   L G ++G+      YP ++I+  +Q   L        R ++I ++A
Sbjct: 254 FKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIA 313

Query: 263 RLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
           +++  + GW+ FF G     ++  P    +F  +E
Sbjct: 314 KIIYKERGWRGFFVGLSIGYIKVTPMVACSFFVYE 348

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 41/90 (45%), Gaps = 9/90 (10%)

Query: 23  RVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAV---------EVVKKLVKNEG 73
           R   +LL+G   GMA      PF+  + RLQ ST   + +         E+ K + K  G
Sbjct: 262 RTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKERG 321

Query: 74  LRGFYKGTLTPLVGVGACVSCQFGVNEAMK 103
            RGF+ G     + V   V+C F V E MK
Sbjct: 322 WRGFFVGLSIGYIKVTPMVACSFFVYERMK 351

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 90/196 (45%), Gaps = 28/196 (14%)

Query: 126 GFVGGVANS---FLASPIEHVRIRLQTQTASGTVAEFKGPL----DCINKLRANGAL--- 175
           G  GG++ S    L +P++  RI++  QT++    ++ G L    +    +  N  +   
Sbjct: 36  GLAGGISGSCAKTLIAPLD--RIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGF 93

Query: 176 MRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVY 235
            +G S T++R     A  F+ YE +    I      S    W+  + G+++G+    T Y
Sbjct: 94  FQGHSVTLMRIFPYAAVKFVAYEQIRNTLIPSKEYESH---WRRLMSGSLAGLCSVFTTY 150

Query: 236 PLDVIKSLMQ--TDNLKNPVRG--KNIIQ--VARLVNAK-------YGWKSFFKGFGPTM 282
           PLD+I+  +   T++ +  + G  K I +   +  + AK         W +F++G+ PT+
Sbjct: 151 PLDLIRVRLAYVTEHKRISLLGLVKTIYKEPASTTLEAKGYIPNWFAHWCNFYRGYTPTV 210

Query: 283 LRAAPANGATFATFEL 298
           L   P  G +F   +L
Sbjct: 211 LGMIPYAGVSFFAHDL 226

>Kwal_27.12081
          Length = 369

 Score = 69.3 bits (168), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 71/300 (23%), Positives = 121/300 (40%), Gaps = 43/300 (14%)

Query: 40  LVGQPFDTTKVRLQTSTTPTTAVE----------------------VVKKLVKNEGLRGF 77
           +V  PFD  K RLQ+    +T                         ++  L K EG R  
Sbjct: 68  IVTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSL 127

Query: 78  YKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLA 137
           +KG    LVGV    S  F      K+ +  +  +  +   +  + I     G A S   
Sbjct: 128 FKGLGPNLVGVIPARSINFFTYGTTKQIYSRAFNNGEEAPWI--HLISAATAGWATSTAT 185

Query: 138 SPIEHVRIRLQTQTASGTVAEFKGPLDCINK-LRANG--ALMRGLSPTILREAQGCATYF 194
           +PI  ++ RLQ   A G   ++K   DC+   ++  G   L +GLS + L   +G   + 
Sbjct: 186 NPIWLIKTRLQLDKA-GHTRQYKNSWDCLKHIIQKEGFFGLYKGLSASYLGSVEGILQWL 244

Query: 195 LTYEALVA----------NQIGKGIARSDVPAWKLCLFGAVSGVTLWL---TVYPLDVIK 241
           L YE +              I +G   +     + C     +G+  +L     YP +V++
Sbjct: 245 L-YEQMKQMIKMRSIEKFGHISEGEKNTSEKIKEWCQRSGSAGLAKFLASIVTYPHEVVR 303

Query: 242 SLMQTDNLKN-PVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAM 300
           + ++   L+N  ++   +IQ  R++  + G  S + G  P +LR  P +   F T+EL +
Sbjct: 304 TRLRQAPLENDKLKYTGLIQSFRVIIKEEGLASMYGGLTPHLLRTVPNSIIMFGTWELVI 363

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 68.2 bits (165), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 76/274 (27%), Positives = 111/274 (40%), Gaps = 26/274 (9%)

Query: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYKGTLTPLV 86
            LL+G A G +  LV  P DT K RLQ                 N G +G Y+G  + +V
Sbjct: 7   SLLSGAAAGTSTDLVFFPIDTIKTRLQAK----------GGFFANGGYKGIYRGLGSAVV 56

Query: 87  GVGACVSCQFGVNEAMKRFFRGS-----SADPHKTLTLPQYYICGFVGGVANSFLASPIE 141
                 S  F   + MK   R       S    + +    + +   +G +    +  P E
Sbjct: 57  ASAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEICACLVRVPAE 116

Query: 142 HVRIRLQTQTASGTVAEFKGPLDCINK--LRANGALMRGLSPTILREAQGCATYFLTYEA 199
            V+ R Q  + + +    +  L   NK  LR N  L RG S TI+RE       F  YE 
Sbjct: 117 VVKQRTQVHSTNSSWQTLQSILRNDNKEGLRKN--LYRGWSTTIMREIPFTCIQFPLYEY 174

Query: 200 LVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNII 259
           L      K   +S V  WK  + G+++G     T  PLD +K+ +  +     + G  II
Sbjct: 175 L-KKTWAKANGQSQVEPWKGAICGSIAGGIAAATTTPLDFLKTRLMLNKTTASL-GSVII 232

Query: 260 QVARLVNAKYGWKSFFKGFGPTMLRAAPANGATF 293
           ++ R    + G   FF G GP  +  + A GA F
Sbjct: 233 RIYR----EEGPAVFFSGVGPRTMWIS-AGGAIF 261

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 68.6 bits (166), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 70/315 (22%), Positives = 124/315 (39%), Gaps = 48/315 (15%)

Query: 24  VLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA---------VEVVKKLVKNEGL 74
           V   L  G AG  A+ LV  P D  K+  QTS  P  A         V   K ++ ++G 
Sbjct: 20  VKSGLAGGIAGSCAKTLVA-PLDRIKILFQTSN-PQFAQFAGSMGGLVRASKYIMAHDGP 77

Query: 75  RGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANS 134
           RGF++G    L+ +    + +F   E ++     +         L    + G + G+ + 
Sbjct: 78  RGFFQGHSATLLRIFPYAAIKFIAYEQIRSVVIPTWRHESHWRRL----LSGSLAGLCSV 133

Query: 135 FLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGAL---------------MRGL 179
           F+  P++ VR+RL   T     A+ +  + CI   R + AL                RG 
Sbjct: 134 FVTYPLDLVRVRLAYVTERHD-AKVRKIMACIYNERPSEALRKWYIPQWFAHWSNFYRGY 192

Query: 180 SPTILREAQGCATYFLTYEAL-------------VANQIGKGIARSDVP--AWKLCLFGA 224
           +PT++         F  ++               V +  G       VP   W   + G 
Sbjct: 193 TPTVIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRTVPLKTWAQLVAGG 252

Query: 225 VSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGK--NIIQVARLVNAKYGWKSFFKGFGPTM 282
           ++G+      YP ++I+  +Q   + +P R     I ++A+++  + GW+ FF G     
Sbjct: 253 LAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIYTEGGWRGFFVGLSIGY 312

Query: 283 LRAAPANGATFATFE 297
           ++  P    +F  +E
Sbjct: 313 IKVTPMVACSFFIYE 327

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 91/199 (45%), Gaps = 35/199 (17%)

Query: 126 GFVGGVANSF---LASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALM------ 176
           G  GG+A S    L +P++  RI++  QT++   A+F G +  +  +RA+  +M      
Sbjct: 23  GLAGGIAGSCAKTLVAPLD--RIKILFQTSNPQFAQFAGSMGGL--VRASKYIMAHDGPR 78

Query: 177 ---RGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLT 233
              +G S T+LR     A  F+ YE + +  I      S    W+  L G+++G+     
Sbjct: 79  GFFQGHSATLLRIFPYAAIKFIAYEQIRSVVIPTWRHESH---WRRLLSGSLAGLCSVFV 135

Query: 234 VYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAK--------------YGWKSFFKGFG 279
            YPLD+++  +     ++  + + I+  A + N +                W +F++G+ 
Sbjct: 136 TYPLDLVRVRLAYVTERHDAKVRKIM--ACIYNERPSEALRKWYIPQWFAHWSNFYRGYT 193

Query: 280 PTMLRAAPANGATFATFEL 298
           PT++   P  G +F   +L
Sbjct: 194 PTVIGMIPYAGVSFFAHDL 212

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 42/92 (45%), Gaps = 7/92 (7%)

Query: 23  RVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTS--TTPT----TAVEVVKKLVKNEG-LR 75
           +    L+AG   GMA      PF+  + RLQ S  T PT      +  + K++  EG  R
Sbjct: 243 KTWAQLVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIYTEGGWR 302

Query: 76  GFYKGTLTPLVGVGACVSCQFGVNEAMKRFFR 107
           GF+ G     + V   V+C F + E  K + +
Sbjct: 303 GFFVGLSIGYIKVTPMVACSFFIYERTKWYLQ 334

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 67.8 bits (164), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 72/314 (22%), Positives = 128/314 (40%), Gaps = 35/314 (11%)

Query: 16  QQPHDSGRVLKD-----LLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTT----AVEVVK 66
           +QP+     LK       LAG   G     V  PF+  K+ LQ  ++ T+        ++
Sbjct: 9   EQPNSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIR 68

Query: 67  KLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEA-MKRFFRGSSADPHKTLTLPQYYIC 125
           ++   EG +G ++G     + +    + QF V EA  K+ F  +  +  + LT  Q    
Sbjct: 69  QVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFS 128

Query: 126 GFVGGVANSFLASPIEHVRIRLQTQTA---------SGTVAEFKGPLDCINK-LRANG-- 173
           G + G  +     P++ ++ RL  QTA         + ++++  G    +++  R  G  
Sbjct: 129 GALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGL 188

Query: 174 -ALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDV-PAWKLCLF----GAVSG 227
             L RG+ PT L      A  F  YE L       G+  SD  P+WK  L+    GA+SG
Sbjct: 189 RGLYRGVWPTSLGVVPYVALNFAVYEQLRE----FGVNSSDAQPSWKSNLYKLTIGAISG 244

Query: 228 VTLWLTVYPLDVIKSLMQTDNLKNP---VRGKNIIQVARLVNAKYGWKSFFKGFGPTMLR 284
                  YP D+++   Q   +       R  ++      +    G   ++KG    + +
Sbjct: 245 GVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFK 304

Query: 285 AAPANGATFATFEL 298
             P+   ++  +E+
Sbjct: 305 VVPSTAVSWLVYEV 318

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 76/197 (38%), Gaps = 23/197 (11%)

Query: 26  KDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAV---------------EVVKKLVK 70
           + L +G   G   V+   P D  K RL   T   +++               +++ +  +
Sbjct: 124 QRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYR 183

Query: 71  NEG-LRGFYKGTLTPLVGVGACVSCQFGVNEAMKRF-FRGSSADPHKTLTLPQYYICGFV 128
            EG LRG Y+G     +GV   V+  F V E ++ F    S A P     L +  I    
Sbjct: 184 LEGGLRGLYRGVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAIS 243

Query: 129 GGVANSFLASPIEHVRIRLQTQTASGTVAEFK-----GPLDCINKLRANGALMRGLSPTI 183
           GGVA + +  P + +R R Q     G    F+       L  I +        +GL+  +
Sbjct: 244 GGVAQT-ITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANL 302

Query: 184 LREAQGCATYFLTYEAL 200
            +     A  +L YE +
Sbjct: 303 FKVVPSTAVSWLVYEVV 319

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/302 (23%), Positives = 125/302 (41%), Gaps = 52/302 (17%)

Query: 44  PFDTTKVRLQT------------STTPTTA-------------VEVVKKLVKNEGLRGFY 78
           PFD  K RLQ+            S  P  A               ++  + +NEG R  +
Sbjct: 72  PFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGFRSLF 131

Query: 79  KGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLAS 138
           KG    LVGV    S  F      K  +  +  +  + + +  + +     G A S   +
Sbjct: 132 KGLGPNLVGVIPARSINFFTYGTTKEIYSKTLNNGQEAVWI--HLMAAATAGWATSTATN 189

Query: 139 PIEHVRIRLQTQTASGTVAEFKGPLDCI-NKLRANG--ALMRGLSPTILREAQGCATYFL 195
           PI  V+ RLQ   A GT  ++K   DC+ N ++  G   L +GLS + L   +G   + L
Sbjct: 190 PIWLVKTRLQLDKA-GTTKKYKNSWDCLKNVVQKEGILGLYKGLSASYLGSVEGILQWVL 248

Query: 196 TYEALVA-------------NQIGKGIARSDVPAWKLCLFGAVSGVTLW---LTVYPLDV 239
            YE +               +++ K  +   +  W  C     +G+  +   +  YP +V
Sbjct: 249 -YEQMKHIIKQRSMEKFGNISEVEKSTS-DKIKEW--CQRSGSAGLAKFVASIITYPHEV 304

Query: 240 IKSLMQTDNLKN-PVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFEL 298
           +++ ++   L+N  ++   ++Q  R++  + G  S + G  P +LR  P +   F T+EL
Sbjct: 305 VRTRLRQAPLENGKLKYTGLVQSIRVIIKEEGLASMYGGLTPHLLRTVPNSIIMFGTWEL 364

Query: 299 AM 300
            +
Sbjct: 365 VI 366

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 67.4 bits (163), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 74/313 (23%), Positives = 124/313 (39%), Gaps = 36/313 (11%)

Query: 5   TSSPLLIDDIDQQPHDSGRVLKD-LLAGTAGGMAQVLVGQPFDTTKVRLQTS----TTPT 59
           TS   + ++ID +   S   L   LLAG   G+ +  +  P D  K R+Q +       T
Sbjct: 3   TSELSIAEEIDYEALPSHAPLHSQLLAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAAST 62

Query: 60  TAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMK-RFFRGSSADPHKTLT 118
             +  + K+   EG    +KG  + ++G G   +  FG  E  K R         H+ + 
Sbjct: 63  GMISQISKISTMEGSMALWKGVQSVILGAGPAHAVYFGTYEFCKARLISPEDMQTHQPM- 121

Query: 119 LPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRG 178
             +  + G +  +A   L +P + V+ RLQ  T        K     I +     A    
Sbjct: 122 --KTALSGTIATIAADALMNPFDTVKQRLQLDTNLRVWNVTKQ----IYQNEGFAAFYYS 175

Query: 179 LSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLD 238
              T+       A  F+ YE+  A++      ++       CL G +SG T      PLD
Sbjct: 176 YPTTLAMNIPFAAFNFMIYES--ASKFFN--PQNSYNPLIHCLCGGISGATCAALTTPLD 231

Query: 239 VIKSLMQTDNLKNPVRGKNIIQVARLVNAK------------YGWKSFFKGFGPTMLRAA 286
            IK+++Q       VRG   + +  + +A             +GWK F++G  P ++   
Sbjct: 232 CIKTVLQ-------VRGSETVSIEIMKDANTFGRASRAILEVHGWKGFWRGLKPRIVANI 284

Query: 287 PANGATFATFELA 299
           PA   ++  +E A
Sbjct: 285 PATAISWTAYECA 297

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 67.4 bits (163), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 73/308 (23%), Positives = 127/308 (41%), Gaps = 28/308 (9%)

Query: 17  QPHDSGRVLKD-----LLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTT----AVEVVKK 67
           QP     +LK+      LAG   G     V  PF+  K+ LQ   + T      V  V++
Sbjct: 10  QPSYVKSILKNDSNVAFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQ 69

Query: 68  LVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKR-FFRGSSADPHKTLTLPQYYICG 126
           + + EG  G ++G     + +    + QF V EA K+ FF    +   + L   Q    G
Sbjct: 70  VYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSG 129

Query: 127 FVGGVANSFLASPIEHVRIRLQTQTASGT---------VAEFKGPLDCINK-LRANG--- 173
            + G  +     P++ VR RL  QTA+ T         +++  G  D + +  +  G   
Sbjct: 130 ALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIK 189

Query: 174 ALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLT 233
            L RG+ PT L      A  F  YE      + +G   +    +KL + GA+SG      
Sbjct: 190 GLYRGVWPTSLGVVPYVALNFAVYEQF-KEFMPEGTDNTLANFYKLSI-GALSGGVAQTV 247

Query: 234 VYPLDVIKSLMQTDNLKNP---VRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANG 290
            YP D+++   Q   +       R K+++     +    G++ ++KG    + +  P+  
Sbjct: 248 TYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTA 307

Query: 291 ATFATFEL 298
            ++  +E+
Sbjct: 308 VSWLVYEV 315

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 75/199 (37%), Gaps = 30/199 (15%)

Query: 26  KDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAV---------------EVVKKLVK 70
           + L +G   G   VL   P D  + RL   T   T +               +++ +  K
Sbjct: 124 QRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYK 183

Query: 71  NEG-LRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYY---ICG 126
            EG ++G Y+G     +GV   V+  F V E  K F    + +     TL  +Y   I  
Sbjct: 184 EEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDN-----TLANFYKLSIGA 238

Query: 127 FVGGVANSFLASPIEHVRIRLQTQTASGTVAEFK-----GPLDCINKLRANGALMRGLSP 181
             GGVA + +  P + +R R Q     G    F+       L  I K        +GL+ 
Sbjct: 239 LSGGVAQT-VTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTA 297

Query: 182 TILREAQGCATYFLTYEAL 200
            + +     A  +L YE +
Sbjct: 298 NLFKVIPSTAVSWLVYEVV 316

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 67.0 bits (162), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 68/289 (23%), Positives = 114/289 (39%), Gaps = 32/289 (11%)

Query: 26  KDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVK---NEGLRGFYKGTL 82
             LLAG   G+ +  V  P D  K R+Q+S++      ++K++ K    EG    +KG  
Sbjct: 18  HQLLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLIKQISKITTAEGSLALWKGVQ 77

Query: 83  TPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLP--QYYICGFVGGVANSFLASPI 140
           + ++G G   +  F   E    F +    DP    T    +  I G         L +P 
Sbjct: 78  SVILGAGPAHAVYFATYE----FSKSKLIDPQDMHTHQPIKTAISGMAATTVADALMNPF 133

Query: 141 EHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYEAL 200
           + ++ R+Q  T        K     I       A       T++      A  F  YE+ 
Sbjct: 134 DVIKQRMQLNTRESVWHVTKN----IYHKEGFAAFYYSYPTTLVMNIPFAAFNFAIYESA 189

Query: 201 V-----ANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQ---TDNLKNP 252
                 +N+    I          C+ G +SG T      PLD IK+++Q   ++ + N 
Sbjct: 190 TKFMNPSNEYNPFIH---------CISGGLSGATCAAITTPLDCIKTVLQVRGSETVSNE 240

Query: 253 V-RGKNIIQ-VARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELA 299
           + +  N  Q  A  +   +GWK F +G  P ++   PA   ++ ++E A
Sbjct: 241 IMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSYECA 289

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 82/202 (40%), Gaps = 16/202 (7%)

Query: 4   ETSSPLLIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVE 63
           E S   LID  D   H   + +K  ++G A       +  PFD  K R+Q +T  +    
Sbjct: 95  EFSKSKLIDPQDMHTH---QPIKTAISGMAATTVADALMNPFDVIKQRMQLNTRESV-WH 150

Query: 64  VVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYY 123
           V K +   EG   FY    T LV      +  F + E+  +F      +P        + 
Sbjct: 151 VTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFNFAIYESATKFM-----NPSNEYNPFIHC 205

Query: 124 ICGFVGGVANSFLASPIEHVRIRLQ---TQTASGTVAE----FKGPLDCINKLRANGALM 176
           I G + G   + + +P++ ++  LQ   ++T S  + +    F+     I K+      +
Sbjct: 206 ISGGLSGATCAAITTPLDCIKTVLQVRGSETVSNEIMKQANTFQRAASAIYKIHGWKGFL 265

Query: 177 RGLSPTILREAQGCATYFLTYE 198
           RGL P ++      A  + +YE
Sbjct: 266 RGLKPRVIANMPATAISWTSYE 287

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 121/295 (41%), Gaps = 35/295 (11%)

Query: 29  LAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVE---------VVKKLVKNEGLRGFYK 79
           ++G   G    ++  PFD  K RLQ         +             + K+EG  G YK
Sbjct: 43  ISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYK 102

Query: 80  GTLTPLVGVGACVSCQFGVNEAMKRFFRGSSAD--PHKTLTLPQYYICGFVGGVANSFLA 137
           G    ++G    +   F V +    F R  S D  PH               G  ++   
Sbjct: 103 GLQPTVLGYIPTLMIYFSVYD----FCRKYSVDIFPHSPFLSNA--SSAITAGAISTVAT 156

Query: 138 SPIEHVRIRLQTQTASGTVA-EFKGPLDCINKL---RANGALMRGLSPTILREAQGCATY 193
           +PI  V+ RL  QT  G  +  +KG +D   K+       AL  GL P +L      A  
Sbjct: 157 NPIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALL-GMLNVAIQ 215

Query: 194 FLTYEALVANQIGKGIARS-----DVPA---WKLCLFGAVSGVTLWLTVYPLDVIKSLMQ 245
           F  YE L   +I  G + S     DV +    KL L   +S +      YP +++++ MQ
Sbjct: 216 FPLYENL---KIRFGYSESTDVSTDVTSSNFQKLILASMLSKMVASTVTYPHEILRTRMQ 272

Query: 246 -TDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELA 299
              +L N V+ ++++ + ++   + G+  F+ GF   ++R  PA   T  +FE +
Sbjct: 273 LKSDLPNTVQ-RHLLPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSFEYS 326

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 77/291 (26%), Positives = 120/291 (41%), Gaps = 22/291 (7%)

Query: 28  LLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA----VEVVKKLVKNEGLRGFYKGTLT 83
            +AG  GG     V  P +  K+ LQ  ++ T      V  VK++ K EG++G ++G   
Sbjct: 20  FVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGI 79

Query: 84  PLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHV 143
             + +    + Q+ V E  K          H+ L   +  + G +GG A+  +  P++ V
Sbjct: 80  NCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERLVGGALGGGASVLVTYPLDLV 139

Query: 144 RIRLQTQTAS------GTVAEFKGPLDCINKL----RANGAL---MRGLSPTILREAQGC 190
           R RL  QTA+          + + P   +  L    R  G L    RG+ PT L      
Sbjct: 140 RTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFV 199

Query: 191 ATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLK 250
           A  F  YE L A  I        V A KL + GAVSG      VYP D+++   Q   + 
Sbjct: 200 ALNFALYERLKA-LIPHDYDAGSVAAAKLAI-GAVSGGIAQTVVYPFDLLRRRFQVLTMG 257

Query: 251 NPVRGKNIIQVAR---LVNAKYGWKSFFKGFGPTMLRAAPANGATFATFEL 298
               G     VA     +  + G + ++KG    +++  PA    +  +EL
Sbjct: 258 QSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 88/219 (40%), Gaps = 32/219 (14%)

Query: 13  DIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTT--------------- 57
            + Q  H+  R  + L+ G  GG A VLV  P D  + RL   T                
Sbjct: 104 HVGQSGHEQLRSWERLVGGALGGGASVLVTYPLDLVRTRLSIQTANLAKLHRSKAHDIRR 163

Query: 58  PTTAVEVVKKLVKNE-GLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHK- 115
           P   VE+++++ + E GLRG+Y+G     +GV   V+  F + E +K         PH  
Sbjct: 164 PPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALI------PHDY 217

Query: 116 ---TLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFK-----GPLDCIN 167
              ++   +  I    GG+A + +  P + +R R Q  T   +   F+       L  I 
Sbjct: 218 DAGSVAAAKLAIGAVSGGIAQT-VVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIG 276

Query: 168 KLRANGALMRGLSPTILREAQGCATYFLTYEALVANQIG 206
           +        +GL+  +++     A  +  YE +  N  G
Sbjct: 277 RQEGLRGYYKGLTANLVKVVPAMAVQWFVYELISENMHG 315

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 66.2 bits (160), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 70/273 (25%), Positives = 112/273 (41%), Gaps = 22/273 (8%)

Query: 25  LKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYKGTLTP 84
           L  L++G A G +  +V  P DT K RLQ                 N G RG Y+G  + 
Sbjct: 6   LASLVSGAAAGTSTDVVFFPIDTLKTRLQAK----------GGFFHNGGYRGIYRGLGSA 55

Query: 85  LVGVGACVSCQFGVNEAMKRFFR---GSSADPHKTLTLPQYYICGFVGGVANSFLASPIE 141
           +V      S  F   ++MK+  R   G      +   +  + +   +G ++   +  P E
Sbjct: 56  VVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMSACLVRVPAE 115

Query: 142 HVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYEALV 201
            ++ R QT   + ++   +  L           L RG   TI+RE       F  YE L 
Sbjct: 116 VIKQRTQTHHTNSSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREIPFTCIQFPLYEYLK 175

Query: 202 ANQIGKG-IARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQ 260
                   I R  V AW+  + G+++G        PLDV+K+ M     + P     ++ 
Sbjct: 176 KKWAAYAEIER--VSAWQGAVCGSLAGGIAAAATTPLDVLKTRMMLHERRVP-----MLH 228

Query: 261 VARLVNAKYGWKSFFKGFGPTMLRAAPANGATF 293
           +AR +  + G + FF+G GP  +  + A GA F
Sbjct: 229 LARTLFREEGARVFFRGIGPRTMWIS-AGGAIF 260

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 27/63 (42%)

Query: 44  PFDTTKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMK 103
           P D  K R+         + + + L + EG R F++G     + + A  +   GV EA+ 
Sbjct: 209 PLDVLKTRMMLHERRVPMLHLARTLFREEGARVFFRGIGPRTMWISAGGAIFLGVYEAVH 268

Query: 104 RFF 106
             F
Sbjct: 269 SLF 271

>Scas_379.2
          Length = 301

 Score = 65.9 bits (159), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 85/202 (42%), Gaps = 16/202 (7%)

Query: 4   ETSSPLLIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVE 63
           E +   LID+ D Q H   + LK  L+GT   +A   +  PFDT K R+Q +T  TT   
Sbjct: 101 EYTKKYLIDEKDMQTH---QPLKTALSGTVATIAADALMNPFDTLKQRMQLNTN-TTVWN 156

Query: 64  VVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYY 123
           V K++ KNEG   FY    T L       +  F + E+  +FF     +P        + 
Sbjct: 157 VTKQIYKNEGFSAFYYSYPTTLAMNIPFAAFNFMIYESATKFF-----NPTNDYNPLVHC 211

Query: 124 ICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAE-------FKGPLDCINKLRANGALM 176
           + G + G   + + +P++ ++  LQ + +     +       F+     I ++       
Sbjct: 212 LSGGLSGATCAAITTPLDCIKTVLQVRGSESVSLQVMKEANTFQKATKAIYQVHGAKGFW 271

Query: 177 RGLSPTILREAQGCATYFLTYE 198
           RGL P +       A  +  YE
Sbjct: 272 RGLQPRVFANMPATAIAWTAYE 293

 Score = 65.1 bits (157), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 71/297 (23%), Positives = 123/297 (41%), Gaps = 20/297 (6%)

Query: 12  DDIDQQP-HDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA--VEVVKKL 68
           ++ID +   DS  +   LLAG   G+ +  V  P D  K R+Q+++  +T+  +  + K+
Sbjct: 10  EEIDYEALPDSAPLSHQLLAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTSNMLSQMAKI 69

Query: 69  VKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFF-RGSSADPHKTLTLPQYYICGF 127
              EG    +KG  + ++G G   +  F   E  K++         H+ L      + G 
Sbjct: 70  STAEGSLALWKGVQSVILGAGPAHAVYFATYEYTKKYLIDEKDMQTHQPLKTA---LSGT 126

Query: 128 VGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSPTILREA 187
           V  +A   L +P + ++ R+Q  T +      K     I K     A       T+    
Sbjct: 127 VATIAADALMNPFDTLKQRMQLNTNTTVWNVTKQ----IYKNEGFSAFYYSYPTTLAMNI 182

Query: 188 QGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTD 247
              A  F+ YE+  A +       +D      CL G +SG T      PLD IK+++Q  
Sbjct: 183 PFAAFNFMIYES--ATKFFN--PTNDYNPLVHCLSGGLSGATCAAITTPLDCIKTVLQVR 238

Query: 248 NLKN----PVRGKNIIQVA-RLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELA 299
             ++     ++  N  Q A + +   +G K F++G  P +    PA    +  +E A
Sbjct: 239 GSESVSLQVMKEANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAIAWTAYECA 295

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 64.7 bits (156), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 71/294 (24%), Positives = 129/294 (43%), Gaps = 24/294 (8%)

Query: 19  HDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTST---TPTTAVEVVKKLVKNEGL- 74
           H+   + +++++G   G    +   P D  K+RLQ S      TT   +++ + + +   
Sbjct: 3   HELTSLQREVISGLTAGTITTIASHPLDLLKLRLQLSAGNRANTTYTGLIRDIFERQQWG 62

Query: 75  RGFYKGTLTPLVGVGACVSCQFGVNEAMK----RFFRGSSADPHKTLTLPQ--YYICGFV 128
           R  Y+G    L+G     +  FG     K    R     SA       LP   Y +    
Sbjct: 63  RELYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYMLAAGS 122

Query: 129 GGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANG---ALMRGLSPTILR 185
            G+A + L +PI  ++ R+   + +G    +K   D + KL       A  RG+ P++L 
Sbjct: 123 SGIATAVLTNPIWVIKTRIMATSRAG---PYKSTFDGVYKLYQTEGVLAFWRGVVPSLLG 179

Query: 186 EAQGCATYFLTYEALVANQIGKGIARSD--VPAWKLCLFGAVSGVTLWLTVYPLDVIKSL 243
            +QG A YF  Y+ L  + +     +++  +   ++     +S +    +VYP  ++KS 
Sbjct: 180 VSQG-AIYFALYDTLKFHYLHSSTDKAERRLSVSEIIGITCISKMISVTSVYPFQLLKSK 238

Query: 244 MQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
           +Q  +   P     I Q+ + V ++ G + F++G    +LRA PA   TF  +E
Sbjct: 239 LQ--DFGAP---SGITQLVQTVYSREGIRGFYRGLSANLLRAVPATCITFFVYE 287

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 31/68 (45%)

Query: 36  MAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQ 95
           M  V    PF   K +LQ    P+   ++V+ +   EG+RGFY+G    L+         
Sbjct: 223 MISVTSVYPFQLLKSKLQDFGAPSGITQLVQTVYSREGIRGFYRGLSANLLRAVPATCIT 282

Query: 96  FGVNEAMK 103
           F V E +K
Sbjct: 283 FFVYENIK 290

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 68/301 (22%), Positives = 117/301 (38%), Gaps = 36/301 (11%)

Query: 26  KDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTP--------TTAVEVVKKLVKNEGLRGF 77
           K LLAG   G+    +  P DT K+RLQ   TP        +  +EV + ++KNEG+R F
Sbjct: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQL--TPANGLKPFGSQVMEVARSMIKNEGIRSF 75

Query: 78  YKGTLTPLVGVGACVSCQFGVNEAMKRFFR--GSSADPHKTLTLPQYYICGFVGGVANSF 135
           +KG +   +      S QF       R+    G  A  H         + G   G+ +S 
Sbjct: 76  WKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSL-------VVGAFAGITSSI 128

Query: 136 LASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFL 195
           ++ P + +R RL       +++  +   D I KL       +G   ++       +  F 
Sbjct: 129 VSYPFDVLRTRLVANNQMHSMSITREVRD-IWKLEGLPGFFKGSIASMTTITLTASIMFG 187

Query: 196 TYEALVANQIGKGIARSDVPAWKLCLF----GAVSGVTLWLTVYPLDVIKSLMQTDNLKN 251
           TYE +           +    W+L       G + GV   +  +PL+ I+  MQ  N K+
Sbjct: 188 TYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKH 247

Query: 252 ------------PVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELA 299
                         +G    ++   +  + G  S ++G    + +  P    +F  +E A
Sbjct: 248 LEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETA 307

Query: 300 M 300
           +
Sbjct: 308 I 308

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 44/88 (50%), Gaps = 3/88 (3%)

Query: 213 DVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTD--NLKNPVRGKNIIQVARLVNAKYG 270
           +V AWK  L GAVSG+       P+D IK  +Q    N   P  G  +++VAR +    G
Sbjct: 13  NVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPF-GSQVMEVARSMIKNEG 71

Query: 271 WKSFFKGFGPTMLRAAPANGATFATFEL 298
            +SF+KG  P  L       A F+++ L
Sbjct: 72  IRSFWKGNIPGSLLYVTYGSAQFSSYSL 99

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 73/307 (23%), Positives = 118/307 (38%), Gaps = 36/307 (11%)

Query: 13  DIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQT----STT-----PTTAVE 63
           D +  P D   +   L+AG   G+A+  V  P D  K RLQ     STT     P+T + 
Sbjct: 8   DYEALP-DHAPLAHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLR 66

Query: 64  VVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYY 123
            +  +   EG    +KG  + L+G G   +  F   E +K F    +    K      ++
Sbjct: 67  QLSSISAQEGSMVLWKGVQSVLLGAGPAHAVYFATYEMVKSFLIDEATSTSKY----HFF 122

Query: 124 ICGFVGG---VANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLS 180
              F G    +A   L +P + ++ R+Q  T            D   ++ +        S
Sbjct: 123 KTAFSGATATIAADALMNPFDVIKQRIQLNTNISV-------WDTAKRIYSKEGFQAFYS 175

Query: 181 --PTILREAQGCATY-FLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPL 237
             PT L      A + F  Y+         G+    +     CL G +SG        PL
Sbjct: 176 SYPTTLAINIPFAAFNFGIYDTATRYFNPSGVYNPFIH----CLCGGISGAACAGLTTPL 231

Query: 238 DVIKSLMQ---TDNLKNPV--RGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGAT 292
           D IK+ +Q   ++ +   V  +     +  R +   YGW+ F+ G  P +L   PA   +
Sbjct: 232 DCIKTALQVRGSEKVSMEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPATAIS 291

Query: 293 FATFELA 299
           +  +E A
Sbjct: 292 WTAYEFA 298

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 76/202 (37%), Gaps = 15/202 (7%)

Query: 4   ETSSPLLIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVE 63
           E     LID+            K   +G    +A   +  PFD  K R+Q +T   +  +
Sbjct: 103 EMVKSFLIDEATST--SKYHFFKTAFSGATATIAADALMNPFDVIKQRIQLNTN-ISVWD 159

Query: 64  VVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYY 123
             K++   EG + FY    T L       +  FG+ +   R+F     +P        + 
Sbjct: 160 TAKRIYSKEGFQAFYSSYPTTLAINIPFAAFNFGIYDTATRYF-----NPSGVYNPFIHC 214

Query: 124 ICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAE-------FKGPLDCINKLRANGALM 176
           +CG + G A + L +P++ ++  LQ + +     E       FK     I ++       
Sbjct: 215 LCGGISGAACAGLTTPLDCIKTALQVRGSEKVSMEVFKQADTFKKATRAIYQVYGWRGFW 274

Query: 177 RGLSPTILREAQGCATYFLTYE 198
            G+ P IL      A  +  YE
Sbjct: 275 SGVKPRILANMPATAISWTAYE 296

>Kwal_26.7967
          Length = 297

 Score = 63.9 bits (154), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 75/287 (26%), Positives = 120/287 (41%), Gaps = 21/287 (7%)

Query: 25  LKDLLAGTAGGMAQVLVGQPFDTTKVRLQ----TSTTPTTAVEVVKKLVKNEGLRGFYKG 80
           L   LAG+  G  +  +  PF+  K RLQ    +ST     + ++ +  K +GL   Y G
Sbjct: 10  LHSFLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTASRNPLTLIYRTAKVQGLGAVYVG 69

Query: 81  TLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHK-TLTLPQYYICGFVGGVANSFLA-S 138
               +VG  A    +F   +A+K   R    DP    L+ P+  + G   G+  S +A +
Sbjct: 70  CPAFIVGNTAKAGVRFLGFDAIKNILR----DPTTGELSGPRGIVAGLGAGLLESVVAVT 125

Query: 139 PIEHVRIRL--QTQTASGTVAEF-KGPLDCINKL---RANGALMRGLSPTILREAQGCAT 192
           P E ++  L    Q+AS       +G L   + L   +    L RG+ P  +R+A   A 
Sbjct: 126 PFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSMRQAANQAV 185

Query: 193 YFLTYEALVANQIGKGIARSDVPAWKLCLF--GAVSGVTLWLTVYPLDVIKSLMQTDNLK 250
               Y  +         +  D P      F  GA SG+    T  P+D +K+ MQ+    
Sbjct: 186 RLGCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKTRMQS---L 242

Query: 251 NPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
           +  +  + I     V  + G K+F+KG  P + R   + G  F  +E
Sbjct: 243 DSSKYSSTINCFATVFREEGLKTFWKGATPRLGRLILSGGIVFTIYE 289

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 70/296 (23%), Positives = 125/296 (42%), Gaps = 29/296 (9%)

Query: 28  LLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA----VEVVKKLVKNEGLRGFYKGTLT 83
           L  G AG +++ +V  PF+  K+ LQ  ++ T       + + ++ K E ++G ++G   
Sbjct: 28  LAGGIAGAISRTVV-SPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGL 86

Query: 84  PLVGVGACVSCQFGVNEAMKR-FFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEH 142
             + V    + QF V E  K+  F   +    + L   Q    G + G  +     P++ 
Sbjct: 87  NCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDL 146

Query: 143 VRIRLQTQTA---------SGTVAEFKGPLDCINKLRAN-GALM---RGLSPTILREAQG 189
           VR RL  QTA         +  +A+  G    ++K  A  G +M   RG+ PT L     
Sbjct: 147 VRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPY 206

Query: 190 CATYFLTYEALV----ANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQ 245
            A  F  YE L     +++ G    R  +  +KL + GA+SG       YP D+++   Q
Sbjct: 207 VALNFAVYEQLKEFMPSDENGNSSMRDSL--YKLSM-GAISGGVAQTITYPFDLLRRRFQ 263

Query: 246 TDNLKNPVRG---KNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFEL 298
              +     G    ++      +    G+K ++KG    + +  P+   ++  +EL
Sbjct: 264 VLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 67/294 (22%), Positives = 119/294 (40%), Gaps = 42/294 (14%)

Query: 29  LAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA------VEVVKKLVKNEGLRGFYKGTL 82
           ++G   G    ++  P D  K RLQ     +        V  +  ++++EG+ G YKG  
Sbjct: 89  VSGALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLYKGLA 148

Query: 83  TPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSF------- 135
             ++G        F V E  K+ +             P Y   GFV   A++        
Sbjct: 149 PIVLGYFPTWMLYFSVYEKCKQRY-------------PSYLPGGFVSHAASALTAGAIST 195

Query: 136 -LASPIEHVRIRLQTQT-ASGTVAEFKGPLDCINKL-RANG--ALMRGLSPTILREAQGC 190
            L +PI  V+ RL  Q+  S     ++  LD   K+ R+ G      GL P++       
Sbjct: 196 ALTNPIWVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLFGLFH-V 254

Query: 191 ATYFLTYEAL-------VANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSL 243
           A +F  YE L            G+ +  + +   +L +   +S V   +  YP +++++ 
Sbjct: 255 AIHFPVYEKLKIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSKVVASVITYPHEILRTR 314

Query: 244 MQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
           MQ  +   P    +++ +   + A  G+  F+ GF   ++R  PA+  T  +FE
Sbjct: 315 MQVRHSGVP---PSLLNLLGRIRASEGYVGFYSGFATNLVRTVPASVITLVSFE 365

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 67/318 (21%), Positives = 121/318 (38%), Gaps = 54/318 (16%)

Query: 28  LLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAV--------EVVKKLVKNEGLRGFYK 79
           L  G +G  A+ L+  P D  K+  QTS    +          E  K +  N+G+RGF++
Sbjct: 23  LAGGVSGSCAKTLIA-PLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFFQ 81

Query: 80  GTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASP 139
           G    L+ +    + +F   E ++     S         L      G + G+ + F+  P
Sbjct: 82  GHSVTLLRIFPYAAVKFVAYEQIRSILIPSREYESHWRRLAS----GSLAGLCSVFITYP 137

Query: 140 IEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGAL----------------MRGLSPTI 183
           ++  R+RL   T    V + +  +  I    A+  L                 RG  PT+
Sbjct: 138 LDLTRVRLAYVTEHKRV-KLRDIVKTIYHEPASEGLTSHLLVPKWFAHWCNFYRGYVPTV 196

Query: 184 LREAQGCATYFLTYE--------ALVA----------NQIGKGIARSDVP--AWKLCLFG 223
           L         F  ++        +L+A           ++ +   R   P   W   + G
Sbjct: 197 LGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELERKKLRQKTPLRTWAELVAG 256

Query: 224 AVSGVTLWLTVYPLDVIKSLMQTDNLK----NPVRGKNIIQVARLVNAKYGWKSFFKGFG 279
            +SG+      YPL++I+  +Q   L        + ++I  +AR++  + GW+ FF G  
Sbjct: 257 GLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARIIYQEKGWRGFFVGLS 316

Query: 280 PTMLRAAPANGATFATFE 297
              ++  P    +F  +E
Sbjct: 317 IGYIKVTPMVACSFFVYE 334

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 89/196 (45%), Gaps = 28/196 (14%)

Query: 126 GFVGGVANS---FLASPIEHVRIRLQTQTASGTVAEFKGPL----DCINKLRANGAL--- 175
           G  GGV+ S    L +P++  RI++  QT++   +++ G L    +    +  N  +   
Sbjct: 22  GLAGGVSGSCAKTLIAPLD--RIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGF 79

Query: 176 MRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVY 235
            +G S T+LR     A  F+ YE + +  I    +R     W+    G+++G+      Y
Sbjct: 80  FQGHSVTLLRIFPYAAVKFVAYEQIRSILIP---SREYESHWRRLASGSLAGLCSVFITY 136

Query: 236 PLDVIKSLMQTDNLKNPVRGKNIIQV-----------ARLVNAKY--GWKSFFKGFGPTM 282
           PLD+ +  +        V+ ++I++            + L+  K+   W +F++G+ PT+
Sbjct: 137 PLDLTRVRLAYVTEHKRVKLRDIVKTIYHEPASEGLTSHLLVPKWFAHWCNFYRGYVPTV 196

Query: 283 LRAAPANGATFATFEL 298
           L   P  G +F   +L
Sbjct: 197 LGMIPYAGVSFFAHDL 212

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 40/90 (44%), Gaps = 9/90 (10%)

Query: 23  RVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTST-TPTTAVE--------VVKKLVKNEG 73
           R   +L+AG   G+       P +  + RLQ ST +P    +        + + + + +G
Sbjct: 248 RTWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARIIYQEKG 307

Query: 74  LRGFYKGTLTPLVGVGACVSCQFGVNEAMK 103
            RGF+ G     + V   V+C F V E MK
Sbjct: 308 WRGFFVGLSIGYIKVTPMVACSFFVYERMK 337

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 63.2 bits (152), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 77/286 (26%), Positives = 114/286 (39%), Gaps = 21/286 (7%)

Query: 26  KDLLAGTAGGMAQVLVGQPFDTTKVRLQ----TSTTPTTAVEVVKKLVKNEGLRGFYKGT 81
           K  +AG   G  +  V  PF+  K RLQ     S      + ++    K +G+   Y G 
Sbjct: 11  KSFIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKASRNPLVLIYNTAKTQGIGSVYVGC 70

Query: 82  LTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHK-TLTLPQYYICGFVGGVANSFLA-SP 139
              +VG  A    +F   + +K   R    DP    L+ P+  I G   G+  S +A +P
Sbjct: 71  PAFIVGNTAKAGVRFLGFDTIKNLLR----DPKTGELSGPRGVIAGLGAGLLESVVAVTP 126

Query: 140 IEHVRIRLQTQTASGTVAEF---KGPLDCINKL-RANG--ALMRGLSPTILREAQGCATY 193
            E ++  L     S T       KG L     L R  G   L RG+ P  +R+A   A  
Sbjct: 127 FEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLPVSMRQAANQAVR 186

Query: 194 FLTYEALVANQIGKGIARSDVPAWKLCLF--GAVSGVTLWLTVYPLDVIKSLMQTDNLKN 251
              Y  +         A  D P      F  GA SG+    T  P+D +K+ MQ+ + K 
Sbjct: 187 LGCYNKIKVMVQDYTNAPKDKPLSSGLTFVVGAFSGIVTVYTTMPIDTVKTRMQSLDSK- 245

Query: 252 PVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
             R  + I     +  + G K+F+KG  P + R   + G  F  +E
Sbjct: 246 --RYSSTINCFTTIFKEEGLKAFWKGATPRLGRLFLSGGIVFTVYE 289

>Scas_721.27
          Length = 374

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 70/305 (22%), Positives = 121/305 (39%), Gaps = 54/305 (17%)

Query: 44  PFDTTKVRLQT------------STTPTTAVEVVKKLV-----------------KNEGL 74
           PFD  K RLQ+            + T     ++   LV                 K EG 
Sbjct: 72  PFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGTHFKETFGILGNVYKREGF 131

Query: 75  RGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANS 134
           R  +KG    LVGV    S  F      K  +  +  +  +T  +  + +     G A S
Sbjct: 132 RSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKAFNNGQETPLI--HLMSAATAGWATS 189

Query: 135 FLASPIEHVRIRLQTQTASGTVAEFKGPLDCINK-LRANG--ALMRGLSPTILREAQGCA 191
              +PI  ++ R+Q   A GT  ++K   DC+   L++ G   L RGLS + L   +G  
Sbjct: 190 TATNPIWMIKTRVQLDKA-GTTRKYKNSWDCLKTVLKSEGIYGLYRGLSASYLGSIEGIL 248

Query: 192 TYFLTYEALVANQIGKGIAR------------SDVPAWKLCLFGAVSGVTLW---LTVYP 236
            + L YE +      + I +              +  W  C     +GV  +   +  YP
Sbjct: 249 QWLL-YEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEW--CQRSGSAGVAKFIASIVTYP 305

Query: 237 LDVIKSLMQTDNLKN-PVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFAT 295
            +V+++ ++   ++N   +   ++Q  R++  + G  S + G  P ++R  P +   F T
Sbjct: 306 HEVVRTRLRQMPMENGKPKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGT 365

Query: 296 FELAM 300
           +EL +
Sbjct: 366 WELVI 370

>Kwal_55.20868
          Length = 380

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 66/294 (22%), Positives = 118/294 (40%), Gaps = 30/294 (10%)

Query: 29  LAGTAGGMAQVLVGQ---PFDTTKVRLQT---STTPTTAVE----VVKKLVKNEGLRGFY 78
           +   +G MA  L G    P D  K RLQ     + P+   +     +  ++++EG RG Y
Sbjct: 77  ITALSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGLY 136

Query: 79  KGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLAS 138
           KG +  ++G        F V E  K+ +         +     +       G  ++ L +
Sbjct: 137 KGLVPIIMGYFPTWMIYFSVYERSKKLY----PRIFPSFDFISHSASALTAGTVSTILTN 192

Query: 139 PIEHVRIRLQTQT-ASGTVAEFKGPLDCINKLRANGAL---MRGLSPTILREAQGCATYF 194
           P+  V+ RL  QT  +     +    D  +K+     L     GL P++L      A +F
Sbjct: 193 PVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLLGLFH-VAIHF 251

Query: 195 LTYEAL-VANQIGKGIARSD---VPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQ----- 245
             YE L V       ++R++   +   +L +  + S +      YP +++++ MQ     
Sbjct: 252 PIYEKLKVWLHCTPSMSRTEDHNLNLARLIIASSASKMVASTLTYPHEILRTRMQLKAYP 311

Query: 246 TDNLK--NPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
           TD L          +I++ +      G + F+ GF   + R  PA+  T  +FE
Sbjct: 312 TDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSFE 365

 Score = 34.7 bits (78), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 12/65 (18%)

Query: 28  LLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA------------VEVVKKLVKNEGLR 75
           ++A +A  M    +  P +  + R+Q    PT              + ++K   K+EGLR
Sbjct: 281 IIASSASKMVASTLTYPHEILRTRMQLKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLR 340

Query: 76  GFYKG 80
           GFY G
Sbjct: 341 GFYSG 345

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 63.2 bits (152), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 79/190 (41%), Gaps = 21/190 (11%)

Query: 29  LAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA------VEVVKKLVKNEGLRGFYKGTL 82
           +AG   GMA      P DT K R+Q +   T         +  K + +  GLR FY+G  
Sbjct: 352 IAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKDMFREGGLRLFYRGVT 411

Query: 83  TPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYIC---------GFVGGVAN 133
             +VG+    +   G   A+K+++    A   KTL LPQ  +          G   G   
Sbjct: 412 VGIVGIFPYAALDLGTFSALKKWYIAKQA---KTLNLPQDQVTLSNLVVLPMGAFSGTVG 468

Query: 134 SFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINK-LRANG--ALMRGLSPTILREAQGC 190
           + +  PI  +R RLQ Q        + G  D + K L   G   L +GL PT+ +     
Sbjct: 469 ASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVPTLAKVCPAV 528

Query: 191 ATYFLTYEAL 200
           +  +L YE L
Sbjct: 529 SISYLCYENL 538

 Score = 56.6 bits (135), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 78/345 (22%), Positives = 130/345 (37%), Gaps = 69/345 (20%)

Query: 9   LLIDDIDQQPHDSGRVLKDLLAG----TAGGMAQVL---VGQPFDTTKVRLQTSTTPTTA 61
           L  +D+D        ++ D + G     AGG++ V+      PFD  KV L   T  ++ 
Sbjct: 205 LFNEDVDLSSEGDVTLINDFIRGFGFFIAGGISGVISRTCTAPFDRLKVFLIARTDLSSI 264

Query: 62  V------------------------EVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFG 97
           +                        + VK L +  G++ FY G    ++ V    S +FG
Sbjct: 265 LLNSKTDLLAKNPNADINKISSPLAKAVKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFG 324

Query: 98  VNEAMKRFF-RGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTV 156
             E  K+   +       K L+    YI G + G+A  F   PI+ ++ R+Q        
Sbjct: 325 SFEVTKKIMTKLEGCRDTKDLSKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQC------- 377

Query: 157 AEFKGPLDCINKLRANGALM----------------RGLSPTILREAQGCATYFLTYEAL 200
                PLD   KL+ N  L                 RG++  I+      A    T+ AL
Sbjct: 378 ----APLDT--KLKGNNLLFQTAKDMFREGGLRLFYRGVTVGIVGIFPYAALDLGTFSAL 431

Query: 201 VANQIGKGIARSDVPAWKLCL-------FGAVSGVTLWLTVYPLDVIKSLMQTD-NLKNP 252
               I K     ++P  ++ L        GA SG      VYP++++++ +Q      +P
Sbjct: 432 KKWYIAKQAKTLNLPQDQVTLSNLVVLPMGAFSGTVGASVVYPINLLRTRLQAQGTYAHP 491

Query: 253 VRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
                   V      + G++  FKG  PT+ +  PA   ++  +E
Sbjct: 492 YVYNGFKDVLLKTLEREGYQGLFKGLVPTLAKVCPAVSISYLCYE 536

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 34/81 (41%), Gaps = 6/81 (7%)

Query: 31  GTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAV------EVVKKLVKNEGLRGFYKGTLTP 84
           G   G     V  P +  + RLQ   T           +V+ K ++ EG +G +KG +  
Sbjct: 461 GAFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVPT 520

Query: 85  LVGVGACVSCQFGVNEAMKRF 105
           L  V   VS  +   E +K+F
Sbjct: 521 LAKVCPAVSISYLCYENLKKF 541

 Score = 28.5 bits (62), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 42/95 (44%), Gaps = 19/95 (20%)

Query: 223 GAVSGVTLWLTVYPLDVIKSLM-------------QTDNL-KNPVRGKNIIQ--VARLVN 266
           G +SGV       P D +K  +             +TD L KNP    N I   +A+ V 
Sbjct: 234 GGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSPLAKAVK 293

Query: 267 AKY---GWKSFFKGFGPTMLRAAPANGATFATFEL 298
           + Y   G K+F+ G G  +++  P +   F +FE+
Sbjct: 294 SLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEV 328

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 62.4 bits (150), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 63/276 (22%), Positives = 115/276 (41%), Gaps = 20/276 (7%)

Query: 31  GTAGGMAQVLVGQPFDTTKVRLQTSTTPT-TAVEVVKKLVKNEGLRGFYKGTLTPLVGVG 89
           G  GG+   +   P D  KVRLQT+  P  T V +  ++++NEG+ G Y G    ++   
Sbjct: 15  GGFGGIVACVATHPLDLAKVRLQTAPAPKPTLVRMASQILRNEGVPGLYSGLTAAILRQC 74

Query: 90  ACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYI-CGFVGGVANSFLASPIEHVRIRLQ 148
              + +FGV + +K  +      P + L    Y + C    G     + +P + V IR+Q
Sbjct: 75  TYTTARFGVYDFVKERY-----IPKEYLNSMLYLLPCSMFSGAVGGLIGNPADVVNIRMQ 129

Query: 149 TQTA--SGTVAEFKGPLDCINKL---RANGALMRGLSPTILREAQGCATYFLTYEALVAN 203
             ++  +     +K   D + K+        L  G  P ++R     ++  +TY+ +  N
Sbjct: 130 NDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTSSQVVTYD-IAKN 188

Query: 204 QIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVAR 263
            + + +               ++G+       P DVIK+      + N  +  +   V  
Sbjct: 189 YLVQNVGLDKDNKSTHFASSLLAGLVATTVCSPADVIKT-----RVMNAHKHSHDSAVRI 243

Query: 264 LVNA--KYGWKSFFKGFGPTMLRAAPANGATFATFE 297
           L++A  + G    F+G+ P+ +R  P     F T E
Sbjct: 244 LLDAVKQEGPSFMFRGWLPSFVRLGPNTILIFLTVE 279

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 73/190 (38%), Gaps = 21/190 (11%)

Query: 28  LLAGTAGGMAQVLVGQPFDTTKVRLQT-STTPT-------TAVEVVKKLVKNEGLRGFYK 79
           + +G  GG    L+G P D   +R+Q  S+ P         A + + K+   EG+   + 
Sbjct: 108 MFSGAVGG----LIGNPADVVNIRMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFT 163

Query: 80  GTLTPLVGVGACVSCQFGVNEAMKRFFR---GSSADPHKTLTLPQYYICGFVGGVANSFL 136
           G    LV      S Q    +  K +     G   D   T     ++    + G+  + +
Sbjct: 164 GWQPNLVRGILMTSSQVVTYDIAKNYLVQNVGLDKDNKST-----HFASSLLAGLVATTV 218

Query: 137 ASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLT 196
            SP + ++ R+         +  +  LD + K      + RG  P+ +R        FLT
Sbjct: 219 CSPADVIKTRVMNAHKHSHDSAVRILLDAV-KQEGPSFMFRGWLPSFVRLGPNTILIFLT 277

Query: 197 YEALVANQIG 206
            E L  +++G
Sbjct: 278 VEQLRKHRVG 287

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 62.8 bits (151), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 78/344 (22%), Positives = 129/344 (37%), Gaps = 63/344 (18%)

Query: 3   EETSSPLLIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTS------- 55
           E +SS   +  + ++ H +   +  L    AG +A V+V  P D  K RLQ         
Sbjct: 83  EGSSSRHGLSIVREEGHFNDTEITALSGALAGFLAGVIVC-PLDVAKTRLQAQGLQLNGP 141

Query: 56  -TTPTTAVEV-------------VKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEA 101
            T P  +V               +  +V++E +RG YKG +  ++G        F V E 
Sbjct: 142 VTRPVGSVATTFGGKYYSGIWGTLTTIVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYER 201

Query: 102 MK----RFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGT-- 155
            K    R+F  S    H         +     G  ++ L +PI  V+ RL  Q+      
Sbjct: 202 CKLSYPRYFNNSEFLSHS--------MSALTAGAISTTLTNPIWVVKTRLMLQSGKNIKG 253

Query: 156 VAEFKGPLDC---INKLRANGALMRGLSPTILREAQGCATYFLTYEALV----------- 201
           +  +K  LD    I K+    +   GL P++       A +F  YE L            
Sbjct: 254 MTHYKNTLDAFIKIYKVEGIKSFYSGLIPSLFGLLH-VAIHFPVYEKLKKVLHCYPSGRP 312

Query: 202 --------ANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPV 253
                    N   +    ++    +L +    S +      YP +++++ +Q  +   P 
Sbjct: 313 NQETMNVNGNSNPQTTGSTNFQLGRLIVASCGSKMIASTLTYPHEILRTRLQLKSDMKP- 371

Query: 254 RGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
              +I  + R   AK G + F+ GF   M R  PA+  T  +FE
Sbjct: 372 ---SIKSIIRTTYAKEGIRGFYSGFLTNMFRTVPASAITLVSFE 412

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 70/302 (23%), Positives = 125/302 (41%), Gaps = 33/302 (10%)

Query: 23  RVLKDLLAGTAGGMAQVLVGQPFDTTKVR-----LQTSTTPTTAVEVVKKLVKNEGLRGF 77
           R+  D+        A+ L+    +TT+ R     LQ +T     V ++  + + EG R  
Sbjct: 83  RLQSDIYQNMYKSQAEALM---MNTTRPRIVNLTLQAATHFKETVSIIGNVYRQEGFRSL 139

Query: 78  YKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLA 137
           +KG    LVGV    S  F      K  +  +  +  +   +  + +     G A +   
Sbjct: 140 FKGLGPNLVGVIPARSINFFTYGTTKDIYSKAFNNGQEAPWI--HLMAAATAGWATATAT 197

Query: 138 SPIEHVRIRLQTQTASGTVAEFKGPLDCINK-LRANG--ALMRGLSPTILREAQGCATYF 194
           +PI  V+ R+Q   A G    +K   DC+   LR  G   L RGLS + L   +G   + 
Sbjct: 198 NPIWMVKTRVQLDKA-GKTRTYKNSYDCLKSILRNEGIYGLYRGLSASYLGSVEGILQWL 256

Query: 195 LTYEALVANQIGKGIAR------------SDVPAWKLCLFGAVSGVTLWL---TVYPLDV 239
           L YE L      + I +              +  W  C     +G+  ++     YP +V
Sbjct: 257 L-YEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQW--CQRSGGAGLAKFMASIVTYPHEV 313

Query: 240 IKSLMQTDNLKN-PVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFEL 298
           +++ ++   L+N  V+   ++Q  R++  + G  S + G  P ++R  P +   F T+E+
Sbjct: 314 VRTRLRQSPLENGKVKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGTWEV 373

Query: 299 AM 300
            +
Sbjct: 374 VI 375

 Score = 31.6 bits (70), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 19/86 (22%), Positives = 34/86 (39%), Gaps = 25/86 (29%)

Query: 236 PLDVIKSLMQTDNLKNPVRG-------------------------KNIIQVARLVNAKYG 270
           P D++K+ +Q+D  +N  +                          K  + +   V  + G
Sbjct: 76  PFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTLQAATHFKETVSIIGNVYRQEG 135

Query: 271 WKSFFKGFGPTMLRAAPANGATFATF 296
           ++S FKG GP ++   PA    F T+
Sbjct: 136 FRSLFKGLGPNLVGVIPARSINFFTY 161

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 76/332 (22%), Positives = 130/332 (39%), Gaps = 43/332 (12%)

Query: 9   LLIDDIDQQPHDSGRVLKDLLAG----TAGGMAQVL---VGQPFDTTKV----RLQTSTT 57
           L  +D+D        ++ D + G     AGG + V+      PFD  KV    R   S+T
Sbjct: 177 LFNEDVDLSSEGDVTLINDFIKGFGFFIAGGCSGVVSRTCTAPFDRIKVFLIARTDLSST 236

Query: 58  ------------PTTAVEVVKK--------LVKNEGLRGFYKGTLTPLVGVGACVSCQFG 97
                       P   +  +K         L +  GLR FY G    +V V    + +FG
Sbjct: 237 LLNSKDTLLAKNPNADLSKIKSPLIKAATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFG 296

Query: 98  VNEAMKRFF-RGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTV 156
             E  KR   R  +      L+    YI G +GGVA  F   PI+ ++ R+Q    +  +
Sbjct: 297 SFEMAKRIMARLENVKDTSELSRLSTYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNL 356

Query: 157 AEFKGPLDCINKLRANGAL---MRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSD 213
            +    L    ++   G +    RG+   ++      A    T+ AL    I K   ++ 
Sbjct: 357 KKSSILLQTAKEMYQQGGIRLFYRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTG 416

Query: 214 VPAWKLCL-------FGAVSGVTLWLTVYPLDVIKSLMQTD-NLKNPVRGKNIIQVARLV 265
           +P  ++ +        GA SG      VYP++++++ +Q      +P        V +  
Sbjct: 417 LPEDEVIISNLIVLPMGAFSGTVGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKT 476

Query: 266 NAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
             + G++  FKG  P + +  PA   ++  +E
Sbjct: 477 IQREGYQGLFKGLVPNLAKVCPAVSISYLCYE 508

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 6/70 (8%)

Query: 44  PFDTTKVRLQTSTT---PTTA---VEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFG 97
           P +  + RLQ   T   P T     +V+KK ++ EG +G +KG +  L  V   VS  + 
Sbjct: 446 PINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPNLAKVCPAVSISYL 505

Query: 98  VNEAMKRFFR 107
             E +KR  +
Sbjct: 506 CYENLKRLMK 515

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/256 (25%), Positives = 108/256 (42%), Gaps = 26/256 (10%)

Query: 64  VVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYY 123
           ++  + + EG R  +KG    LVGV    S  F      K  +  +  +  +   +  + 
Sbjct: 116 IIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFLTYGTTKDIYSRTLNNGQEAPWI--HL 173

Query: 124 ICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGA---LMRGLS 180
           +     G A S + +PI  V+ RLQ   A GT   +K  LDCI  +  N     L +GLS
Sbjct: 174 LAAATAGWATSTVTNPIWLVKTRLQLDKA-GT-KTYKNSLDCIKSVVKNEGVLGLYKGLS 231

Query: 181 PTILREAQGCATYFLTYEALVANQIGKGIAR-----------SD-VPAWKLCLFGAVSGV 228
            + L   +G   + L YE +      + I +           SD V  W  C     +G+
Sbjct: 232 ASYLGSVEGILQWIL-YEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEW--CQRSGSAGL 288

Query: 229 TLW---LTVYPLDVIKS-LMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLR 284
             +   +  YP +V+++ L Q       ++   ++Q  R++  + G  S + G  P +LR
Sbjct: 289 AKFVASIVTYPHEVVRTRLRQAPTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPHLLR 348

Query: 285 AAPANGATFATFELAM 300
             P +   F T+EL +
Sbjct: 349 TVPNSIIMFGTWELVI 364

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 79/193 (40%), Gaps = 20/193 (10%)

Query: 28  LLAGTAGGMAQVLVGQPFDTTKVRLQT----STTPTTAVEVVKKLVKNEGLRGFYKGTLT 83
           LLA    G A   V  P    K RLQ     + T   +++ +K +VKNEG+ G YKG   
Sbjct: 173 LLAAATAGWATSTVTNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYKGLSA 232

Query: 84  PLVGVGACVSCQFGVNEAMKRFFR-------GSSADPHKTLTLPQYYICGFVG--GVAN- 133
             +G    +  Q+ + E MKR  +       G   +  K+ +      C   G  G+A  
Sbjct: 233 SYLGSVEGI-LQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGLAKF 291

Query: 134 --SFLASPIEHVRIRLQTQTASGTVAEFKG---PLDCINKLRANGALMRGLSPTILREAQ 188
             S +  P E VR RL+         ++ G       I K     ++  GL+P +LR   
Sbjct: 292 VASIVTYPHEVVRTRLRQAPTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPHLLRTVP 351

Query: 189 GCATYFLTYEALV 201
                F T+E ++
Sbjct: 352 NSIIMFGTWELVI 364

 Score = 31.6 bits (70), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 32/82 (39%), Gaps = 21/82 (25%)

Query: 236 PLDVIKSLMQTDNLKNPVRG---------------------KNIIQVARLVNAKYGWKSF 274
           P DV+K+ +Q+D  +   +                      K    +   V  + G++S 
Sbjct: 70  PFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGFRSL 129

Query: 275 FKGFGPTMLRAAPANGATFATF 296
           FKG GP ++   PA    F T+
Sbjct: 130 FKGLGPNLVGVIPARSINFLTY 151

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 59.3 bits (142), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 67/280 (23%), Positives = 105/280 (37%), Gaps = 29/280 (10%)

Query: 10  LIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTS---TTPTTAVEVVK 66
           L DD +  P     +    LAG  GG+         DT K R Q +         ++  +
Sbjct: 44  LFDDYEHSP-----IWHCFLAGGVGGIIGDSAMHSLDTVKTRQQGAPNVHKYKHMLQAYR 98

Query: 67  KLVKNEGLR-GFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYIC 125
            +   EG R G Y G    ++G     +  F   E  KR       D H   T   +   
Sbjct: 99  TMFIEEGFRRGLYGGYCAAMLGSFPSAAIFFSTYEFTKRTMIN---DYHLNDTF-SHLTA 154

Query: 126 GFVGGVANSFLASPIEHVRIRLQTQ--------TASGTVAEFKGPLDCINKLRANGALMR 177
           GF+G   +SF+  P E ++ RLQ Q         +       +  +  I +     AL  
Sbjct: 155 GFLGDFFSSFVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFF 214

Query: 178 GLSPTILREAQGCATYFLTYEALVANQI---GKGIARSDVPAWKLCLFGAVSGVTLWLTV 234
           G   T+ R+    A  F  YE          GK I + D+      + GA +G    +  
Sbjct: 215 GYKATLARDLPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEIVTGACAGGLAGILT 274

Query: 235 YPLDVIKSLMQTD-----NLKNPVRGKNIIQVARLVNAKY 269
            PLDV+K+ +QT      ++    + KN+ +   L N+ +
Sbjct: 275 TPLDVVKTRVQTQLPSQIDISTDTKIKNVSKPVTLTNSIF 314

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 58.9 bits (141), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 87/189 (46%), Gaps = 24/189 (12%)

Query: 122 YYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSP 181
           + I GF GG++++    P++ ++ R Q QT  GT+ +       +  L     L RG  P
Sbjct: 7   HLIGGFAGGLSSAVALQPLDLLKTRFQ-QTKGGTLWQ------TVKSLDTPWQLWRGTLP 59

Query: 182 TILREAQGCATYF----LTYEALVANQ---------IGKGIARSDVPAWKLCLFGAVSGV 228
           + +R + G A Y     L   AL   +          GK      +  ++  + GA +  
Sbjct: 60  SAIRTSVGSALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTGAFARG 119

Query: 229 TLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPA 288
           T+     P+ +IK   ++  L N    K+I + A+ + A+ G + FF+GFGPT LR AP 
Sbjct: 120 TVGYITMPITIIKVRYES-TLYNY---KSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPY 175

Query: 289 NGATFATFE 297
           +G     +E
Sbjct: 176 SGLYVLLYE 184

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 71/294 (24%), Positives = 113/294 (38%), Gaps = 33/294 (11%)

Query: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNEGL-RGFYKGTLTPL 85
            L+ G AGG++  +  QP D  K R Q  T   T  + VK L     L RG     +   
Sbjct: 7   HLIGGFAGGLSSAVALQPLDLLKTRFQ-QTKGGTLWQTVKSLDTPWQLWRGTLPSAIRTS 65

Query: 86  VGVGACVSCQFGVNEAM---KRFFRGSSADPHKTLTLPQ--YYICGFVGGVAN---SFLA 137
           VG    +S    +  A+   K+F    S    K+  LPQ   Y     G  A     ++ 
Sbjct: 66  VGSALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTGAFARGTVGYIT 125

Query: 138 SPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGAL---MRGLSPTILREAQGCATYF 194
            PI  +++R ++     T+  +K   +    + A   +    RG  PT LR+A     Y 
Sbjct: 126 MPITIIKVRYES-----TLYNYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSGLYV 180

Query: 195 LTYEAL---VANQIGKGIARSD----VPAWKLCLFGAVSGV---TLWLTVY-PLDVIKSL 243
           L YE L   +   + K + + D      A+      + S +   ++  TV  P D IK+ 
Sbjct: 181 LLYEKLKHTLPTILPKSLLQLDSEGRYTAYTSTAINSTSAILSASMATTVTAPFDTIKTR 240

Query: 244 MQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
           MQ +    P + K        +  +      F G    + R A + G  +  +E
Sbjct: 241 MQLE----PTKFKTFWSTLTTIVTQEHPIKIFSGLSMRLTRKALSAGIAWGIYE 290

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 58.9 bits (141), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 66/320 (20%), Positives = 125/320 (39%), Gaps = 58/320 (18%)

Query: 28  LLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA--------VEVVKKLVKNEGLRGFYK 79
           L  G +G  A+ L+  P D  K+  QTS    T         VE  K +  N+G+RGF++
Sbjct: 38  LAGGISGSCAKTLIA-PLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQ 96

Query: 80  GTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTL-TLPQYYICGFVGGVANSFLAS 138
           G    L+ +    + +F   E ++     ++  P K   +  +  + G + G+ + F+  
Sbjct: 97  GHSATLLRIFPYAAVKFVAYEQIR-----NTLIPSKEFESHWRRLVSGSLAGLCSVFITY 151

Query: 139 PIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALM----------------RGLSPT 182
           P++ VR+RL  +T    V +    +  I K  A+  L+                RG  PT
Sbjct: 152 PLDLVRVRLAYETEHKRV-KLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYVPT 210

Query: 183 ILREAQGCATYFLTYEAL---------------------VANQIGKGIARSDVPAWKLCL 221
           +L         F  ++ L                        ++ K   R  +  W   +
Sbjct: 211 VLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQKK-QRRPLRTWAELI 269

Query: 222 FGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPV----RGKNIIQVARLVNAKYGWKSFFKG 277
            G ++G+      YP ++I+  +Q   L        + ++I ++A ++  + G + FF G
Sbjct: 270 SGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAHIIFKERGVRGFFVG 329

Query: 278 FGPTMLRAAPANGATFATFE 297
                ++  P    +F  +E
Sbjct: 330 LSIGYIKVTPMVACSFFVYE 349

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 82/194 (42%), Gaps = 24/194 (12%)

Query: 126 GFVGGVANSF---LASPIEHVRIRLQTQTASGT--VAEFKGPLDCINKLRANGAL---MR 177
           G  GG++ S    L +P++ ++I  QT     T       G ++    +  N  +    +
Sbjct: 37  GLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQ 96

Query: 178 GLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPL 237
           G S T+LR     A  F+ YE +    I      S    W+  + G+++G+      YPL
Sbjct: 97  GHSATLLRIFPYAAVKFVAYEQIRNTLIPSKEFESH---WRRLVSGSLAGLCSVFITYPL 153

Query: 238 DVIKSLMQTDNLKNPVRGKNIIQ-------VARLVNAKY------GWKSFFKGFGPTMLR 284
           D+++  +  +     V+   II+        A L+   Y       W +F++G+ PT+L 
Sbjct: 154 DLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYVPTVLG 213

Query: 285 AAPANGATFATFEL 298
             P  G +F   +L
Sbjct: 214 MIPYAGVSFFAHDL 227

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 48/109 (44%), Gaps = 9/109 (8%)

Query: 4   ETSSPLLIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTST-TPTTAV 62
           E S    ++ + ++     R   +L++G   GMA      PF+  + RLQ S  +P T  
Sbjct: 244 ELSEDDELERVQKKQRRPLRTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMY 303

Query: 63  --------EVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMK 103
                   E+   + K  G+RGF+ G     + V   V+C F V E MK
Sbjct: 304 DHKFQSISEIAHIIFKERGVRGFFVGLSIGYIKVTPMVACSFFVYERMK 352

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 58.9 bits (141), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 70/300 (23%), Positives = 117/300 (39%), Gaps = 50/300 (16%)

Query: 44  PFDTTKVRLQTST------TPTTA---------------VEVVKKLVKNEGLRGFYKGTL 82
           PFD  K RLQ+        T  TA               V +++ +   EG R  +KG  
Sbjct: 69  PFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGLG 128

Query: 83  TPLVGVGACVSCQF---GV-NEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLAS 138
             LVGV    S  F   GV  +   R        P        +++ G   G A S   +
Sbjct: 129 PNLVGVIPARSINFFTYGVTKDTASRLLNDGQEAPWI------HFLAGATAGWATSTATN 182

Query: 139 PIEHVRIRLQ-TQTASGTVAEFKGPLDCINKLRANGALM---RGLSPTILREAQGCATYF 194
           PI  V+ RLQ  + A G    +K   DC+  +  N  ++   +GLS + L   +    + 
Sbjct: 183 PIWLVKTRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGLSASYLGSVESILQWV 242

Query: 195 LTYEAL-------VANQIGKGIARSDVPAWKLCLF----GAVSGVTLWLTV--YPLDVIK 241
           L YE +          + G     +     K+  +    G+     L+ ++  YP +V++
Sbjct: 243 L-YEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAAKLFASILTYPHEVVR 301

Query: 242 S-LMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAM 300
           + L Q       ++   + Q   L+  + G+ S + G  P ++R  P +   F T+EL +
Sbjct: 302 TRLRQAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVPNSIIMFGTWELVI 361

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/275 (24%), Positives = 112/275 (40%), Gaps = 25/275 (9%)

Query: 33  AGGMAQ---VLVGQPFDTTKVRLQ--------TSTTPTTAVEVVKKLVKNEGLRGFYKGT 81
           AGG+A    V V  PFD  K R+Q         +   T  ++    + KNEG+ G  KG 
Sbjct: 26  AGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKNEGIAGLQKGL 85

Query: 82  LTPLVGVGACVSCQFGVNEAMKRFFRG---SSADPHKTLTLPQYYICGFVGGVANSFLAS 138
            +  +   A    + G  E ++         + + HK   +      G   GV  +F+ S
Sbjct: 86  ASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHIGINVAAGATSGVVGAFIGS 145

Query: 139 PIEHVRIRLQTQTASGTVAEFKGPLDCINKL----RANG--ALMRGLSPTILREAQGCAT 192
           P+  V+ R+Q+ + +  + +        N L    R+ G   L RG+   +LR   G A 
Sbjct: 146 PLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGIKGLFRGVDAAMLRTGIGSAV 205

Query: 193 YFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNP 252
               Y  +  N + K    +D     L L   ++G  + + + P DV+  L +  N K  
Sbjct: 206 QLPIYN-ICKNFLLKHDLMNDGTGLHL-LSSTIAGFGVGVAMNPWDVV--LTRVYNQKGN 261

Query: 253 VRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAP 287
           +    I    + V  + G  + +KGFG  +LR  P
Sbjct: 262 LYSGPIDCFIKTVRNE-GLSALYKGFGAQILRIGP 295

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 76/182 (41%), Gaps = 21/182 (11%)

Query: 17  QPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQT---------STTPTTAVEVVKK 67
           + H    +  ++ AG   G+    +G P    K R+Q+          T  T+A   +  
Sbjct: 119 ESHKVQHIGINVAAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLAT 178

Query: 68  LVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRF-FRGSSADPHKTLTLPQYYICG 126
           + ++EG++G ++G    ++  G   + Q  +    K F  +    +    L L    I G
Sbjct: 179 IFRSEGIKGLFRGVDAAMLRTGIGSAVQLPIYNICKNFLLKHDLMNDGTGLHLLSSTIAG 238

Query: 127 FVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDC-INKLRANG--ALMRGLSPTI 183
           F  GVA     +P + V  R+  Q  +     + GP+DC I  +R  G  AL +G    I
Sbjct: 239 FGVGVA----MNPWDVVLTRVYNQKGN----LYSGPIDCFIKTVRNEGLSALYKGFGAQI 290

Query: 184 LR 185
           LR
Sbjct: 291 LR 292

 Score = 29.6 bits (65), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 2/65 (3%)

Query: 27  DLLAGTAGGMAQVLVGQPFDT--TKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYKGTLTP 84
            LL+ T  G    +   P+D   T+V  Q     +  ++   K V+NEGL   YKG    
Sbjct: 230 HLLSSTIAGFGVGVAMNPWDVVLTRVYNQKGNLYSGPIDCFIKTVRNEGLSALYKGFGAQ 289

Query: 85  LVGVG 89
           ++ +G
Sbjct: 290 ILRIG 294

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/279 (23%), Positives = 114/279 (40%), Gaps = 26/279 (9%)

Query: 31  GTAGGMAQVLVGQPFDTTKVRLQTSTTPT-TAVEVVKKLVKNEGLRGFYKGTLTPLVGVG 89
           G A G+   +V  P D  KVRLQ +  P  T   +++ ++ NEG+ G Y G    ++   
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRLQAAPMPKPTLFRMLESILANEGVVGLYSGLSAAVLRQC 79

Query: 90  ACVSCQFGVNEAMKRFFRGSSADPHKTLT-----LPQYYICGFVGGVANSFLASPIEHVR 144
              + +FG  + +K      +  P + LT     LP     G +GG+A +F     + V 
Sbjct: 80  TYTTVRFGAYDLLK-----ENVIPREQLTNMAYLLPCSMFSGAIGGLAGNF----ADVVN 130

Query: 145 IRLQTQTA--SGTVAEFKGPLDCINKL-RANGA---LMRGLSPTILREAQGCATYFLTYE 198
           IR+Q  +A  +     +K  +D + K+ R  G    L  G  P ++R     A+  +TY+
Sbjct: 131 IRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTYD 190

Query: 199 ALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNI 258
               N +   +       +       ++G+       P DV+K+ +   +  +    K +
Sbjct: 191 VF-KNYLVTKLDFDASKNYTHLTASLLAGLVATTVCSPADVMKTRIMNGSGDHQPALKIL 249

Query: 259 IQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
               R    K G    F+G+ P+  R  P     F   E
Sbjct: 250 ADAVR----KEGPSFMFRGWLPSFTRLGPFTMLIFFAIE 284

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 77/194 (39%), Gaps = 23/194 (11%)

Query: 115 KTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGP--LDCINKLRAN 172
           K +  P +Y  G   G+  + +  P++  ++RLQ        A    P     +  + AN
Sbjct: 11  KNIKYPWWY--GGAAGIFATMVTHPLDLAKVRLQ-------AAPMPKPTLFRMLESILAN 61

Query: 173 GA---LMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLF-GAVSGV 228
                L  GLS  +LR+       F  Y+ L  N I +    +        +F GA+ G+
Sbjct: 62  EGVVGLYSGLSAAVLRQCTYTTVRFGAYDLLKENVIPREQLTNMAYLLPCSMFSGAIGGL 121

Query: 229 TLWLTVYPLDVIKSLMQTDNLKNPVRGKN----IIQVARLVNAKYGWKSFFKGFGPTMLR 284
                    DV+   MQ D+     + +N    I  V ++   + G K+ F G+ P M+R
Sbjct: 122 AGNFA----DVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVR 177

Query: 285 AAPANGATFATFEL 298
                 +   T+++
Sbjct: 178 GILMTASQVVTYDV 191

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 72/291 (24%), Positives = 115/291 (39%), Gaps = 29/291 (9%)

Query: 25  LKDLLAGTAGGMAQVLVGQPFDTTKVRLQ----TSTTPTTAVEVVKKLVKNEGLRGFYKG 80
           L   LAG+  G A+  +  PF+  K RLQ     S      + ++ K  K +G+   Y G
Sbjct: 13  LHSFLAGSLAGAAEACITYPFEFAKTRLQLIDKASKASRNPLVLIYKTAKTQGIGSIYVG 72

Query: 81  TLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLA-SP 139
               ++G  A    +F   + +K   R S       L+  +  I G   G+  S  A +P
Sbjct: 73  CPAFIIGNTAKAGIRFLGFDTIKDMLRDSETGE---LSGTRGVIAGLGAGLLESVAAVTP 129

Query: 140 IEHVRIRLQTQTASGTVAEFKGPLDCINK----LRANG--ALMRGLSPTILREAQGCATY 193
            E ++  L     S T          +      +R  G   L RG+ P  +R+A   A  
Sbjct: 130 FEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQAANQAVR 189

Query: 194 FLTYEALVANQIGKGIAR-SDVPAWK------LCLFGAVSGVTLWLTVYPLDVIKSLMQT 246
              Y     N+I   I   +D P  K        L GA SG+    +  PLD +K+ MQ+
Sbjct: 190 LGCY-----NKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTMPLDTVKTRMQS 244

Query: 247 DNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
               +  +  + +     +  + G K+F+KG  P + R   + G  F  +E
Sbjct: 245 ---LDSTKYSSTMNCFATIFKEEGLKTFWKGATPRLGRLVLSGGIVFTIYE 292

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 116/281 (41%), Gaps = 37/281 (13%)

Query: 33  AGGMAQ---VLVGQPFDTTKVRLQTSTTPTTAVEVVKK--------LVKNEGLRGFYKGT 81
           AGG+A    V V  PF+  K R+Q     +   + + +        + KNEG++G  +G 
Sbjct: 29  AGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGVIFKNEGVKGLQRGL 88

Query: 82  LTPLVGVGACVSCQFGVNEAM-----KRFFRGSSADPHKTLTLPQYYICGFVGGVANSFL 136
           ++  V        + G  E +     K FF    +DPHK   +      G   G+  + +
Sbjct: 89  VSAYVYQIGLNGSRLGFYEPIRTVLNKTFF--PESDPHKLQNVAVNVTAGATSGIIGAIV 146

Query: 137 ASPIEHVRIRLQTQTASGTVAE------FKGPLDCINKLRANGALMRGLSPTILREAQGC 190
            SP+  V+ R+Q+ + +  + E          L  I K      L RG+   ILR   G 
Sbjct: 147 GSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRGVDAAILRTGAGS 206

Query: 191 AT----YFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQT 246
           +     Y  T   L+ N I K     +  A  L L   V+G+ + + + P DV+  L + 
Sbjct: 207 SVQLPIYNTTKNFLLQNDIMK-----EGTALHL-LSSTVTGLGVGIVMNPWDVV--LTRV 258

Query: 247 DNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAP 287
            N K       I  + + +  + G  + +KGFG  + R AP
Sbjct: 259 YNQKGNTYKGPIDCMFKTIKIE-GIGALYKGFGAQLFRIAP 298

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 75/185 (40%), Gaps = 19/185 (10%)

Query: 15  DQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQT---------STTPTTAVEVV 65
           +  PH    V  ++ AG   G+   +VG P    K R+Q+          T  T+    +
Sbjct: 120 ESDPHKLQNVAVNVTAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGL 179

Query: 66  KKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYIC 125
             + K EG+ G ++G    ++  GA  S Q  +    K F   +      T     + + 
Sbjct: 180 ATIFKKEGVLGLFRGVDAAILRTGAGSSVQLPIYNTTKNFLLQNDIMKEGT---ALHLLS 236

Query: 126 GFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCIN---KLRANGALMRGLSPT 182
             V G+    + +P + V  R+  Q  +     +KGP+DC+    K+   GAL +G    
Sbjct: 237 STVTGLGVGIVMNPWDVVLTRVYNQKGN----TYKGPIDCMFKTIKIEGIGALYKGFGAQ 292

Query: 183 ILREA 187
           + R A
Sbjct: 293 LFRIA 297

>Scas_578.3*
          Length = 524

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 72/331 (21%), Positives = 124/331 (37%), Gaps = 43/331 (12%)

Query: 9   LLIDDIDQQPHDSGRVLKDLLAG----TAGGMAQVL---VGQPFDTTKVRLQTSTTPTTA 61
           L  +D+D        ++ D + G     AGG++ V+      P D  KV L   T  ++ 
Sbjct: 186 LFNEDVDLSSEGDMTLINDFIKGFGYFIAGGLSGVISRTCTAPLDRIKVFLIARTDLSST 245

Query: 62  ----------------------VEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVN 99
                                 ++ ++ L +  GLR FY G    +  +    S +FG  
Sbjct: 246 LLNPKMHLRIQGLNLAKIRSPIIKAIRSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTF 305

Query: 100 EAMKRFFRGSSADPH-KTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAE 158
           E  KR     S D     L+  Q Y+ G + GV       PI+ ++ R+Q     G +  
Sbjct: 306 ELAKRLMANLSGDKLVNDLSKLQTYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKG 365

Query: 159 FKGPLDCINKLRANGALMRGLSPTILREAQGCATY----FLTYEALVANQIGKGIARSDV 214
               +    ++   G + R     +L  A G   Y      T+ AL    I +   + ++
Sbjct: 366 NALLISTAKEMYKEGGI-RVFYRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNI 424

Query: 215 PAWKLCL-------FGAVSGVTLWLTVYPLDVIKSLMQTD-NLKNPVRGKNIIQVARLVN 266
           P   + L        GA SG      VYP++++++ +Q      +P        V     
Sbjct: 425 PEKDVMLSYLLVLPMGAFSGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTL 484

Query: 267 AKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
            + G   F+KG  PT+++  PA    +  +E
Sbjct: 485 KREGVPGFYKGLVPTLVKVCPAVSIGYLCYE 515

 Score = 57.4 bits (137), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 86/207 (41%), Gaps = 24/207 (11%)

Query: 15  DQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTP------TTAVEVVKKL 68
           D+  +D  ++   +  G AG MAQ+ +  P DT K R+Q +            +   K++
Sbjct: 318 DKLVNDLSKLQTYVAGGIAGVMAQISI-YPIDTLKFRIQCAPLEGNLKGNALLISTAKEM 376

Query: 69  VKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSAD----PHKT------LT 118
            K  G+R FY+G L   +G+    +   G   A+K+++    +     P K       L 
Sbjct: 377 YKEGGIRVFYRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLV 436

Query: 119 LPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDC-INKLRANG--AL 175
           LP     G VG  A      PI  +R RLQ Q        + G  D  +  L+  G    
Sbjct: 437 LPMGAFSGTVGATA----VYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGF 492

Query: 176 MRGLSPTILREAQGCATYFLTYEALVA 202
            +GL PT+++     +  +L YE   A
Sbjct: 493 YKGLVPTLVKVCPAVSIGYLCYEKFKA 519

 Score = 35.0 bits (79), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 45/94 (47%), Gaps = 17/94 (18%)

Query: 223 GAVSGVTLWLTVYPLDVIKSLM--QTD---NLKNP-----VRGKN-------IIQVARLV 265
           G +SGV       PLD IK  +  +TD    L NP     ++G N       II+  R +
Sbjct: 215 GGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSPIIKAIRSL 274

Query: 266 NAKYGWKSFFKGFGPTMLRAAPANGATFATFELA 299
             + G ++F+ G G ++ +  P +   F TFELA
Sbjct: 275 YRQGGLRAFYVGNGLSVFKICPESSIKFGTFELA 308

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 69/279 (24%), Positives = 113/279 (40%), Gaps = 31/279 (11%)

Query: 32  TAGGMAQ---VLVGQPFDTTKVRLQTS-----------TTPTTAVEVVKKLVKNEGLRGF 77
           TAGG+A    V V  P +  K+R+Q             T P  A+ VV    +NEG+RG 
Sbjct: 23  TAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVV---FRNEGIRGL 79

Query: 78  YKGTLTPLVGVGACVSCQFGVNEAMKRFFRGS---SADPHKTLTLPQYYICGFVGGVANS 134
            KG +   +   A    + G  E ++     +     + HK  ++      G   G+  +
Sbjct: 80  QKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGA 139

Query: 135 FLASPIEHVRIRLQTQTASGTVAE---FKGP---LDCINKLRANGALMRGLSPTILREAQ 188
            + SP+  V+ RLQ+ + +  + E   + G    L  I        L RG+   ILR   
Sbjct: 140 VMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGA 199

Query: 189 GCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDN 248
           G +     Y     N + +     D P+  L     +SG+ + + + P DVI  L +  N
Sbjct: 200 GSSVQLPIYNT-AKNFLLRNDIMEDGPSLHLTA-STISGLGVAVVMNPWDVI--LTRIYN 255

Query: 249 LKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAP 287
            K  +    I  + + V  + G  + +KGF   + R  P
Sbjct: 256 QKGDLYKGPIDCLVKTVKIE-GITALYKGFEAQVFRIGP 293

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 79/184 (42%), Gaps = 21/184 (11%)

Query: 15  DQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQT---------STTPTTAVEVV 65
           DQ+ H    V  ++ AG A G+   ++G P    K RLQ+          T  T     +
Sbjct: 115 DQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGL 174

Query: 66  KKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRF-FRGSSADPHKTLTLPQYYI 124
           K +   EG++G ++G    ++  GA  S Q  +    K F  R    +   +L L    I
Sbjct: 175 KTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTI 234

Query: 125 CGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINK-LRANG--ALMRGLSP 181
            G   GVA   + +P + +  R+  Q        +KGP+DC+ K ++  G  AL +G   
Sbjct: 235 SGL--GVA--VVMNPWDVILTRIYNQKGD----LYKGPIDCLVKTVKIEGITALYKGFEA 286

Query: 182 TILR 185
            + R
Sbjct: 287 QVFR 290

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 78/176 (44%), Gaps = 18/176 (10%)

Query: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA---------VEVVKKLVKNEGLRGF 77
           +L +G A G   +L     D  + RL      +            +V KK +K++G+ G 
Sbjct: 119 NLASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGL 178

Query: 78  YKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLA 137
           Y+G +  +VG+       FG+ +++K      S D     +    ++ G+V     S  +
Sbjct: 179 YRGFMPSVVGIVVYRGLYFGMFDSLKPLVLTGSLDG----SFLASFLLGWVVTTGASTCS 234

Query: 138 SPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRAN---GALMRGLSPTILREAQGC 190
            P++ VR R+     SG   ++ G +DC+ K+ A+   G+L +G    ILR   G 
Sbjct: 235 YPLDTVRRRM--MMTSGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGA 288

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 98/248 (39%), Gaps = 12/248 (4%)

Query: 62  VEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRG-SSADPHKTLTLP 120
           V+    L +  GLR FY G    ++ V    + +FG  E  KR   G         L+  
Sbjct: 237 VKAATSLYRQGGLRAFYLGNGLNVIKVFPESAMKFGSFELAKRVLAGLEGCGETGELSRL 296

Query: 121 QYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGAL---MR 177
             Y+ G +GG+   F   PI+ ++ R+Q              +     +   G L    R
Sbjct: 297 STYVAGGLGGIMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGLRLFYR 356

Query: 178 GLSPTILREAQGCATYFLTYEALVANQIGK-----GIARSDVPAWKLCLF--GAVSGVTL 230
           GL   IL      A    T+ AL    I +     GI+ ++V    L +   GA SG   
Sbjct: 357 GLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTVG 416

Query: 231 WLTVYPLDVIKSLMQTD-NLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPAN 289
              VYP++++++ +Q      +P R      V R    + G    +KG  PT+ +  PA 
Sbjct: 417 ATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTLAKVCPAV 476

Query: 290 GATFATFE 297
             ++  +E
Sbjct: 477 AISYLCYE 484

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 81/196 (41%), Gaps = 25/196 (12%)

Query: 25  LKDLLAGTAGG-MAQVLVGQPFDTTKVRLQTSTTPTTA------VEVVKKLVKNEGLRGF 77
           L   +AG  GG MAQ  V  P DT K R+Q +   T        ++  K + +  GLR F
Sbjct: 296 LSTYVAGGLGGIMAQFSV-YPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGLRLF 354

Query: 78  YKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADP----------HKTLTLPQYYICGF 127
           Y+G    ++GV    +   G   A+KR++    A+              + LP     G 
Sbjct: 355 YRGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGT 414

Query: 128 VGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINK-LRANG--ALMRGLSPTIL 184
           VG      +  PI  +R RLQ Q        + G  D   K ++  G   L +GL PT+ 
Sbjct: 415 VGAT----VVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTLA 470

Query: 185 REAQGCATYFLTYEAL 200
           +     A  +L YE L
Sbjct: 471 KVCPAVAISYLCYENL 486

 Score = 35.8 bits (81), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 81/191 (42%), Gaps = 13/191 (6%)

Query: 115 KTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPL--DCINKLRAN 172
           +T T P   I  F+  +A + L+SP+ H   +L         A+ + PL     +  R  
Sbjct: 190 RTCTAPFDRIKVFL--IARTDLSSPLLHTPEQLLHHNPRADPAKIRSPLVKAATSLYRQG 247

Query: 173 G--ALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIA----RSDVPAWKLCLFGAVS 226
           G  A   G    +++     A  F ++E  +A ++  G+       ++      + G + 
Sbjct: 248 GLRAFYLGNGLNVIKVFPESAMKFGSFE--LAKRVLAGLEGCGETGELSRLSTYVAGGLG 305

Query: 227 GVTLWLTVYPLDVIKSLMQTDNLKNPVRG-KNIIQVARLVNAKYGWKSFFKGFGPTMLRA 285
           G+    +VYP+D +K  +Q   L    RG   +I+ A+ +  + G + F++G G  +L  
Sbjct: 306 GIMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGLRLFYRGLGVGILGV 365

Query: 286 APANGATFATF 296
            P       TF
Sbjct: 366 FPYAALDLGTF 376

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 34/83 (40%), Gaps = 6/83 (7%)

Query: 31  GTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA------VEVVKKLVKNEGLRGFYKGTLTP 84
           G   G     V  P +  + RLQ   T           +V +K V+ EGL G YKG +  
Sbjct: 409 GAFSGTVGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPT 468

Query: 85  LVGVGACVSCQFGVNEAMKRFFR 107
           L  V   V+  +   E +KR  R
Sbjct: 469 LAKVCPAVAISYLCYENLKRAMR 491

>Kwal_23.3042
          Length = 542

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 79/187 (42%), Gaps = 15/187 (8%)

Query: 29  LAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA------VEVVKKLVKNEGLRGFYKGTL 82
           LAG  GG+   L   P DT K R+Q +   T +      +   K + K  GLR FY+G  
Sbjct: 349 LAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKEGGLRIFYRGIT 408

Query: 83  TPLVGVGACVSCQFGVNEAMKRFFRGSSAD----PHKTLTLPQYYIC--GFVGGVANSFL 136
             ++G+    +   G   A+K+++    A     P   +T+   ++   G   G   +  
Sbjct: 409 VGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAFSGTVGATA 468

Query: 137 ASPIEHVRIRLQTQTASGTVAEFKGPLDCINK-LRANG--ALMRGLSPTILREAQGCATY 193
             P+  +R RLQ Q        + G  D + K ++  G   L +GL P + +     +  
Sbjct: 469 VYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGLVPNLAKVCPAVSIS 528

Query: 194 FLTYEAL 200
           +L YE L
Sbjct: 529 YLCYENL 535

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 73/333 (21%), Positives = 126/333 (37%), Gaps = 45/333 (13%)

Query: 9   LLIDDIDQQPHDSGRVLKDLLAG----TAGGMAQVL---VGQPFDTTKV----RLQTSTT 57
           L  +D+D        ++ D + G     AGG++ V+      PFD  KV    R   S+T
Sbjct: 202 LFNEDVDLSSEGDVTLINDFIRGFGFFIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSST 261

Query: 58  ------------PTTAVEVVKK--------LVKNEGLRGFYKGTLTPLVGVGACVSCQFG 97
                       P   +  +K         L +  G+R FY G     + V    + +FG
Sbjct: 262 FLKSKDIILEKNPNADLSKIKSPLVKAATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFG 321

Query: 98  VNEAMKRFFRGSSADPHKTLTLPQY--YICGFVGGVANSFLASPIEHVRIRLQTQTASGT 155
             E  KR           T  L ++  Y+ G +GGV       PI+ ++ R+Q    +  
Sbjct: 322 SFELAKRLM-AQLEGVQDTAGLSRFSTYLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTE 380

Query: 156 VAEFKGPLDCINKLRANGAL---MRGLSPTILREAQGCATYFLTYEALVANQIGKGIARS 212
               +  +     +   G L    RG++  I+      A    T+ AL    I +    +
Sbjct: 381 SKGRQLLISTAKDMYKEGGLRIFYRGITVGIMGIFPYAAMDLGTFSALKKWYIARQARLT 440

Query: 213 DVPAWKLC-------LFGAVSGVTLWLTVYPLDVIKSLMQTD-NLKNPVRGKNIIQVARL 264
            +P  ++        L GA SG      VYP++++++ +Q      +P R      V   
Sbjct: 441 GLPEDQVTMSNMFVLLMGAFSGTVGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLK 500

Query: 265 VNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
              + G++  FKG  P + +  PA   ++  +E
Sbjct: 501 TVQREGYQGLFKGLVPNLAKVCPAVSISYLCYE 533

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 34/83 (40%), Gaps = 6/83 (7%)

Query: 28  LLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA------VEVVKKLVKNEGLRGFYKGT 81
           LL G   G        P +  + RLQ   T           +V+ K V+ EG +G +KG 
Sbjct: 455 LLMGAFSGTVGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGL 514

Query: 82  LTPLVGVGACVSCQFGVNEAMKR 104
           +  L  V   VS  +   E +KR
Sbjct: 515 VPNLAKVCPAVSISYLCYENLKR 537

>Kwal_23.4354
          Length = 343

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 98/228 (42%), Gaps = 45/228 (19%)

Query: 112 DPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQ---------TASG--TVAEFK 160
           +  K + L +  +   VG +  S + +P++ VRIRLQ Q         T +G  + A  K
Sbjct: 4   EKQKGIGLKERLLSAVVGSLLTSLILTPMDVVRIRLQQQKMLPDCGCETDAGLTSRASSK 63

Query: 161 G---------PLDC----------------INKLRANGALMRGLSPTILREAQGCATYFL 195
           G          + C                I K+    +L RGLS T+L  A     YF+
Sbjct: 64  GVFWQDICFEDVRCKTSPVRYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFI 123

Query: 196 TYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNP--- 252
            YE+L      K   +   P     + GA++ V    TV PL++ ++ +Q+    +P   
Sbjct: 124 GYESLR----DKSRLQDKYPTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKST 179

Query: 253 --VRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFEL 298
             +  K++I+ +R   +K G+K+ F+G   T+ R  P +   +  +E 
Sbjct: 180 TAMMIKDLIKESRYEISKVGYKALFRGLEITLWRDVPFSSIYWGCYEF 227

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 64/270 (23%), Positives = 109/270 (40%), Gaps = 29/270 (10%)

Query: 50  VRLQTSTTPTTAV-EVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRG 108
           VR +TS     +  +   K+ K EG++  ++G    L+         F   E+++   + 
Sbjct: 75  VRCKTSPVRYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYESLRD--KS 132

Query: 109 SSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQT----QTASGTVAEFKGPLD 164
              D + TL  P   +CG +  V  +   +P+E  R RLQ+       S T    K   D
Sbjct: 133 RLQDKYPTLN-P--LMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIK---D 186

Query: 165 CINKLRAN------GALMRGLSPTILREAQGCATYFLTYEALVAN---QIGKGIARSDVP 215
            I + R         AL RGL  T+ R+    + Y+  YE   +N      K I  S   
Sbjct: 187 LIKESRYEISKVGYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNVSIDSEKSIVNSSNS 246

Query: 216 AWKLCLF----GAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVR---GKNIIQVARLVNAK 268
            W   +     G+  G    +  +P DV K+ MQ   L + +     KN+ +    +   
Sbjct: 247 NWNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKS 306

Query: 269 YGWKSFFKGFGPTMLRAAPANGATFATFEL 298
            G  + + G  P +++ AP+     +T+E+
Sbjct: 307 EGLAALYTGLVPRVIKIAPSCAIMISTYEV 336

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 82/193 (42%), Gaps = 32/193 (16%)

Query: 34  GGMAQVLVGQ---PFDTTKVRLQT---STTPTTAVEVVKKLVKNE-------GLRGFYKG 80
           G +A+VL      P +  + RLQ+   S+  +T   ++K L+K         G +  ++G
Sbjct: 147 GALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIKESRYEISKVGYKALFRG 206

Query: 81  TLTPLVGVGACVSCQFGVNEAMKRFFRGS-SADPHKTLTLP-----QYYICGFVGG---- 130
               L       S  +G  E    F++ + S D  K++         +++  FVGG    
Sbjct: 207 LEITLWRDVPFSSIYWGCYE----FYKSNVSIDSEKSIVNSSNSNWNHFVNSFVGGSFGG 262

Query: 131 VANSFLASPIEHVRIRLQTQTASGTVAE--FKGPLDCINKLRAN---GALMRGLSPTILR 185
              + L  P +  + R+Q    + T+ +   K     +N++R +    AL  GL P +++
Sbjct: 263 AVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLAALYTGLVPRVIK 322

Query: 186 EAQGCATYFLTYE 198
            A  CA    TYE
Sbjct: 323 IAPSCAIMISTYE 335

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/101 (19%), Positives = 41/101 (40%), Gaps = 8/101 (7%)

Query: 14  IDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTT--------AVEVV 65
           ++    +    +   + G+ GG    ++  PFD  K R+Q +   +T          + +
Sbjct: 241 VNSSNSNWNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYL 300

Query: 66  KKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFF 106
            ++ K+EGL   Y G +  ++ +    +      E  KR F
Sbjct: 301 NQMRKSEGLAALYTGLVPRVIKIAPSCAIMISTYEVCKRLF 341

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 78/176 (44%), Gaps = 18/176 (10%)

Query: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA---------VEVVKKLVKNEGLRGF 77
           +L +G A G   +L     D  + RL   +  +           ++V KK +K++G+ G 
Sbjct: 130 NLASGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGL 189

Query: 78  YKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLA 137
           Y+G L  +VG+       FG+ +++K      S +     +    ++ G+V     S  +
Sbjct: 190 YRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGSLEG----SFLASFLLGWVVTTGASTCS 245

Query: 138 SPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRAN---GALMRGLSPTILREAQGC 190
            P++ VR R+     SG   ++ G  DC+ K+ A    G+L +G    ILR   G 
Sbjct: 246 YPLDTVRRRM--MMTSGQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGA 299

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 56.6 bits (135), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 68/281 (24%), Positives = 113/281 (40%), Gaps = 26/281 (9%)

Query: 20  DSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYK 79
           DS   +  L++G A G +  L   P DT K RLQ                 N G +G Y+
Sbjct: 2   DSQMFIASLVSGAAAGTSTDLAFFPIDTLKTRLQAK----------GGFFANGGYKGVYR 51

Query: 80  GTLTPLVGVGACVSCQFGVNEAMKRFFRGSSAD-----PHKTLTLPQYYICGFVGGVANS 134
           G  + +V      S  F   ++MK + R            +T     + +    G ++  
Sbjct: 52  GLGSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSHMVSSSFGEISAC 111

Query: 135 FLASPIEHVRIRLQTQTASGTVAEFKGPLDCIN--KLRANGALMRGLSPTILREAQGCAT 192
            +  P E ++ R QT   + ++   +  L   N   LR N  L RG S TI+RE      
Sbjct: 112 MVRVPAEVIKQRTQTHRTNSSLQTLQALLRNENGEGLRRN--LYRGWSTTIMREIPFTCI 169

Query: 193 YFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNP 252
            F  YE +   +  +   +     W+  + G ++G        PLDV+K+ +   +    
Sbjct: 170 QFPLYEYM-KKRWAEVQGKERAAPWQGSVCGCIAGGIAAAATTPLDVLKTRIMLHH---- 224

Query: 253 VRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATF 293
            +  + + +A+ +  + G K FF G GP  +  + A GA F
Sbjct: 225 -KSVSALHLAKTMLQEEGVKVFFSGVGPRTMWIS-AGGAIF 263

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/63 (23%), Positives = 29/63 (46%)

Query: 44  PFDTTKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMK 103
           P D  K R+       +A+ + K +++ EG++ F+ G     + + A  +   GV E + 
Sbjct: 212 PLDVLKTRIMLHHKSVSALHLAKTMLQEEGVKVFFSGVGPRTMWISAGGAIFLGVYETVH 271

Query: 104 RFF 106
             F
Sbjct: 272 SLF 274

>Kwal_26.7653
          Length = 325

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 70/287 (24%), Positives = 113/287 (39%), Gaps = 49/287 (17%)

Query: 33  AGGMAQ---VLVGQPFDTTKVRLQTSTTPT--------TAVEVVKKLVKNEGLRGFYKGT 81
           AGGMA    V V  P +  K R+Q     +          ++ +K + KNEG+RG  KG 
Sbjct: 30  AGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGL 89

Query: 82  LTPLVGVGACVSCQFGVNEAMKRFFRGS---SADPHKTLTLPQYYICGFVGGVANSFLAS 138
               +        + G  E ++     +   + DPHK   +    + G   G+  + + S
Sbjct: 90  SCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGS 149

Query: 139 PIEHVRIRLQTQTASGTVAEFKGPLDCINKL----RANG--ALMRGLSPTILREAQGC-- 190
           P+  ++ R+Q+ + +  + +        N L    RA G   L RG+   ILR   G   
Sbjct: 150 PLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSV 209

Query: 191 -------ATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVI--K 241
                  A +FL    L+    G  +  S            VSG  + + + P DVI  +
Sbjct: 210 QLPIYNTAKHFLLKHDLMKEGTGLHLVAS-----------TVSGFGVGVVMNPWDVILTR 258

Query: 242 SLMQTDNL-KNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAP 287
              Q  NL K P+     ++  R+     G  + +KGF   + R AP
Sbjct: 259 VYNQKGNLYKGPL--DCFVKTVRI----EGIGALYKGFEAQIFRIAP 299

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 75/183 (40%), Gaps = 21/183 (11%)

Query: 18  PHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQT---------STTPTTAVEVVKKL 68
           PH    V  ++++G   G+   ++G P    K R+Q+          T  T+    +  +
Sbjct: 124 PHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSI 183

Query: 69  VKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKT-LTLPQYYICGF 127
            + EG +G Y+G    ++  GA  S Q  +    K F          T L L    + GF
Sbjct: 184 YRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGF 243

Query: 128 VGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINK---LRANGALMRGLSPTIL 184
             GV    + +P + +  R+  Q  +     +KGPLDC  K   +   GAL +G    I 
Sbjct: 244 GVGV----VMNPWDVILTRVYNQKGN----LYKGPLDCFVKTVRIEGIGALYKGFEAQIF 295

Query: 185 REA 187
           R A
Sbjct: 296 RIA 298

>Scas_489.4
          Length = 297

 Score = 55.8 bits (133), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 118/297 (39%), Gaps = 24/297 (8%)

Query: 15  DQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQ----TSTTPTTAVEVVKKLVK 70
           +++P D    L   +AG   G  +  +  PF+  K RLQ    TST     + ++    K
Sbjct: 4   EKKPVDP---LHSFIAGALAGAIEASITYPFEFAKTRLQLIDKTSTASRNPLVLIYNTAK 60

Query: 71  NEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADP-HKTLTLPQYYICGFVG 129
            +G    Y G    +VG  A    +F   + +K   R    DP    L+ P+  + G   
Sbjct: 61  TQGTGAIYVGCPAFIVGNTAKAGIRFLGFDTIKNMLR----DPVTGELSGPRGVVAGLGA 116

Query: 130 GVANSFLA-SPIEHVRIRL---QTQTASGTVAEFKGPLDCINKLRANGALM---RGLSPT 182
           G+  S +A +P E ++  L   +           +G L     L  +  +M   RG+ P 
Sbjct: 117 GLLESVVAVTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVLPV 176

Query: 183 ILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLF--GAVSGVTLWLTVYPLDVI 240
            +R+A   A     Y  +         A  D P      F  GA SGV    T  P+D +
Sbjct: 177 SMRQAANQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTTMPIDTV 236

Query: 241 KSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
           K+ MQ+    +  +  + +     +  + G K+F+KG  P + R   + G  F  +E
Sbjct: 237 KTRMQS---LDATKYTSTVNCFAKIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYE 290

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 70/267 (26%), Positives = 122/267 (45%), Gaps = 38/267 (14%)

Query: 63  EVVKKLVKNEGLRGFYKG-TLTPLVGVGACVSCQFGVNEAMKRFFRGSS--ADPHKTLTL 119
           E   K+ + EGL   ++G ++T L+ + A V     V  +    FR  S   D + +L  
Sbjct: 102 EAFTKISEVEGLATLWRGLSITLLMAIPANV-----VYFSGYEMFRDHSPMRDSYPSLN- 155

Query: 120 PQYYICGFVGGVANSFLASPIEHVRIRLQT----QTASGTVAEFKGPL-DCINKLRANG- 173
           P +  CG    +  +   +P+E ++ RLQ+    +  + T   FK  L +  N++R+ G 
Sbjct: 156 PLF--CGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSGGY 213

Query: 174 -ALMRGLSPTILREAQGCATYFLTYEALVAN---QIGKGIARSDV-PAWKLCLF----GA 224
             L +GL  T+ R+    A Y+ +YE    N      +   R ++ P W   +     G+
Sbjct: 214 KVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINSFIGGS 273

Query: 225 VSGVTLWLTVYPLDVIKSLMQ-TDNLKNPVRGKNIIQVAR---------LVNAKY--GWK 272
           VSG +  L  +P DV K+ MQ T +++N  R   +    R         L N K   G+ 
Sbjct: 274 VSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQTEGYG 333

Query: 273 SFFKGFGPTMLRAAPANGATFATFELA 299
           + + G  P +++ AP+     +T+EL+
Sbjct: 334 ALYTGLIPRVMKIAPSCAIMISTYELS 360

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/243 (23%), Positives = 87/243 (35%), Gaps = 58/243 (23%)

Query: 110 SADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQT-----ASGTVAEFKGP-- 162
           S D   T  + +  +    G    SF  +P++ VRIRLQ Q      + G  +E KG   
Sbjct: 2   SGDRSSTAIMKERMLSACAGSFLTSFFLTPMDVVRIRLQQQVMLPDCSCGAASELKGSVG 61

Query: 163 --------------------------LDCINK-LRAN---------------GALMRGLS 180
                                     + C N  LR N                 L RGLS
Sbjct: 62  TEVIYDHVVANKNSPKIFWQDVCFQDIQCKNSALRFNSTWEAFTKISEVEGLATLWRGLS 121

Query: 181 PTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVI 240
            T+L        YF  YE    +       R   P+      GA + +    TV PL++I
Sbjct: 122 ITLLMAIPANVVYFSGYEMFRDH----SPMRDSYPSLNPLFCGATARMVAATTVAPLELI 177

Query: 241 KSLMQT-----DNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFAT 295
           K+ +Q+      +    +  K++++  R      G+K  FKG   T+ R  P +   + +
Sbjct: 178 KTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSGGYKVLFKGLEITLWRDVPFSAIYWGS 237

Query: 296 FEL 298
           +E 
Sbjct: 238 YEF 240

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 78/216 (36%), Gaps = 32/216 (14%)

Query: 15  DQQP-HDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQT---STTPTTAVEVVKKLVK 70
           D  P  DS   L  L  G    M       P +  K RLQ+   S   TT   + K L+K
Sbjct: 143 DHSPMRDSYPSLNPLFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLK 202

Query: 71  ---NE----GLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLP--- 120
              NE    G +  +KG    L       +  +G  E  K+ F    ++      L    
Sbjct: 203 ETRNEIRSGGYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNW 262

Query: 121 QYYICGFVGGVAN----SFLASPIEHVRIRLQT-----QTASGTVAEFKGPLDC------ 165
            ++I  F+GG  +    + L  P +  + R+Q           T+   K  +        
Sbjct: 263 DFFINSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKF 322

Query: 166 ---INKLRANGALMRGLSPTILREAQGCATYFLTYE 198
              I +    GAL  GL P +++ A  CA    TYE
Sbjct: 323 LYNIKQTEGYGALYTGLIPRVMKIAPSCAIMISTYE 358

>Kwal_27.11419
          Length = 298

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 83/187 (44%), Gaps = 22/187 (11%)

Query: 122 YYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSP 181
           ++I GFVGG+ ++ +  P + ++ RLQ   +S         LD +  +   G L +G  P
Sbjct: 10  HFIGGFVGGLTSAVILQPFDLLKTRLQQNKSSNL-------LDVVRSIETPGQLWKGTLP 62

Query: 182 TILREAQGCATYFLTY---EALVANQIGKGIARSD--------VPAWKLCLFGAVSGVTL 230
           + LR + G A +  T     + +A++  KGIA  +        +  ++  + GA++   +
Sbjct: 63  SALRTSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAV 122

Query: 231 WLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANG 290
            +   P+ V+K   ++        G+    + R      G +  F G G T++R AP  G
Sbjct: 123 GVATMPITVLKVRFESTMYNYKSLGEAATHIYR----SEGIRGLFSGCGATVMRDAPYAG 178

Query: 291 ATFATFE 297
                +E
Sbjct: 179 LYVLFYE 185

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 67/297 (22%), Positives = 116/297 (39%), Gaps = 41/297 (13%)

Query: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYKGTLTPL- 85
             + G  GG+   ++ QPFD  K RLQ + + +  ++VV+ +   E     +KGTL    
Sbjct: 10  HFIGGFVGGLTSAVILQPFDLLKTRLQQNKS-SNLLDVVRSI---ETPGQLWKGTLPSAL 65

Query: 86  ---VGVGACVSCQFGVNEAM-KRFFRGSSADPHKTLTLPQY-----YICGFVGGVANSFL 136
              VG    +S    V  A+  +  +G +     +  LPQ       I G +   A    
Sbjct: 66  RTSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAVGVA 125

Query: 137 ASPIEHVRIRLQTQTASGTVAEFKGPLDCINKL-RANG--ALMRGLSPTILREAQGCATY 193
             PI  +++R ++     T+  +K   +    + R+ G   L  G   T++R+A     Y
Sbjct: 126 TMPITVLKVRFES-----TMYNYKSLGEAATHIYRSEGIRGLFSGCGATVMRDAPYAGLY 180

Query: 194 FLTYE-------------ALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVI 240
            L YE              +  N+ G    ++      +  F + S  T   +  P D I
Sbjct: 181 VLFYEQSKLQLPRILPVWMVEHNESGVFSTKTSTIINSIAAFSSASLATTITS--PFDTI 238

Query: 241 KSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
           K+ MQ     NP +    IQ  + +      ++ F G    + R A + G  +  +E
Sbjct: 239 KTRMQL----NPSQYYGFIQTFKSIIRYERPRNLFDGLSLRLSRKALSAGIAWGIYE 291

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 71/332 (21%), Positives = 129/332 (38%), Gaps = 43/332 (12%)

Query: 9   LLIDDIDQQPHDSGRVLKDLLAG----TAGGMAQVL---VGQPFDTTKVRLQTSTTPTTA 61
           L  +D+D        ++ D + G     AGG++ V+      PFD  KV L   T  ++ 
Sbjct: 178 LFNEDVDLSSEGDMTLINDFIKGFGFFIAGGISGVISRTCTAPFDRLKVFLIARTDLSST 237

Query: 62  ------------------------VEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFG 97
                                   V+ +  L +  G++ FY G     + V    S +FG
Sbjct: 238 LLNSTEDVLAKNPHAKPNKLRSPLVKAIISLYRQGGIKSFYVGNGLNALKVFPESSIKFG 297

Query: 98  VNEAMKRFF-RGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTV 156
             E  K+   +  +    K L+    +I G + GV   F   PI+ ++ R+Q    +  +
Sbjct: 298 SFEITKKLMTKVENCKDTKDLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAEL 357

Query: 157 AEFKGPLDCINKLRANGAL---MRGLSPTIL----REAQGCATYFLTYEALVANQIGK-G 208
              K  +    ++   G L    RG++  +L      A    T+ +  +  ++++  K  
Sbjct: 358 KGRKLMIQTAKEMYTEGGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLN 417

Query: 209 IARSDVPAWKLCLF--GAVSGVTLWLTVYPLDVIKSLMQTD-NLKNPVRGKNIIQVARLV 265
               DV    L +   GA SG      VYP++++++ +Q      +P R      V    
Sbjct: 418 KKEEDVELSNLVVLPMGAFSGTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKT 477

Query: 266 NAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
             + G+   FKG  PT+ +  PA   ++  +E
Sbjct: 478 IQREGYPGLFKGLVPTLAKVCPAVSISYLCYE 509

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 79/187 (42%), Gaps = 20/187 (10%)

Query: 31  GTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA--------VEVVKKLVKNEGLRGFYKGTL 82
           G AG  AQ  V  P DT K R+Q +  P  A        ++  K++    GL+ FY+G  
Sbjct: 328 GLAGVCAQFSV-YPIDTLKFRMQCA--PLNAELKGRKLMIQTAKEMYTEGGLKLFYRGVT 384

Query: 83  TPLVGVGACVSCQFGVNEAMKRFFRGSSA----DPHKTLTLPQYYIC--GFVGGVANSFL 136
             ++G+    +   G    +K+++  S A       + + L    +   G   G   + +
Sbjct: 385 VGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAFSGTFGATV 444

Query: 137 ASPIEHVRIRLQTQTASGTVAEFKGPLDCINK-LRANG--ALMRGLSPTILREAQGCATY 193
             PI  +R RLQ Q        + G  D + K ++  G   L +GL PT+ +     +  
Sbjct: 445 VYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGYPGLFKGLVPTLAKVCPAVSIS 504

Query: 194 FLTYEAL 200
           +L YE L
Sbjct: 505 YLCYENL 511

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 42/84 (50%), Gaps = 3/84 (3%)

Query: 218 KLCLF--GAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNI-IQVARLVNAKYGWKSF 274
           KL  F  G ++GV    +VYP+D +K  MQ   L   ++G+ + IQ A+ +  + G K F
Sbjct: 320 KLSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAKEMYTEGGLKLF 379

Query: 275 FKGFGPTMLRAAPANGATFATFEL 298
           ++G    +L   P       TF +
Sbjct: 380 YRGVTVGVLGIFPYAALDLGTFSM 403

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 76/284 (26%), Positives = 120/284 (42%), Gaps = 29/284 (10%)

Query: 28  LLAGTAGGMAQVLVGQPFDTTKVRLQTSTTP-TTAVEVVKKLVKNEGLRGFYKG--TLTP 84
           LL   + G+ ++ V  P DT   RL ++ T  T+  ++   + ++     F K   TL P
Sbjct: 14  LLGSASAGILEIGVFHPVDTISKRLMSNHTKITSGAQLNSVIFRDHAAEAFGKRVFTLFP 73

Query: 85  LVGVGACVSC-----QFG----VNEAMKRFFRGS--SADPHKTLTLPQYYICGFVGGVAN 133
            +G  A         ++G     NE + + F+    SA   KT    +    G + G+  
Sbjct: 74  GLGYAAVYKILQRVYKYGGQPFANEFLNKHFKKDFDSAFGDKTGKALRSATAGSLIGIGE 133

Query: 134 SFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGA--LMRGLSPTILREAQGCA 191
             L  P++ ++I+ QT   +     FKG    +  L+  G   L RG   T  R A G  
Sbjct: 134 IVLL-PLDVLKIKRQTNPEA-----FKGR-GFLKILKDEGIFNLYRGWGWTAARNAPG-- 184

Query: 192 TYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVY-PLDVIKSLMQTDNLK 250
           ++ L      A +   G+       W      ++ G +  L V  PLDVIK+ +Q  N  
Sbjct: 185 SFALFGGNAFAKEYILGLQDYSQATWSQNFISSIVGASASLIVSAPLDVIKTRIQNRNFD 244

Query: 251 NPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFA 294
           NP  G  I++   L N   G+ +FFKG  P +L   P    +FA
Sbjct: 245 NPESGFKIVK-NTLKNE--GFTAFFKGLTPKLLTTGPKLVFSFA 285

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 2/79 (2%)

Query: 26  KDLLAGTAGGMAQVLVGQPFDTTKVRLQTST--TPTTAVEVVKKLVKNEGLRGFYKGTLT 83
           ++ ++   G  A ++V  P D  K R+Q      P +  ++VK  +KNEG   F+KG   
Sbjct: 212 QNFISSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFKIVKNTLKNEGFTAFFKGLTP 271

Query: 84  PLVGVGACVSCQFGVNEAM 102
            L+  G  +   F + +++
Sbjct: 272 KLLTTGPKLVFSFALAQSL 290

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 81/348 (23%), Positives = 139/348 (39%), Gaps = 55/348 (15%)

Query: 3   EETSSPLLIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQT-------- 54
           E T  PL +   + + H + +     +AG  GGMA  +V  PFD  K RLQ+        
Sbjct: 31  EATQIPLNLKQSEIENHPTVKPWVHFVAGGIGGMAGAVVTCPFDLVKTRLQSDIFLKAYK 90

Query: 55  ---------STTPTTAVEVVK-------------KLVKNEGLRGFYKGTLTPLVGVGACV 92
                    ST P +   V++              + K EG R  +KG    LVGV    
Sbjct: 91  SQAVNISKGSTRPKSINYVIQAGTHFKETLGIIGNVYKQEGFRSLFKGLGPNLVGVIPAR 150

Query: 93  SCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTA 152
           S  F      K  +  +  +  +T  +  + +     G A +   +PI  ++ R+Q   A
Sbjct: 151 SINFFTYGTTKDMYAKAFNNGQETPMI--HLMAAATAGWATATATNPIWLIKTRVQLDKA 208

Query: 153 SGT-VAEFKGPLDCINK-LRANG--ALMRGLSPTILREAQGCATYFLTYEALVANQIGKG 208
             T V ++K   DC+   +R  G   L +GLS + L   +G   + L YE +      + 
Sbjct: 209 GKTSVRQYKNSWDCLKSVIRNEGFTGLYKGLSASYLGSVEGILQWLL-YEQMKRLIKERS 267

Query: 209 IAR------------SDVPAWKLCLFGAVSGVTLW---LTVYPLDVIKS-LMQTDNLKNP 252
           I +              V  W  C     +G+  +   +  YP +V+++ L QT      
Sbjct: 268 IEKFGYQAEGTKSTSEKVKEW--CQRSGSAGLAKFVASIATYPHEVVRTRLRQTPKENGK 325

Query: 253 VRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAM 300
            +   ++Q  +++  + G  S + G  P ++R  P +   F T+E+ +
Sbjct: 326 RKYTGLVQSFKVIIKEEGLFSMYSGLTPHLMRTVPNSIIMFGTWEIVI 373

>Kwal_26.7972
          Length = 358

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/313 (20%), Positives = 119/313 (38%), Gaps = 54/313 (17%)

Query: 28  LLAGTAGGMAQVLVGQPFDTTKVRLQTST--------TPTTAVEVVKKLVKNEGLRGFYK 79
           L  G AG  A+ L+  P D  K+  QTS         +    +     +  ++G+RGFY+
Sbjct: 32  LAGGIAGSCAKTLIA-PLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFYQ 90

Query: 80  GTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASP 139
           G    L+ +    + +F   E ++ F   S     +  T  +    G + G+ + F+  P
Sbjct: 91  GHSATLIRIFPYAAIKFIAYEQIRHFMIPSK----EYETHARRLASGSMAGLCSVFMTYP 146

Query: 140 IEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGAL----------------MRGLSPTI 183
           ++ +R+RL   T    +      +  I   RA+ +L                 RG +PT+
Sbjct: 147 LDLIRVRLAYVTDRSRIKMLP-VIKQIYTERASESLTSKSYVPRWFAHWCNFYRGFTPTV 205

Query: 184 LREAQGCATYFLTYE---------ALVANQI-----------GKGIARSDVPAWKLCLFG 223
           L         F  ++         AL    +            K  +   +  W   + G
Sbjct: 206 LGMIPYAGVSFFAHDLCGDILRSGALSPYSVLPISDEELTIRSKKQSSRPLKTWAELVAG 265

Query: 224 AVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKN---IIQVARLVNAKYGWKSFFKGFGP 280
            ++G+      YP ++I+  +Q  ++ +P    N   I  + R++  + GW+ FF G   
Sbjct: 266 GLAGMASQTASYPFEIIRRRLQV-SVVSPTSIHNFQTIPDMIRIIYKERGWRGFFVGLSI 324

Query: 281 TMLRAAPANGATF 293
             ++  P    +F
Sbjct: 325 GYIKVTPMVACSF 337

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 46/100 (46%), Gaps = 13/100 (13%)

Query: 21  SGRVLK---DLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAV-------EVVKKLVK 70
           S R LK   +L+AG   GMA      PF+  + RLQ S    T++       ++++ + K
Sbjct: 252 SSRPLKTWAELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDMIRIIYK 311

Query: 71  NEGLRGFYKGTLTPLVGVGACVSCQF---GVNEAMKRFFR 107
             G RGF+ G     + V   V+C F     NE +  + R
Sbjct: 312 ERGWRGFFVGLSIGYIKVTPMVACSFFRLRKNEVVSEYLR 351

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 80/194 (41%), Gaps = 24/194 (12%)

Query: 126 GFVGGVANSF---LASPIEHVRIRLQTQT-----ASGTVAEFKGPLDCINKLRANGALMR 177
           G  GG+A S    L +P++ ++I  QT        SG+          IN         +
Sbjct: 31  GLAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFYQ 90

Query: 178 GLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPL 237
           G S T++R     A  F+ YE +    I       +  A +L   G+++G+      YPL
Sbjct: 91  GHSATLIRIFPYAAIKFIAYEQIRHFMIPS--KEYETHARRLAS-GSMAGLCSVFMTYPL 147

Query: 238 DVIKSLMQTDNLKNPVRGKNIIQ-------VARLVNAKY------GWKSFFKGFGPTMLR 284
           D+I+  +     ++ ++   +I+          L +  Y       W +F++GF PT+L 
Sbjct: 148 DLIRVRLAYVTDRSRIKMLPVIKQIYTERASESLTSKSYVPRWFAHWCNFYRGFTPTVLG 207

Query: 285 AAPANGATFATFEL 298
             P  G +F   +L
Sbjct: 208 MIPYAGVSFFAHDL 221

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 80/299 (26%), Positives = 123/299 (41%), Gaps = 37/299 (12%)

Query: 18  PHDSGRV--LKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNE--- 72
           PH   +   L  LL   + G+ ++ V  P DT   RL ++ T  T+ + + +++  +   
Sbjct: 2   PHTDKKQSGLARLLGSASAGIMEIAVFHPVDTISKRLMSNHTKITSGQELNRVIFRDHFS 61

Query: 73  ---GLRGFYKGTLTPLVGVGACVSC-----QFG----VNEAMKRFFRGSSAD--PHKTLT 118
              G R F   TL P +G  A         ++G     NE + + ++    +    KT  
Sbjct: 62  EPLGKRLF---TLFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGK 118

Query: 119 LPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANG--ALM 176
             +    G + G+    L  P++ ++I+ QT   S     FKG    I  LR  G   L 
Sbjct: 119 AMRSAAAGSLIGIGEIVLL-PLDVLKIKRQTNPES-----FKGR-GFIKILRDEGLFNLY 171

Query: 177 RGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVY- 235
           RG   T  R A G  ++ L      A +   G+       W      ++ G    L V  
Sbjct: 172 RGWGWTAARNAPG--SFALFGGNAFAKEYILGLKDYSQATWSQNFISSIVGACSSLIVSA 229

Query: 236 PLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFA 294
           PLDVIK+ +Q  N  NP  G  I++   L N   G  +FFKG  P +L   P    +FA
Sbjct: 230 PLDVIKTRIQNRNFDNPESGLRIVKNT-LKNE--GVTAFFKGLTPKLLTTGPKLVFSFA 285

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 40/79 (50%), Gaps = 2/79 (2%)

Query: 26  KDLLAGTAGGMAQVLVGQPFDTTKVRLQTST--TPTTAVEVVKKLVKNEGLRGFYKGTLT 83
           ++ ++   G  + ++V  P D  K R+Q      P + + +VK  +KNEG+  F+KG   
Sbjct: 212 QNFISSIVGACSSLIVSAPLDVIKTRIQNRNFDNPESGLRIVKNTLKNEGVTAFFKGLTP 271

Query: 84  PLVGVGACVSCQFGVNEAM 102
            L+  G  +   F + +++
Sbjct: 272 KLLTTGPKLVFSFALAQSL 290

>Scas_721.129
          Length = 323

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 68/278 (24%), Positives = 111/278 (39%), Gaps = 31/278 (11%)

Query: 33  AGGMAQ---VLVGQPFDTTKVRLQTSTTPTTAVEVVKK--------LVKNEGLRGFYKGT 81
           AGGMA    V    P +  K+R+Q         + V +        + +NEG+RG  KG 
Sbjct: 27  AGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRNEGIRGLQKGL 86

Query: 82  LTPLVGVGACVSCQFGVNEAMKRFFRGS---SADPHKTLTLPQYYICGFVGGVANSFLAS 138
           +   +        + G  E ++     +   + + HK   +      G   G+  + + S
Sbjct: 87  VAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSINVAAGASSGIIGAVIGS 146

Query: 139 PIEHVRIRLQTQTASGTVAEFKGPLDCINKL----RANG--ALMRGLSPTILREAQGCAT 192
           P+  V+ R+Q+ + +  + E     +  N L    R  G   L RG+   ILR   G + 
Sbjct: 147 PLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRGIDAAILRTGAGSSV 206

Query: 193 YFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLM--QTDNL- 249
               Y     N + K     D P   L     +SG+ + + + P DVI + +  Q  NL 
Sbjct: 207 QLPIYNT-AKNFLLKNDLMKDGPGLHLTA-STISGLGVAVVMNPWDVILTRIYNQKGNLY 264

Query: 250 KNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAP 287
           K PV     ++  R      G  + +KGF   +LR AP
Sbjct: 265 KGPV--DCFVKTVR----TEGISALYKGFQAQILRIAP 296

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 79/186 (42%), Gaps = 21/186 (11%)

Query: 15  DQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEV---------V 65
           +++ H   +V  ++ AG + G+   ++G P    K R+Q+ +      E          +
Sbjct: 118 NEESHKIQKVSINVAAGASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGL 177

Query: 66  KKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRF-FRGSSADPHKTLTLPQYYI 124
             + + EG +G ++G    ++  GA  S Q  +    K F  +         L L    I
Sbjct: 178 STIARTEGFKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLKNDLMKDGPGLHLTASTI 237

Query: 125 CGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINK-LRANG--ALMRGLSP 181
            G   GVA   + +P + +  R+  Q  +     +KGP+DC  K +R  G  AL +G   
Sbjct: 238 SGL--GVA--VVMNPWDVILTRIYNQKGN----LYKGPVDCFVKTVRTEGISALYKGFQA 289

Query: 182 TILREA 187
            ILR A
Sbjct: 290 QILRIA 295

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 73/333 (21%), Positives = 129/333 (38%), Gaps = 45/333 (13%)

Query: 9   LLIDDIDQQPHDSGRVLKDLLAG----TAGGMAQVL---VGQPFDTTKV----RLQTSTT 57
           L  +D+D        ++ D + G     AGG + V+      PFD  KV    R   S+T
Sbjct: 173 LFNEDVDLSSEGDVTLINDFIRGFGFFIAGGCSGVISRTCTAPFDRIKVFLIARTDLSST 232

Query: 58  ------------PTTAVEVVKK--------LVKNEGLRGFYKGTLTPLVGVGACVSCQFG 97
                       P   +  +K         L +  G+R FY G    ++ V    + +FG
Sbjct: 233 LLNSKDKVLMKNPNADISKIKSPLIKAATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFG 292

Query: 98  VNEAMKRFFRGSSADPHKTLTLPQY--YICGFVGGVANSFLASPIEHVRIRLQTQTASGT 155
             E  K+         H T  L ++  YI G +GGV   F   PI+ ++ R+Q       
Sbjct: 293 SFELAKQLM-AHLEGVHHTSELSKFSTYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTA 351

Query: 156 VAEFKGPLDCINKLRANGAL---MRGLSPTILREAQGCATYFLTYEALVANQIGKGIARS 212
           +   +  +    ++  +G L    RG++  ++      A    T+ AL    I +    +
Sbjct: 352 LKGNELLISTARQMYRDGGLKLFYRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMT 411

Query: 213 DVPAWKLCL-------FGAVSGVTLWLTVYPLDVIKSLMQTD-NLKNPVRGKNIIQVARL 264
            VP  ++ +        GA SG      VYP++++++ +Q      +P        V   
Sbjct: 412 GVPVDQVTISNFIVLPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWK 471

Query: 265 VNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
              + G++  FKG  P + +  PA   ++  +E
Sbjct: 472 TVQREGYQGLFKGLVPNLAKVCPAVSISYLCYE 504

 Score = 32.3 bits (72), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 35/83 (42%), Gaps = 6/83 (7%)

Query: 31  GTAGGMAQVLVGQPFDTTKVRLQ---TSTTPTTAV---EVVKKLVKNEGLRGFYKGTLTP 84
           G   G     V  P +  + RLQ   T   P T     +V+ K V+ EG +G +KG +  
Sbjct: 429 GAFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLVPN 488

Query: 85  LVGVGACVSCQFGVNEAMKRFFR 107
           L  V   VS  +   E  KR  +
Sbjct: 489 LAKVCPAVSISYLCYENFKRLMK 511

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 75/305 (24%), Positives = 130/305 (42%), Gaps = 47/305 (15%)

Query: 19  HDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNEGLRGFY 78
             +G V   L++G  GG+A V   QP D  K RLQ +    +++  V + V+    R  +
Sbjct: 3   EKAGGVPAHLVSGFFGGLASVCALQPLDLLKTRLQQAQ--ASSLRSVLREVRTT--RELW 58

Query: 79  KGTLTPLV--GVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLP-----QYYICGFVGGV 131
           +GTL   +   +G+ +     +N +     RGS A    +L LP     Q  + G +   
Sbjct: 59  RGTLPSALRTSIGSALYLSL-LNYSRSALARGSEARTRSSL-LPRLQSYQNLLTGALSRA 116

Query: 132 ANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKL-RANGA--LMRGLSPTILREAQ 188
           A   +  PI  +++R ++     T+  + G  +    + R+ GA    +G + T LR+A 
Sbjct: 117 AVGLVTMPITVIKVRYES-----TLYAYNGLAEATRHIWRSEGARGFFKGAAATTLRDAP 171

Query: 189 GCATYFLTYE--------ALVANQIGKGIA-RSDVPAWKLCLFGAVSGVTLWLTVY---- 235
               Y L YE        AL A  +G   + +   PA  +     V+GV+ +L+      
Sbjct: 172 YAGLYVLLYEQAKEMLPRALPATLLGADESGKLTAPASAM-----VNGVSAFLSASLATT 226

Query: 236 ---PLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGAT 292
              P D IK+ MQ  +  +PV     +Q  R +  +   ++ F G    + R A +    
Sbjct: 227 LTAPFDTIKTRMQLQS--HPV---GFVQTLRHIVCEERARTLFDGLSLRLCRKAMSACIA 281

Query: 293 FATFE 297
           +  +E
Sbjct: 282 WGIYE 286

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 4/65 (6%)

Query: 44  PFDTTKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYKGTLTPLV--GVGACVSCQFGVNEA 101
           PFDT K R+Q  + P   V+ ++ +V  E  R  + G    L    + AC++  +G+ E 
Sbjct: 230 PFDTIKTRMQLQSHPVGFVQTLRHIVCEERARTLFDGLSLRLCRKAMSACIA--WGIYEE 287

Query: 102 MKRFF 106
           + +  
Sbjct: 288 LLKLL 292

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 82/189 (43%), Gaps = 20/189 (10%)

Query: 31  GTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA---------VEVVKKLVKNEGLRGFYKGT 81
           G AGG++ + V    D  + RL      +           V+V KK + ++G+ G Y+G 
Sbjct: 123 GIAGGLSLMFV-YSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGLYRGF 181

Query: 82  LTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIE 141
           L  ++G+       FG+ ++ K      S +     +    ++ G+V     S  + P++
Sbjct: 182 LPSVIGIVVYRGLYFGLYDSCKPLLLTGSLEG----SFIASFLLGWVVTTGASTASYPLD 237

Query: 142 HVRIRLQTQTASGTVAEFKGPLDCINKLRAN---GALMRGLSPTILREAQGCATYFLTYE 198
            VR R+     SG   ++KG +DC+ K+ A     +L +G    ILR   G     L Y+
Sbjct: 238 TVRRRM--MMTSGQAVKYKGAMDCLQKIVAAEGVSSLFKGCGANILRGVAGAGVISL-YD 294

Query: 199 ALVANQIGK 207
            L     GK
Sbjct: 295 QLQMILFGK 303

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 80/186 (43%), Gaps = 21/186 (11%)

Query: 15  DQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQT---------STTPTTAVEVV 65
           DQ+PH    V  ++ +G A G+   ++G P    K RLQ+          T  T     +
Sbjct: 119 DQEPHKVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGL 178

Query: 66  KKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGV-NEAMKRFFRGSSADPHKTLTLPQYYI 124
             + K EG++G ++G    ++  GA  S Q  + N A     +         L L    I
Sbjct: 179 VTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTI 238

Query: 125 CGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINK-LRANG--ALMRGLSP 181
            G   GVA   + +P + +  R+  Q        +KGP+DC+ K +R  G  AL +G + 
Sbjct: 239 SGL--GVA--VVMNPWDVILTRIYNQKGD----LYKGPIDCLVKTVRIEGVTALYKGFAA 290

Query: 182 TILREA 187
            + R A
Sbjct: 291 QVFRIA 296

>Scas_718.24
          Length = 337

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 77/172 (44%), Gaps = 19/172 (11%)

Query: 31  GTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA---------VEVVKKLVKNEGLRGFYKGT 81
           G AGG++ + V    D  + RL   +  +           ++V KK +K++G+ G Y+G 
Sbjct: 154 GAAGGLSLLFV-YSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGF 212

Query: 82  LTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIE 141
           L  +VG+       FG+ +++K      S +     +    ++ G+V     S  + P++
Sbjct: 213 LPSVVGIIVYRGLYFGLYDSIKPVLLTGSLEG----SFLASFLLGWVVTTGASTCSYPLD 268

Query: 142 HVRIRLQTQTASGTVAEFKGPLDCINKLRAN---GALMRGLSPTILREAQGC 190
            VR ++     SG   ++KG  DC  K+ A     +L +G    ILR   G 
Sbjct: 269 TVRRKM--MMTSGQAVKYKGAFDCFKKIVAAEGVASLFKGCGANILRGVAGA 318

>Kwal_27.11626
          Length = 299

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 77/286 (26%), Positives = 119/286 (41%), Gaps = 34/286 (11%)

Query: 28  LLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNE------GLRGFYKGT 81
           +L   + G+ ++ V  P DT   RL ++ T  ++   +  ++  E      G R F   T
Sbjct: 13  VLGSASAGILEIGVFHPVDTVSKRLMSNHTKISSSAQLNSVIFREHAGEALGKRLF---T 69

Query: 82  LTPLVGVGACVSC-----QFG----VNEAMKRFFRGS--SADPHKTLTLPQYYICGFVGG 130
           L P +G  A         ++G     NE + + F+    +A   KT    +    G + G
Sbjct: 70  LFPGLGYAASYKILQRVYKYGGQPFANEFLNKNFKADFDNAFGEKTGKALRSATAGSLIG 129

Query: 131 VANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANG-ALMRGLSPTILREAQG 189
           +    L  P++ ++I+ QT   S     FKG    I  L+  G  L RG   T  R A G
Sbjct: 130 IGEIVLL-PLDVLKIKRQTNPES-----FKGR-GFIKILKDEGFGLYRGWGWTAARNAPG 182

Query: 190 CATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVY-PLDVIKSLMQTDN 248
             ++ L      A +   G+       W      ++ G +  L V  PLDVIK+ +Q  +
Sbjct: 183 --SFALFGGNAFAKEYILGLKDYSSATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRH 240

Query: 249 LKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFA 294
             NP  G  I+Q   L N   G  +FFKG  P +L   P    +FA
Sbjct: 241 FDNPESGFRIVQNT-LKNE--GITAFFKGLTPKLLTTGPKLVFSFA 283

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 39/79 (49%), Gaps = 2/79 (2%)

Query: 26  KDLLAGTAGGMAQVLVGQPFDTTKVRLQTS--TTPTTAVEVVKKLVKNEGLRGFYKGTLT 83
           ++ ++   G  A ++V  P D  K R+Q      P +   +V+  +KNEG+  F+KG   
Sbjct: 210 QNFVSSIVGASASLIVSAPLDVIKTRIQNRHFDNPESGFRIVQNTLKNEGITAFFKGLTP 269

Query: 84  PLVGVGACVSCQFGVNEAM 102
            L+  G  +   F + +++
Sbjct: 270 KLLTTGPKLVFSFALAQSL 288

>Scas_645.9
          Length = 391

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/263 (22%), Positives = 114/263 (43%), Gaps = 35/263 (13%)

Query: 62  VEVVKKLVKNEGLRGFYKG-TLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLP 120
           +E   K+ K EG+   ++G ++  L+ + A +    G       + R +S     + T  
Sbjct: 133 LEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGY-----EYLRDNSPLATSSPTF- 186

Query: 121 QYYICGFVGGVANSFLASPIEHVRIRLQT-QTASGTVAEFKGPLDCINKLR-------AN 172
              +CG +  +  +   +P+E ++ +LQ+    S +   +    + + + R       A+
Sbjct: 187 NPLMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETRQEMRISGAS 246

Query: 173 GALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLF------GAVS 226
            AL +GL  T+ R+    A Y+ +YE      +    ++S      L  F      G++S
Sbjct: 247 NALFKGLEITLWRDVPFSAIYWGSYE-FCKTHLWMDTSKSHS---NLTFFINSFIGGSIS 302

Query: 227 GVTLWLTVYPLDVIKSLMQT----DNLKNPVRG------KNIIQVARLVNAKYGWKSFFK 276
           G    L  +P DV K+  Q     +N K+ V+       KN+ +  R +    GW + + 
Sbjct: 303 GTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWKLEGWGALYT 362

Query: 277 GFGPTMLRAAPANGATFATFELA 299
           G  P M++ AP+     +++EL+
Sbjct: 363 GLVPRMVKIAPSCAIMISSYELS 385

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 64/289 (22%), Positives = 100/289 (34%), Gaps = 83/289 (28%)

Query: 75  RGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANS 134
           R  +K  L P   +    SC            R  S +    LTL Q  +    G +  S
Sbjct: 3   RTRFKQNLDPESNLFLLESCN-----------RAMSTNATDGLTLHQRMLSASTGSLLTS 51

Query: 135 FLASPIEHVRIRLQTQ-----------------------------TASGTVAE------- 158
              +P++ VRIRLQ Q                             + + T++        
Sbjct: 52  LTLTPMDVVRIRLQQQELLPDCSCETIAVKDFLPKAKTDLSSVQVSRAATISTGNKNKVF 111

Query: 159 FKGP----LDCIN-KLRANG---------------ALMRGLSPTILREAQGCATYFLTYE 198
           +  P    L+C N  +R NG                L RG+S  +L        YF  YE
Sbjct: 112 WDNPCFQELNCKNSSVRFNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYE 171

Query: 199 ALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQ---------TDNL 249
            L  N     +A S  P +   + GA++ +    TV PL+++K+ +Q         T  +
Sbjct: 172 YLRDNS---PLATSS-PTFNPLMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWM 227

Query: 250 KNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFEL 298
                 K   Q  R+  A     + FKG   T+ R  P +   + ++E 
Sbjct: 228 MVKELLKETRQEMRISGAS---NALFKGLEITLWRDVPFSAIYWGSYEF 273

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 34/99 (34%), Gaps = 15/99 (15%)

Query: 25  LKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVK-----------KLVKN-- 71
           +   + G+  G    LV  PFD  K R Q S        VVK           K ++N  
Sbjct: 293 INSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIW 352

Query: 72  --EGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRG 108
             EG    Y G +  +V +    +      E  KR F  
Sbjct: 353 KLEGWGALYTGLVPRMVKIAPSCAIMISSYELSKRLFNA 391

>Kwal_14.2210
          Length = 315

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 64/287 (22%), Positives = 111/287 (38%), Gaps = 25/287 (8%)

Query: 31  GTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA----VEVVKKLVKNEGLRGFYKGTLTPLV 86
           G AG +++ +V  PF+  K+ LQ  ++           VK++   EG+ G  +G     +
Sbjct: 25  GIAGAVSRTVV-SPFERVKILLQVQSSTHAYNHGLFRAVKQVYLEEGVPGLLRGNGLNCI 83

Query: 87  GVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIR 146
            +    + QF V E  K+  +    +P   +      + G + G  +     P++ VR R
Sbjct: 84  RIFPYSAVQFLVYEFCKK--QWFQQNPDTVVLNWHRLVSGALCGGCSVLATYPLDLVRTR 141

Query: 147 LQTQTAS------GTVAEFKGPLDCINKLRANG-------ALMRGLSPTILREAQGCATY 193
           L  QTA+         A    P      LR           L RG+ PT +      A  
Sbjct: 142 LSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIGVVPYVALN 201

Query: 194 FLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPV 253
           F  YE L    I      +    +KL + GA+SG       YP D+++   Q   +    
Sbjct: 202 FAVYEQL-REYIPASFDPASASLYKLSI-GAISGGVAQTITYPFDLLRRRFQVLAMGQSE 259

Query: 254 RG---KNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
            G   K++      +    G+K ++KG    + +  P+   ++  +E
Sbjct: 260 LGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKVVPSTAVSWVVYE 306

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 75/194 (38%), Gaps = 24/194 (12%)

Query: 28  LLAGTAGGMAQVLVGQPFDTTKVRLQTSTT---------------PTTAVEVVKKLVKNE 72
           L++G   G   VL   P D  + RL   T                P    E+++K    E
Sbjct: 118 LVSGALCGGCSVLATYPLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQE 177

Query: 73  G-LRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGV 131
           G + G Y+G     +GV   V+  F V E ++ +   +S DP  + +L +  I    GGV
Sbjct: 178 GGIFGLYRGVWPTSIGVVPYVALNFAVYEQLREYI-PASFDP-ASASLYKLSIGAISGGV 235

Query: 132 ANSFLASPIEHVRIRLQTQTASGTVAEFK-----GPLDCINKLRANGALMRGLSPTILRE 186
           A + +  P + +R R Q      +   F        L  I +        +GL+  + + 
Sbjct: 236 AQT-ITYPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKV 294

Query: 187 AQGCATYFLTYEAL 200
               A  ++ YE +
Sbjct: 295 VPSTAVSWVVYETV 308

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 75/189 (39%), Gaps = 17/189 (8%)

Query: 123 YICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGA---LMRGL 179
           +  G + G  +  + SP E V+I LQ Q  S T A   G    + ++        L+RG 
Sbjct: 21  FCAGGIAGAVSRTVVSPFERVKILLQVQ--SSTHAYNHGLFRAVKQVYLEEGVPGLLRGN 78

Query: 180 SPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDV 239
               +R     A  FL YE     Q  +    + V  W   + GA+ G    L  YPLD+
Sbjct: 79  GLNCIRIFPYSAVQFLVYE-FCKKQWFQQNPDTVVLNWHRLVSGALCGGCSVLATYPLDL 137

Query: 240 IKSLM--QTDNLKNPVRGKNIIQ-----VARLVNAKY----GWKSFFKGFGPTMLRAAPA 288
           +++ +  QT NL    + K         V  L+   Y    G    ++G  PT +   P 
Sbjct: 138 VRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIGVVPY 197

Query: 289 NGATFATFE 297
               FA +E
Sbjct: 198 VALNFAVYE 206

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 40/95 (42%), Gaps = 9/95 (9%)

Query: 21  SGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLV--------KNE 72
           S  + K  +   +GG+AQ +   PFD  + R Q      + +    K V        + E
Sbjct: 220 SASLYKLSIGAISGGVAQTIT-YPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGRTE 278

Query: 73  GLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFR 107
           G +G+YKG    L  V    +  + V E ++ + +
Sbjct: 279 GFKGYYKGLTANLFKVVPSTAVSWVVYETVRDYMQ 313

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 70/301 (23%), Positives = 116/301 (38%), Gaps = 44/301 (14%)

Query: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVE----VVKKLVKNEGLRGFYKGTL 82
            ++AG+  G+   +   P DT K+R Q         +     V+ ++K EGLR  +KG +
Sbjct: 21  SVIAGSVSGVFARMATAPMDTVKIRYQLQPVQEDKYKGIASTVRTIMKEEGLRALWKGNI 80

Query: 83  TPLVGVGACVSCQFGV-----NEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLA 137
                     + QFG      N    +F R S     +TLT+      G + G+ +S ++
Sbjct: 81  PATAMYVVYGAVQFGSYSWFNNVWSAKFPRFSQQG--QTLTV------GALAGMTSSVVS 132

Query: 138 SPIEHVRIRLQTQTASG--TVAEFKGPLDCINKLRANGA--LMRGLSPTILREAQGCATY 193
            P++ +R RL     S   +VAE     +C       G      G+S  +       A  
Sbjct: 133 YPLDLLRTRLIANRTSHRTSVAE-----ECRQMWLNEGVRGFFTGISTAMTTVTLSTAIM 187

Query: 194 FLTYEA--LVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKN 251
           FLTYE   +V     K      V A    + G VS       V+P+D ++  MQ  N K 
Sbjct: 188 FLTYETVNIVCENHEKEFWSRPVSASSGIIAGFVSKT----MVFPIDTLRRRMQVMNSKR 243

Query: 252 PV------------RGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELA 299
            V            R K+   +   +  + G  + ++G    + ++ P    +   +E  
Sbjct: 244 TVHFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALYRGLTMGLCKSVPTTAISLFVYERT 303

Query: 300 M 300
           M
Sbjct: 304 M 304

>Scas_702.10
          Length = 302

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/276 (22%), Positives = 107/276 (38%), Gaps = 19/276 (6%)

Query: 31  GTAGGMAQVLVGQPFDTTKVRLQTSTTPT-TAVEVVKKLVKNEGLRGFYKGTLTPLVGVG 89
           G A G+   ++  P D  KVRLQ +  P  T   ++  +++NE + G Y G    ++   
Sbjct: 16  GGAAGIFACVMTHPLDLAKVRLQAAPLPKPTLGRMLTTILRNENVMGLYSGLSAAVLRQC 75

Query: 90  ACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQT 149
              + +FG  + MK               LP     G +GG+  +F     + V IR+Q 
Sbjct: 76  TYTTVRFGAYDLMKENLIPQGHINDMVYLLPCSMFSGAIGGLVGNF----ADVVNIRMQN 131

Query: 150 QTA--SGTVAEFKGPLDCINKLRAN----GALMRGLSPTILREAQGCATYFLTYEALVAN 203
            +A        ++  +D + K+  +      L+ G  P ++R     A+  +TY+     
Sbjct: 132 DSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVRGVLMTASQVVTYDVFKNY 191

Query: 204 QIGKGIARSDVPAWKLCLFGA--VSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQV 261
            + K    S  P        A  ++G+       P DVIK+ +      +    ++ I++
Sbjct: 192 LVTK---LSFDPKKNSTHLSASLLAGLVATTICSPADVIKTRIMN---AHKTESESAIKI 245

Query: 262 ARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
                 K G    F+G+ P   R  P     F   E
Sbjct: 246 LTSAIKKEGPSFMFRGWLPIFTRLGPFTMLIFFAIE 281

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 72/294 (24%), Positives = 118/294 (40%), Gaps = 35/294 (11%)

Query: 25  LKDLLAGTAGGMAQVLVGQPFDTTKVRLQ----TSTTPTTAVEVVKKLVKNEGLRGFYKG 80
               LAG+  G  +  +  PF+  K RLQ     S      + ++    KN G+   Y G
Sbjct: 91  FHSFLAGSIAGAIEASITYPFEFAKTRLQLVDKASKASRNPLVLIYNTGKNYGISSIYVG 150

Query: 81  TLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQY--YICGFVGGVANSFLA- 137
               +VG  A    +F   + +K   R       KT  L  +   + G   G+  S +A 
Sbjct: 151 CPAFIVGNTAKAGIRFLGFDTIKNLLR-----DKKTGELSGFRGVVAGLGAGLLESVVAV 205

Query: 138 SPIEHVRIRLQTQTASGTVAEF----KGPLDCINKLRAN---GALMRGLSPTILREAQGC 190
           +P E ++  L        V ++    KG +    KL ++     L RG+ P  +R+A   
Sbjct: 206 TPFEAIKTAL-IDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQAANQ 264

Query: 191 ATYFLTYEALVANQIGKGIA-RSDVPAWK------LCLFGAVSGVTLWLTVYPLDVIKSL 243
           A     Y     N+I   +   ++VP  K        + GA SG+    T  P+D +K+ 
Sbjct: 265 AVRLGCY-----NKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTTMPIDTVKTR 319

Query: 244 MQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
           MQ+    N  +  + I     +  + G K+F+KG  P + R   + G  F  +E
Sbjct: 320 MQS---LNAGQYSSTINCFATIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYE 370

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 68/327 (20%), Positives = 119/327 (36%), Gaps = 59/327 (18%)

Query: 24  VLKDLLAG-TAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNEG--------L 74
           +LK  LAG  AG  A+ L+  P D  K+  QTS           + + N G        L
Sbjct: 53  ILKSGLAGGVAGSCAKTLIA-PLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRL 111

Query: 75  RGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYIC-GFVGGVAN 133
           RG ++G    L+ +    + +F   E ++         P K        +C G + G+ +
Sbjct: 112 RGVFQGHSATLLRIFPYAAVKFIAYEQIRNVI-----IPSKEYETHFRRLCSGSLAGLCS 166

Query: 134 SFLASPIEHVRIRLQ--------------TQTASGTVAEFKGPLDCINKLRANGA-LMRG 178
            F   P++ +R+RL                Q  S   +E       + K  A      RG
Sbjct: 167 VFCTYPLDLIRVRLAYVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPKWFAQWCNFYRG 226

Query: 179 LSPTILREAQGCATYFLT---------------YEALVANQIGKGIARSDVPA------- 216
             PT++         F                 Y  L  + +     + DV         
Sbjct: 227 YIPTVIGMIPYAGVSFFAHDLFHDILRHPVIAPYSVLRVDDLDADDLKVDVQTTRTGKRI 286

Query: 217 ----WKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGK--NIIQVARLVNAKYG 270
               W   L G ++G+      YP ++I+  +Q   + NP+  K  ++ ++A+++  + G
Sbjct: 287 PLNTWAELLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHKFTSMSEMAKIIFHERG 346

Query: 271 WKSFFKGFGPTMLRAAPANGATFATFE 297
           W+ FF G     ++  P    +F  +E
Sbjct: 347 WRGFFVGLSIGYIKVTPMVACSFFVYE 373

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 52/118 (44%), Gaps = 19/118 (16%)

Query: 7   SPLLIDDIDQ-------QPHDSGRVL-----KDLLAGTAGGMAQVLVGQPFDTTKVRLQT 54
           S L +DD+D        Q   +G+ +      +LLAG   GMA      PF+  + RLQ 
Sbjct: 261 SVLRVDDLDADDLKVDVQTTRTGKRIPLNTWAELLAGGLAGMASQTAAYPFEIIRRRLQV 320

Query: 55  S--TTP-----TTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRF 105
              T P     T+  E+ K +    G RGF+ G     + V   V+C F V E MK +
Sbjct: 321 GAVTNPLEHKFTSMSEMAKIIFHERGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWY 378

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 86/198 (43%), Gaps = 32/198 (16%)

Query: 126 GFVGGVANSF---LASPIEHVRIRLQTQTASGT--VAEFKGPLDC----INKLRANGALM 176
           G  GGVA S    L +P++ ++I  QT           F+G L+      ++ R  G + 
Sbjct: 57  GLAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRG-VF 115

Query: 177 RGLSPTILREAQGCATYFLTYEALVANQIGKGIARS---DVPAWKLCLFGAVSGVTLWLT 233
           +G S T+LR     A  F+ YE     QI   I  S   +    +LC  G+++G+     
Sbjct: 116 QGHSATLLRIFPYAAVKFIAYE-----QIRNVIIPSKEYETHFRRLCS-GSLAGLCSVFC 169

Query: 234 VYPLDVIKSLMQTDNLKNPVRGKNIIQ-------VARLVNAKY------GWKSFFKGFGP 280
            YPLD+I+  +      + VR   +++          L +  Y       W +F++G+ P
Sbjct: 170 TYPLDLIRVRLAYVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPKWFAQWCNFYRGYIP 229

Query: 281 TMLRAAPANGATFATFEL 298
           T++   P  G +F   +L
Sbjct: 230 TVIGMIPYAGVSFFAHDL 247

>Kwal_23.3965
          Length = 307

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 59/299 (19%), Positives = 114/299 (38%), Gaps = 31/299 (10%)

Query: 24  VLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA----VEVVKKLVKNEGLRGFYK 79
           V + L+AG   G++  +V  P DT K+RLQ            +   K+LV+ EG+R  +K
Sbjct: 14  VFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWK 73

Query: 80  GTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVG---GVANSFL 136
           G +  +       S QF     + +    S         LP     G VG   G  ++  
Sbjct: 74  GNVPAMAMYILYGSTQFTSYAILNKLLSKSQ--------LPAQIHTGMVGALSGTCSAIA 125

Query: 137 ASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLT 196
           + P + +R R      S  ++        I +        +G+S +I+  A   ++   T
Sbjct: 126 SYPCDVLRTRF-IANHSRELSTMLSTAQEIWRHEGFRGFFKGVSSSIVSIAVATSSILAT 184

Query: 197 YEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQT---DNLKNP- 252
           YE++      +    S V          ++G+     V+P+D ++   Q      L +P 
Sbjct: 185 YESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPG 244

Query: 253 -----------VRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAM 300
                          N +++A ++  K G  + + G+   + ++ P+   +   +E  +
Sbjct: 245 HTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEWCL 303

 Score = 31.6 bits (70), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 35/70 (50%), Gaps = 1/70 (1%)

Query: 213 DVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWK 272
           +VP ++  + G +SG++  +   PLD +K  +Q         G  ++   RLV  + G +
Sbjct: 11  EVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQE-GVR 69

Query: 273 SFFKGFGPTM 282
           + +KG  P M
Sbjct: 70  ALWKGNVPAM 79

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 75/290 (25%), Positives = 118/290 (40%), Gaps = 36/290 (12%)

Query: 25  LKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYKG---- 80
           L  +L   + G+ ++ V  P DT   RL ++ T   +   +  ++     R F       
Sbjct: 11  LARVLGSASAGILEIGVFHPVDTISKRLMSNHTKIASTSQLNSVI----FRDFASEPLGR 66

Query: 81  ---TLTPLVGVGACVSC-----QFG----VNEAMKRFFRGS--SADPHKTLTLPQYYICG 126
              +L P +G  A         ++G     NE + + F+G    A   KT    +    G
Sbjct: 67  RLLSLFPGLGYAAAYKILQRVYKYGGQPFANEFLNKNFKGDFDQAFGEKTGKALRSATAG 126

Query: 127 FVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANG-ALMRGLSPTILR 185
            + G+    L  P++ ++I+ QT   S     FKG    +  ++  G  L RG   T  R
Sbjct: 127 SLIGIGEIVLL-PLDVLKIKRQTNPES-----FKGR-GFLKIIKDEGFGLYRGWGWTAAR 179

Query: 186 EAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVY-PLDVIKSLM 244
            A G  ++ L      A +   G+       W      ++ G +  L V  PLDVIK+ +
Sbjct: 180 NAPG--SFALFGGNAFAKEYILGLKDYGQATWSQNFVSSIVGASASLIVSAPLDVIKTRI 237

Query: 245 QTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFA 294
           Q  N  NP  G  II+   L N   G+ +FFKG  P +L   P    +FA
Sbjct: 238 QNRNFDNPESGFKIIK-NTLKNE--GFTAFFKGLTPKLLTTGPKLVFSFA 284

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 2/79 (2%)

Query: 26  KDLLAGTAGGMAQVLVGQPFDTTKVRLQTST--TPTTAVEVVKKLVKNEGLRGFYKGTLT 83
           ++ ++   G  A ++V  P D  K R+Q      P +  +++K  +KNEG   F+KG   
Sbjct: 211 QNFVSSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFKIIKNTLKNEGFTAFFKGLTP 270

Query: 84  PLVGVGACVSCQFGVNEAM 102
            L+  G  +   F + + +
Sbjct: 271 KLLTTGPKLVFSFALAQTL 289

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 74/289 (25%), Positives = 119/289 (41%), Gaps = 34/289 (11%)

Query: 25  LKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNE------GLRGFY 78
           L  +L   + G+ ++ V  P DT   RL ++ T   +   +  ++  E        R F 
Sbjct: 10  LARVLGSASAGILEIGVFHPVDTISKRLMSNHTKIGSSSQLNSVIFREHAAEPLSKRVF- 68

Query: 79  KGTLTPLVGVGACVSC-----QFG----VNEAMKRFFRGSSADP--HKTLTLPQYYICGF 127
             TL P +G  A         ++G     NE + R F+    +    KT    +    G 
Sbjct: 69  --TLFPGLGYAATYKILQRVYKYGGQPFANEFLNRNFKADFDNTFGEKTGKALRSATAGS 126

Query: 128 VGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANG-ALMRGLSPTILRE 186
           + G+    L  P++ ++I+ QT   +     FKG    +  L+  G  L RG   T  R 
Sbjct: 127 MIGIGEIVLL-PLDVLKIKRQTNPEA-----FKGR-GFVKILKDEGLGLYRGWGWTAARN 179

Query: 187 AQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVY-PLDVIKSLMQ 245
           A G  ++ L      A +   G+       W      ++ G +  L +  PLDVIK+ +Q
Sbjct: 180 APG--SFALFGGNAFAKEYILGLKDYSQATWSQNFVSSIVGASASLIISAPLDVIKTRIQ 237

Query: 246 TDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFA 294
             N +NP  G  I++   L N   G+ +FFKG  P +L   P    +FA
Sbjct: 238 NKNFENPESGFTIVK-NTLKNE--GFSAFFKGLTPKLLTTGPKLVFSFA 283

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 37/79 (46%), Gaps = 2/79 (2%)

Query: 26  KDLLAGTAGGMAQVLVGQPFDTTKVRLQTST--TPTTAVEVVKKLVKNEGLRGFYKGTLT 83
           ++ ++   G  A +++  P D  K R+Q      P +   +VK  +KNEG   F+KG   
Sbjct: 210 QNFVSSIVGASASLIISAPLDVIKTRIQNKNFENPESGFTIVKNTLKNEGFSAFFKGLTP 269

Query: 84  PLVGVGACVSCQFGVNEAM 102
            L+  G  +   F + + +
Sbjct: 270 KLLTTGPKLVFSFALAQTL 288

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 76/187 (40%), Gaps = 18/187 (9%)

Query: 26  KDLLAGTAGGMAQVLVG-QPFDTTK---------VRLQTSTTPTTAVEVVKKLVKNEGLR 75
           + +LAG   G+ + +V   PF+  K         VR +      +       LVK+EG R
Sbjct: 108 RGVLAGLGAGLLESVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFR 167

Query: 76  GFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPH-KTLTLPQYYICGFVGGVANS 134
           G Y G L   +   A  + + G    +K   +  +  P  K LT    +I G   GV   
Sbjct: 168 GLYGGVLPVSMRQAANQAVRLGCYNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTV 227

Query: 135 FLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALM---RGLSPTILREAQGCA 191
           +   PI+ V+ R+Q+ TAS    ++   L+C   +     L    +G +P + R      
Sbjct: 228 YATMPIDTVKTRMQSLTAS----KYSSTLNCFTTIYKEEGLKTFWKGATPRLGRLILSGG 283

Query: 192 TYFLTYE 198
             F  YE
Sbjct: 284 IVFTIYE 290

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 69/302 (22%), Positives = 122/302 (40%), Gaps = 37/302 (12%)

Query: 19  HDSGRV--LKDLLAGTAGGMAQVLVGQPFDTTKVRLQ----TSTTPTTAVEVVKKLVKNE 72
            DS +V   K  +AG   G  +  +  PF+  K RLQ    +S      + ++    K +
Sbjct: 3   KDSKKVDPTKSFVAGALAGAVEASITYPFEFAKTRLQLIDKSSKASRNPLVLIYNTAKTQ 62

Query: 73  GLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVA 132
           G+   Y G    +VG  A  + +F   + ++   +         L+ P+  + G   G+ 
Sbjct: 63  GVGAIYVGCPAFIVGNTAKAATRFLGYDTIRNLLKDKKTGE---LSGPRGVLAGLGAGLL 119

Query: 133 NSFLA-SPIEHVR---------IRLQTQTASGTVAEFKGPLDCINKLRANG--ALMRGLS 180
            S +A +P E ++         +R + Q    ++A      + I+ ++  G   L  G+ 
Sbjct: 120 ESVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMAR-----NYISLVKDEGFRGLYGGVL 174

Query: 181 PTILREAQGCATYFLTY---EALVANQIGKGIARSDVPAWKLCLF--GAVSGVTLWLTVY 235
           P  +R+A   A     Y   + LV +  G   A  D P      F  GA SGV       
Sbjct: 175 PVSMRQAANQAVRLGCYNKIKVLVQDYTG---APKDKPLTSGLTFIVGAFSGVVTVYATM 231

Query: 236 PLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFAT 295
           P+D +K+ MQ+       +  + +     +  + G K+F+KG  P + R   + G  F  
Sbjct: 232 PIDTVKTRMQS---LTASKYSSTLNCFTTIYKEEGLKTFWKGATPRLGRLILSGGIVFTI 288

Query: 296 FE 297
           +E
Sbjct: 289 YE 290

>Kwal_47.19228
          Length = 281

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 65/140 (46%), Gaps = 6/140 (4%)

Query: 158 EFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAW 217
           +F   +  I + R     ++G  PTI+R+    A  F TY +L    I      ++  A+
Sbjct: 130 QFLTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSL-KQMISPNKPLNEYYAF 188

Query: 218 KLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKG 277
            L   G +S   +     P+DVIK+ MQ+    +    KN +  A  +  + G+  F+KG
Sbjct: 189 AL---GFISSCAVVAVTQPIDVIKTRMQSKYTWSNY--KNSLNCAYRIFVEEGFTKFWKG 243

Query: 278 FGPTMLRAAPANGATFATFE 297
           + P +++   + G +F  ++
Sbjct: 244 WAPRLMKVGLSGGVSFGVYQ 263

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/124 (20%), Positives = 61/124 (49%), Gaps = 11/124 (8%)

Query: 65  VKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYI 124
           V+++ ++ G+RGF +GT+  ++   +  + +F    ++K+        P+K L     + 
Sbjct: 135 VQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMI-----SPNKPLNEYYAFA 189

Query: 125 CGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGA---LMRGLSP 181
            GF+   A   +  PI+ ++ R+Q++    T + +K  L+C  ++          +G +P
Sbjct: 190 LGFISSCAVVAVTQPIDVIKTRMQSKY---TWSNYKNSLNCAYRIFVEEGFTKFWKGWAP 246

Query: 182 TILR 185
            +++
Sbjct: 247 RLMK 250

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 34/81 (41%), Gaps = 3/81 (3%)

Query: 31  GTAGGMAQVLVGQPFDTTKVRLQTSTTPT---TAVEVVKKLVKNEGLRGFYKGTLTPLVG 87
           G     A V V QP D  K R+Q+  T +    ++    ++   EG   F+KG    L+ 
Sbjct: 191 GFISSCAVVAVTQPIDVIKTRMQSKYTWSNYKNSLNCAYRIFVEEGFTKFWKGWAPRLMK 250

Query: 88  VGACVSCQFGVNEAMKRFFRG 108
           VG      FGV + +    + 
Sbjct: 251 VGLSGGVSFGVYQYVDNLMKA 271

>Scas_562.12
          Length = 300

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 117/287 (40%), Gaps = 35/287 (12%)

Query: 28  LLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNE------GLRGFYKGT 81
           LL   + G+ ++ V  P DT   RL ++ T       + +++  E      G R F   T
Sbjct: 14  LLGSASAGILEIGVFHPVDTISKRLMSNHTKIGNSHELNRVIFREHFSEPLGKRLF---T 70

Query: 82  LTPLVGVGACVSC-----QFG----VNEAMKRFFRGS--SADPHKTLTLPQYYICGFVGG 130
           L P +G  A         ++G     NE + + ++    SA   KT    +    G + G
Sbjct: 71  LFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDSAFGEKTGKAMRSATAGSLIG 130

Query: 131 VANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGA--LMRGLSPTILREAQ 188
           +    L  P++ ++I+ QT   +     FKG    +  L+  G   L RG   T  R A 
Sbjct: 131 IGEIVLL-PLDVLKIKRQTNPEA-----FKGR-GFVKILKDEGIFNLYRGWGWTAARNAP 183

Query: 189 GCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVY-PLDVIKSLMQTD 247
           G  ++ L      A +   G+      +W      ++ G +  L V  PLDVIK+ +Q  
Sbjct: 184 G--SFALFGGNAFAKEYILGLEDYSQASWSQNFISSIVGASCSLIVSAPLDVIKTRIQNR 241

Query: 248 NLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFA 294
           +  NP  G  I++         G  +FFKG  P +L   P    +FA
Sbjct: 242 SFDNPETGLTIVKNTF---KNEGITAFFKGLTPKLLTTGPKLVFSFA 285

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 2/79 (2%)

Query: 26  KDLLAGTAGGMAQVLVGQPFDTTKVRLQTST--TPTTAVEVVKKLVKNEGLRGFYKGTLT 83
           ++ ++   G    ++V  P D  K R+Q  +   P T + +VK   KNEG+  F+KG   
Sbjct: 212 QNFISSIVGASCSLIVSAPLDVIKTRIQNRSFDNPETGLTIVKNTFKNEGITAFFKGLTP 271

Query: 84  PLVGVGACVSCQFGVNEAM 102
            L+  G  +   F + +++
Sbjct: 272 KLLTTGPKLVFSFALAQSL 290

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 79/299 (26%), Positives = 123/299 (41%), Gaps = 38/299 (12%)

Query: 15  DQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNE-- 72
           DQ+     RV+       + G+ ++ V  P DT   RL ++ T  T  + +  +V  E  
Sbjct: 4   DQKQSGLARVV----GSASAGILEIGVFHPVDTISKRLMSNHTKITNAQQLNDVVFREHA 59

Query: 73  ----GLRGFYKGTLTPLVGVGACVSC-----QFG----VNEAMKRFFRGS--SADPHKTL 117
               G R F   TL P +G  A         ++G     NE + + F+     A   KT 
Sbjct: 60  SKPFGQRLF---TLFPGLGYAATYKIFQRVYKYGGQPFANEFLNKHFKADFDGAFGEKTG 116

Query: 118 TLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANG-ALM 176
              +    G + G+    L  P++ ++I+ QT   S     F+G    +  LR  G  L 
Sbjct: 117 KALRSATAGSLIGIGEIVLL-PLDVLKIKRQTNPES-----FRGR-GFLRILRDEGMGLY 169

Query: 177 RGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVY- 235
           RG   T  R A G  ++ L      A +   G+       W      ++ G +  L V  
Sbjct: 170 RGWGWTAARNAPG--SFALFGGNAFAKEYILGLKDYSQATWGQNFVSSIFGASASLIVSA 227

Query: 236 PLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFA 294
           PLDVIK+ +Q+ N ++   G  I++   L N   G  +FFKG  P +L   P    +FA
Sbjct: 228 PLDVIKTRIQSRNFESAESGFTIVKNT-LKNE--GATAFFKGLTPKLLTTGPKLVFSFA 283

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 2/79 (2%)

Query: 26  KDLLAGTAGGMAQVLVGQPFDTTKVRLQTST--TPTTAVEVVKKLVKNEGLRGFYKGTLT 83
           ++ ++   G  A ++V  P D  K R+Q+    +  +   +VK  +KNEG   F+KG   
Sbjct: 210 QNFVSSIFGASASLIVSAPLDVIKTRIQSRNFESAESGFTIVKNTLKNEGATAFFKGLTP 269

Query: 84  PLVGVGACVSCQFGVNEAM 102
            L+  G  +   F + + +
Sbjct: 270 KLLTTGPKLVFSFAIAQTL 288

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 70/290 (24%), Positives = 118/290 (40%), Gaps = 30/290 (10%)

Query: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNEGL-RGFYKGTLTPL 85
            L+ G  GG+   +V QPFD  K RLQ +   TT    +K++   + L RG    +L   
Sbjct: 10  HLIGGFVGGLTSAIVLQPFDLLKTRLQQN-KDTTLWGTLKEIRSPKQLWRGALPSSLRTS 68

Query: 86  VGVGACVSCQFGVNEAMKR-----FFRGSSADPHKTLTLPQYYICG-FVGGVANSFLASP 139
           +G    +S       AM +        GSS  P   LT+ +    G F  GV   F+  P
Sbjct: 69  IGSALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQ--LTMYENLASGAFTRGVVG-FITMP 125

Query: 140 IEHVRIRLQ-TQTASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYE 198
           I  +++R + T  +  ++ E    +     +R       G   T++R+A     Y L YE
Sbjct: 126 ITIIKVRYESTMYSYKSLGEATRHIYSTEGIR---GFFNGCGATVMRDAPYAGLYVLLYE 182

Query: 199 A---LVANQI-GKGIARSDVPAWKLCLFGAVSGVTLWLT-------VYPLDVIKSLMQTD 247
               LV   +    I+  +   +       V+ ++ +++         P D IK+ MQ D
Sbjct: 183 KAKLLVPMMLPSSTISYDEAGMFTTYTSTVVNSISAFMSASLATTITSPFDTIKTRMQLD 242

Query: 248 NLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
               P +     +   L+ +K  +K+ F G    + R A + G  +  +E
Sbjct: 243 ----PTKFSGFYKTLVLIVSKEKFKNLFDGLTLRLTRKAFSAGIAWGIYE 288

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 86/192 (44%), Gaps = 29/192 (15%)

Query: 121 QYYICGFVGGVANSFLASPIEHVRIRLQTQ---TASGTVAEFKGPLDCINKLRANGALMR 177
            + I GFVGG+ ++ +  P + ++ RLQ     T  GT+ E + P            L R
Sbjct: 9   SHLIGGFVGGLTSAIVLQPFDLLKTRLQQNKDTTLWGTLKEIRSP----------KQLWR 58

Query: 178 GLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAW----KLCLF-----GAVS-G 227
           G  P+ LR + G A Y  T        + KG  ++  P      +L ++     GA + G
Sbjct: 59  GALPSSLRTSIGSALYLSTLNVF-RTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTRG 117

Query: 228 VTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAP 287
           V  ++T+ P+ +IK   ++         K++ +  R + +  G + FF G G T++R AP
Sbjct: 118 VVGFITM-PITIIKVRYESTMYSY----KSLGEATRHIYSTEGIRGFFNGCGATVMRDAP 172

Query: 288 ANGATFATFELA 299
             G     +E A
Sbjct: 173 YAGLYVLLYEKA 184

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 76/171 (44%), Gaps = 18/171 (10%)

Query: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA---------VEVVKKLVKNEGLRGF 77
           +L +G A G   +L     D  + RL      + +         ++V KK +K +GL G 
Sbjct: 121 NLFSGGAAGGLSLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGL 180

Query: 78  YKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLA 137
           Y+G +  ++G+       FG+ ++ K      + +     +    ++ G+V  +  S  +
Sbjct: 181 YRGFVPSVLGIIVYRGLYFGLYDSFKPVLLTGALEG----SFVASFLLGWVITMGASTAS 236

Query: 138 SPIEHVRIRLQTQTASGTVAEFKGPLDCINKL-RANGA--LMRGLSPTILR 185
            P++ VR R+     SG   ++ G LDC+ K+ +  GA  L +G    I R
Sbjct: 237 YPLDTVRRRM--MMTSGQTIKYDGALDCLRKIVQKEGAYSLFKGCGANIFR 285

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 66/344 (19%), Positives = 126/344 (36%), Gaps = 64/344 (18%)

Query: 14  IDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRL-QTSTTPTTA----------- 61
           + ++    G   + +++ +AG +   L   P D  +VRL Q    P+             
Sbjct: 1   MSKETRKEGSAKERMVSASAGSLVTSLFLTPLDVVRVRLHQQEMLPSCTCTGQLSKPAGK 60

Query: 62  -----------------------VEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGV 98
                                  +E ++K+ + EGL   ++G    LV         F  
Sbjct: 61  VFWQDECFANVGCREPAARLQGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFSG 120

Query: 99  NEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQT-QTASGTVA 157
            EA++      ++     L +    +CG    +  +   +P+E +R RLQ+   A  T  
Sbjct: 121 YEALR-----DNSPLASRLPVANPLVCGAFARILAATTIAPLELLRTRLQSVPRARDTER 175

Query: 158 EFKGPLDCINKLRAN------GALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIAR 211
                 D + ++R         AL +GL  T+ R+    A Y+ TYE        +  A 
Sbjct: 176 TIYLIGDLLREMRHEVSVMGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAAT 235

Query: 212 SDVPAWKLCL----FGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVR------------G 255
            +   W   +     G++ G    L  +P DV K+ MQ   + +P +             
Sbjct: 236 HNASNWDHFIGSFACGSMGGAVAALLTHPFDVGKTRMQI-AIASPQQLTVGGKATKTDDS 294

Query: 256 KNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELA 299
           + +      +    G ++ + G  P +++ AP+     +T+EL+
Sbjct: 295 RGMFSFLNAIRKSEGIRALYTGLLPRVMKIAPSCAIMISTYELS 338

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 36/92 (39%), Gaps = 16/92 (17%)

Query: 31  GTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEV----------------VKKLVKNEGL 74
           G+ GG    L+  PFD  K R+Q +      + V                +  + K+EG+
Sbjct: 251 GSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRKSEGI 310

Query: 75  RGFYKGTLTPLVGVGACVSCQFGVNEAMKRFF 106
           R  Y G L  ++ +    +      E  K+FF
Sbjct: 311 RALYTGLLPRVMKIAPSCAIMISTYELSKKFF 342

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 74/176 (42%), Gaps = 27/176 (15%)

Query: 31  GTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA---------VEVVKKLVKNEGLRGFYKGT 81
           G AGG++ + V    D  + RL   +              V+V KK + ++G+ G Y+G 
Sbjct: 122 GAAGGLSLLFV-YSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRGF 180

Query: 82  LTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLAS--- 138
           L  +VG+       FG+ +++K            T  L   +I  F+ G A +  AS   
Sbjct: 181 LPSVVGIVVYRGLYFGMYDSLKPLLL--------TGNLESSFIASFLLGWAVTTGASTAS 232

Query: 139 -PIEHVRIRLQTQTASGTVAEFKGPLDCINKLRAN---GALMRGLSPTILREAQGC 190
            P++ VR R+     SG   ++ G  D   K+ A     +L +G    ILR   G 
Sbjct: 233 YPLDTVRRRM--MMTSGQAVKYDGAFDAFRKIVAAEGVKSLFKGCGANILRGVAGA 286

>Scas_667.4
          Length = 308

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 79/189 (41%), Gaps = 20/189 (10%)

Query: 31  GTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA---------VEVVKKLVKNEGLRGFYKGT 81
           G AGG++ + V    D  + RL      +           ++V K+ +  +G+ G Y+G 
Sbjct: 125 GAAGGLSLLFV-YSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAGLYRGF 183

Query: 82  LTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIE 141
           L  +VG+       FG+ +++K      S +     +    ++ G++     S  + P++
Sbjct: 184 LPSVVGIIVYRGLYFGLYDSLKPAVLTGSLEG----SFLASFLLGWIVTTGASTASYPLD 239

Query: 142 HVRIRLQTQTASGTVAEFKGPLDCINKLRAN---GALMRGLSPTILREAQGCATYFLTYE 198
            VR R+     SG   ++ G  DC  K+ A     +L +G    ILR   G     + Y+
Sbjct: 240 TVRRRM--MMTSGQAVKYDGAFDCFRKVVAAEGVSSLFKGCGANILRGVAGAGVISM-YD 296

Query: 199 ALVANQIGK 207
            L     GK
Sbjct: 297 QLQMIMFGK 305

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 57/250 (22%), Positives = 100/250 (40%), Gaps = 39/250 (15%)

Query: 12  DDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTT-AVEVVKKLVK 70
           +D+D+  H         +AG+ GG A + V  P  T    LQT        +E +K++  
Sbjct: 7   NDVDELAHA--------IAGSLGGAASIAVTYPLVTITTNLQTKENEARPKLETIKEIYN 58

Query: 71  NEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYY------I 124
             G+ G++ G  + + G+       +        +F    A   +TLT  QY       +
Sbjct: 59  KNGIIGYFLGLESAVYGMATTNFVYY--------YFYEWCAKTARTLTTKQYLSTWESIL 110

Query: 125 CGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANG--ALMRGLSPT 182
              + G   +  ++PI     R+    A    +  +  +D +   + +G   L+ GL P 
Sbjct: 111 ASTIAGSMTAVASNPIWVANTRM--TVAKSNHSTLRTVIDIV---KTDGPLTLLNGLKPA 165

Query: 183 ILREAQGCATYFLTYEALVANQIGKGIARSDV--PAWKLCLFGAVSGVTLWLTVYPLDVI 240
           ++  +     Y + YE L    +   + R  V  P+W   L GA+  +    T YP   +
Sbjct: 166 LVLVSNPIIQYTV-YEQL--KNLVLRLQRKKVLSPSWAF-LLGAIGKLAATGTTYPYITL 221

Query: 241 KS---LMQTD 247
           K+   LMQ D
Sbjct: 222 KTRMHLMQND 231

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/254 (22%), Positives = 114/254 (44%), Gaps = 36/254 (14%)

Query: 44  PFDTTKVRLQTS-TTPTTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAM 102
           P D  K RLQ +     + ++  K +V++EGL   + G     +G     +C++G  E  
Sbjct: 35  PLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYF 94

Query: 103 KRFFRG----SSADPHKTLTLPQYYICGFVGGVANSFLAS----PIEHVRIRLQTQTASG 154
           K+ +       +A  H+T      Y+C      +  FLA     P E ++++ QT     
Sbjct: 95  KQTYSNLLSPETAHRHRTAV----YLC---ASASAEFLADILLCPWEAIKVKQQT----- 142

Query: 155 TVAEF-KGPLDCINKLRAN---GALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIA 210
           T+  F K  L+  +K+ A      L +G++P   R+       F ++E +V   I   + 
Sbjct: 143 TIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIV-EMIYAKLP 201

Query: 211 RSD---VPAWKLCLF---GAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARL 264
           RS     P+ ++ +    G ++G+   +  +P DV+ S +  D      +G+++++ ++ 
Sbjct: 202 RSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADR----KQGESMVEASKR 257

Query: 265 VNAKYGWKSFFKGF 278
           + ++ G+   + G 
Sbjct: 258 IYSRIGFGGLWNGL 271

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 70/188 (37%), Gaps = 19/188 (10%)

Query: 120 PQYYICGFVGGVA----NSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKL-RANG- 173
           P+YY    +GGV          +P++ V+ RLQ          ++  LD    + R+ G 
Sbjct: 12  PEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQL-----YRSNLDGWKTIVRSEGL 66

Query: 174 -ALMRGLSPTIL-REAQGCATY--FLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVT 229
             +  G+  T +    QG   Y  +  ++   +N +    A     A  LC   +   + 
Sbjct: 67  SKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLA 126

Query: 230 LWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPAN 289
             L   P + IK   QT     P   KN ++    + A  G    +KG  P   R  P  
Sbjct: 127 DILLC-PWEAIKVKQQTTI---PPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYT 182

Query: 290 GATFATFE 297
              F +FE
Sbjct: 183 MCKFTSFE 190

>Scas_705.9
          Length = 323

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 62/293 (21%), Positives = 112/293 (38%), Gaps = 36/293 (12%)

Query: 31  GTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKK----------------LVKNEGL 74
             A  MA V+V  P D  K  +Q+ T      E+ +K                + +  GL
Sbjct: 11  AIASTMANVIV-YPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLIRIFRKRGL 69

Query: 75  RGFYKGTLTPLVGVGACVSCQFGVNEAMKR------FFRGSSADPHKTLTLPQYYICGFV 128
           RG Y+G  T +        C F     ++R        R + A P  +++  +  I G  
Sbjct: 70  RGLYQGMSTSVFSKFVQSFCYFFWYSFLRRKYFSLKLLRNTQARPINSISTVEELIVGVG 129

Query: 129 GGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGAL---MRGLSPTILR 185
                  + +PIE +  + QT      V +F   L  I  + +NG L    +G   +++ 
Sbjct: 130 AAALTQVVNNPIEVILTKQQTTDDKDNV-DFYSVLKQIY-VESNGKLSSYWKGFKVSLIL 187

Query: 186 EAQGCATY--FLTYEALVANQIGKGIARS--DVPAWKLCLFGAVSGVTLWLTVYPLDVIK 241
                 T+  +  ++ ++  Q+          +   +  + GA++ +   +   PL V K
Sbjct: 188 TVNPSITFAAYQRFKDILLKQVSNSEKSYSGQLTVNQNFILGALAKIISTIITQPLIVAK 247

Query: 242 SLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFA 294
             +Q  N K     K+  +V R +  + G  + +KG GP + +     G  FA
Sbjct: 248 VSLQRSNSK----FKHFEEVLRYLYKEEGVLALWKGVGPQLTKGVLVQGLVFA 296

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 11/72 (15%)

Query: 223 GAVSGVTLWLTVYPLDVIKSLMQ-------TDNL----KNPVRGKNIIQVARLVNAKYGW 271
           GA++     + VYPLDV K+++Q       TD L    K  +R +N+I+    +  K G 
Sbjct: 10  GAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLIRIFRKRGL 69

Query: 272 KSFFKGFGPTML 283
           +  ++G   ++ 
Sbjct: 70  RGLYQGMSTSVF 81

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/266 (22%), Positives = 105/266 (39%), Gaps = 27/266 (10%)

Query: 2   PEETSSPLLIDDIDQQPHDSGRVLKDL----LAGTAGGMAQVLVGQPFDTTKVRLQTSTT 57
           P++ ++    D + ++  DS   L  +    ++G  GG          DT K R Q +  
Sbjct: 27  PDQPNNNRKDDKLHKKRGDSDEDLSPIWHCVVSGGIGGKIGDSAMHSLDTVKTRQQGAPN 86

Query: 58  PT---TAVEVVKKLVKNEGLR-GFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADP 113
                  +   + +   EG+R G Y G +  ++G     +  FG  E  KR         
Sbjct: 87  VKKYRNMISAYRTIWLEEGVRRGLYGGYMAAMLGSFPSAAIFFGTYEYTKRTMI-EDWQI 145

Query: 114 HKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQ--------TASGTVAEFKGPLDC 165
           + T+T   +   GF+G   +SF+  P E ++ RLQ Q         +    +  +  +  
Sbjct: 146 NDTIT---HLSAGFLGDFISSFVYVPSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKT 202

Query: 166 INKLRANGALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLC----- 220
           + K     +L  G   T+ R+    A  F  YE     Q+   I + D    +L      
Sbjct: 203 VIKEEGFRSLFFGYKATLARDLPFSALQFAFYEKF--RQLAFKIEQKDGRDGELSIPNEI 260

Query: 221 LFGAVSGVTLWLTVYPLDVIKSLMQT 246
           L GA +G    +   P+DV+K+ +QT
Sbjct: 261 LTGACAGGLAGIITTPMDVVKTRVQT 286

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/293 (21%), Positives = 111/293 (37%), Gaps = 29/293 (9%)

Query: 23  RVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYKGTL 82
           R    L+ G +GG+   ++ QPFD  K RLQ   T T    + K L   E     ++G L
Sbjct: 6   RATTHLIGGFSGGLVSAIILQPFDLLKTRLQQDKTST----LWKTLKSIETPSQLWRGAL 61

Query: 83  TPLV--GVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQ--YYICGFVGGVANS---F 135
              +   VG+ +     +N   +   +G +     +  LPQ   Y   F G V  +    
Sbjct: 62  PSCIRTSVGSAMYLTM-LNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRALTGL 120

Query: 136 LASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFL 195
           +  PI  +++R ++     T    +     I +        RG   T LR+A     Y L
Sbjct: 121 ITMPITVIKVRYESTLYQYT--SLRYATSHIFRTEGLRGFFRGFGATALRDAPYAGLYML 178

Query: 196 TYE-------ALVANQIGKGIARSDVPAWKLCLF---GAVSGVTLWLTVY-PLDVIKSLM 244
            Y+        L+ + + K  + +    +   L     A S   +  ++  P D +K+ M
Sbjct: 179 FYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSAAVIATSITAPFDTVKTRM 238

Query: 245 QTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
           Q +    P +  +       +  K   ++ F G    + R A + G  +  +E
Sbjct: 239 QLE----PAKFHSFTSTFWHIATKESVRNLFAGISLRLTRKAFSAGIAWGIYE 287

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 65/156 (41%), Gaps = 10/156 (6%)

Query: 144 RIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYEALVAN 203
           R RL         + F   +  I   R     ++G +PTI R+    A  F TY +L   
Sbjct: 255 RERLFLHYEEHPTSRFFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSL--- 311

Query: 204 QIGKGIARSDVPAWKLCLF--GAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQV 261
              K +   + P  +   F  G +S   +     P+DVIK+ MQ+         KN +  
Sbjct: 312 ---KQLISPNKPLNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQSKYAW--ANYKNSLNC 366

Query: 262 ARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
           A  +  + G   F+KG+ P +++   + G +F  ++
Sbjct: 367 AYRIFVEEGIPKFWKGWAPRLMKVGLSGGVSFGVYQ 402

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/141 (21%), Positives = 64/141 (45%), Gaps = 12/141 (8%)

Query: 49  KVRLQTSTTPTTAV-EVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFR 107
           ++ L     PT+     VK++    GLRGF +GT   +       + +F    ++K+   
Sbjct: 257 RLFLHYEEHPTSRFFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLKQLI- 315

Query: 108 GSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCIN 167
                P+K L     ++ GF+   A   +  PI+ ++ R+Q++ A    A +K  L+C  
Sbjct: 316 ----SPNKPLNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQSKYA---WANYKNSLNCAY 368

Query: 168 KLRANGAL---MRGLSPTILR 185
           ++     +    +G +P +++
Sbjct: 369 RIFVEEGIPKFWKGWAPRLMK 389

 Score = 32.3 bits (72), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 35/83 (42%), Gaps = 3/83 (3%)

Query: 28  LLAGTAGGMAQVLVGQPFDTTKVRLQTS---TTPTTAVEVVKKLVKNEGLRGFYKGTLTP 84
            + G     A V V QP D  K R+Q+         ++    ++   EG+  F+KG    
Sbjct: 327 FVLGFISSCAVVAVTQPIDVIKTRMQSKYAWANYKNSLNCAYRIFVEEGIPKFWKGWAPR 386

Query: 85  LVGVGACVSCQFGVNEAMKRFFR 107
           L+ VG      FGV + ++   +
Sbjct: 387 LMKVGLSGGVSFGVYQYVENLIK 409

>Scas_669.6
          Length = 373

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 66/276 (23%), Positives = 96/276 (34%), Gaps = 44/276 (15%)

Query: 43  QPFDTTKVRLQTS-TTPT--TAVEVVKKLVKNEGL-RGFYKGTLTPLVGVGACVSCQFGV 98
              DT K R Q +  TP         + +   EG+ RG Y G    ++G     +  FG 
Sbjct: 70  HSLDTVKTRQQGAPMTPKYKNMTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAIFFGT 129

Query: 99  NEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQ-------- 150
            E  KR   G          L      G +G   +SF+  P E ++ RLQ Q        
Sbjct: 130 YEWCKRKMIGDLGFNDTVSHLS----AGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFF 185

Query: 151 TASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIA 210
            +       +  +  I       AL  G   T+ R+    A  F  YE     Q    + 
Sbjct: 186 QSGYNYRSLRTAIRIIVNTEGVKALFFGYKATLARDLPFSALQFGFYEKF--RQTAFKLE 243

Query: 211 RSDVPAWKLCL-----FGAVSGVTLWLTVYPLDVIKSLMQTDNLK-NP------------ 252
           + D+    L +      GA++G    +   P+DVIK+ +QT     NP            
Sbjct: 244 KKDITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIKTRLQTQQADINPNSATTVGAISAK 303

Query: 253 --------VRGKNIIQVARLVNAKYGWKSFFKGFGP 280
                   V   +I +  +LV    G   FF G GP
Sbjct: 304 TNKKSRPIVLSNSIFRSLKLVYQSEGVIGFFSGVGP 339

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 43.9 bits (102), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 62/141 (43%), Gaps = 9/141 (6%)

Query: 123 YICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRAN---GALMRGL 179
           +I G V G  +  + SP E V+I LQ Q  S T A   G ++ + ++        L RG 
Sbjct: 15  FIAGGVAGAVSRTVVSPFERVKILLQVQ--SSTSAYNHGIINAVGQVYKEEGVAGLFRGN 72

Query: 180 SPTILREAQGCATYFLTYEALVAN--QIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPL 237
               +R     A  F+ YE    +   +   + +  +  W+    GA+ G    L  YPL
Sbjct: 73  GLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPL 132

Query: 238 DVIKSLM--QTDNLKNPVRGK 256
           D++++ +  QT NL    + K
Sbjct: 133 DLVRTRLSIQTANLAKLSKSK 153

 Score = 41.2 bits (95), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 62/130 (47%), Gaps = 10/130 (7%)

Query: 31  GTAGGMAQVLVGQPFDTTKVRLQTSTTPTT----AVEVVKKLVKNEGLRGFYKGTLTPLV 86
           G AG +++ +V  PF+  K+ LQ  ++ +      +  V ++ K EG+ G ++G     V
Sbjct: 19  GVAGAVSRTVV-SPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCV 77

Query: 87  GVGACVSCQFGVNEAMKR--FFRGSSADPHKTLTLPQYYICGFVGGVANSFLAS-PIEHV 143
            +    + QF V E  K+  F    +    + L   +       GG+  S LA+ P++ V
Sbjct: 78  RIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGM--SVLATYPLDLV 135

Query: 144 RIRLQTQTAS 153
           R RL  QTA+
Sbjct: 136 RTRLSIQTAN 145

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 58/260 (22%), Positives = 112/260 (43%), Gaps = 31/260 (11%)

Query: 62  VEVVKKLVKNEGLRGFYKG-TLTPLVGVGACVSCQFGVNEAMKRFFRGSS--ADPHKTLT 118
           +E   K+   EG+   ++G +LT L+ + A +    G       + R  S  A  + TL 
Sbjct: 106 LEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGY-----EYIRDVSPIASTYPTLN 160

Query: 119 LPQYYICGFVGGVANSFLASPIEHVRIRLQT-QTASGTVAEFKGPLDCINKLRA------ 171
            P +  CG +  V  +   +P+E V+ +LQ+   +S +   +    D +N+ R       
Sbjct: 161 -PLF--CGAIARVFAATSIAPLELVKTKLQSIPRSSKSTKTWMMVKDLLNETRQEMKMVG 217

Query: 172 -NGALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIAR--SDVPAWKLCL----FGA 224
            + AL +GL  T+ R+    A Y+ +YE L   ++     R  S    W   +     G 
Sbjct: 218 PSRALFKGLEITLWRDVPFSAIYWSSYE-LCKERLWLDSTRFASKDANWVHFINSFASGC 276

Query: 225 VSGVTLWLTVYPLDVIK-----SLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFG 279
           +SG+   +  +P DV K     S+M   + K   R +N+ +    +    G  + + G  
Sbjct: 277 ISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTEGLAALYTGLA 336

Query: 280 PTMLRAAPANGATFATFELA 299
             +++  P+     +++E++
Sbjct: 337 ARVIKIRPSCAIMISSYEIS 356

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 54/249 (21%), Positives = 95/249 (38%), Gaps = 63/249 (25%)

Query: 109 SSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQ-----------------T 151
           S  +   +LTL +  +    G V  S + +P++ VRIRLQ Q                  
Sbjct: 2   SDRNTSNSLTLKERMLSAGAGSVLTSLILTPMDVVRIRLQQQQMIPDCSCDGAAEVPNAV 61

Query: 152 ASG---------------------------------TVAEFKGPLDCINKL---RANGAL 175
           +SG                                 +  +F G L+   K+       +L
Sbjct: 62  SSGSKMKTFTNVGGQNLNNAKIFWESACFQELHCKNSSLKFNGTLEAFTKIASVEGITSL 121

Query: 176 MRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVY 235
            RG+S T+L        YF  YE +   +    IA S  P       GA++ V    ++ 
Sbjct: 122 WRGISLTLLMAIPANMVYFSGYEYI---RDVSPIA-STYPTLNPLFCGAIARVFAATSIA 177

Query: 236 PLDVIKSLMQ-----TDNLKNPVRGKNIIQVARLVNAKYG-WKSFFKGFGPTMLRAAPAN 289
           PL+++K+ +Q     + + K  +  K+++   R      G  ++ FKG   T+ R  P +
Sbjct: 178 PLELVKTKLQSIPRSSKSTKTWMMVKDLLNETRQEMKMVGPSRALFKGLEITLWRDVPFS 237

Query: 290 GATFATFEL 298
              ++++EL
Sbjct: 238 AIYWSSYEL 246

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 68/161 (42%), Gaps = 6/161 (3%)

Query: 137 ASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLT 196
           A P++    R          + F G +  I + R     ++G  PTI R+       F T
Sbjct: 173 ARPVQTAHERWLLHYERQPSSHFAGTVLEIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTT 232

Query: 197 YEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGK 256
           Y A +   +    A  +  A+     GA+S   +     P+DVIK+ MQ+         K
Sbjct: 233 Y-AWIVQSLSPHKALDEYQAFAA---GALSSAAVVALTQPIDVIKTRMQSKTAWFTY--K 286

Query: 257 NIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
           + +  A  +  + G++  +KG+ P + + + + G +F  ++
Sbjct: 287 SSLNCAYRIFVEEGFRYMWKGWVPRLFKVSLSGGISFGVYQ 327

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 39/89 (43%), Gaps = 3/89 (3%)

Query: 18  PHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTST---TPTTAVEVVKKLVKNEGL 74
           PH +    +   AG     A V + QP D  K R+Q+ T   T  +++    ++   EG 
Sbjct: 242 PHKALDEYQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWFTYKSSLNCAYRIFVEEGF 301

Query: 75  RGFYKGTLTPLVGVGACVSCQFGVNEAMK 103
           R  +KG +  L  V       FGV + ++
Sbjct: 302 RYMWKGWVPRLFKVSLSGGISFGVYQYVE 330

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 48/105 (45%), Gaps = 8/105 (7%)

Query: 65  VKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYI 124
           V ++ +  G+RGF +G +  +         +F     + +     S  PHK L   Q + 
Sbjct: 199 VLEIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTTYAWIVQ-----SLSPHKALDEYQAFA 253

Query: 125 CGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKL 169
            G +   A   L  PI+ ++ R+Q++TA  T   +K  L+C  ++
Sbjct: 254 AGALSSAAVVALTQPIDVIKTRMQSKTAWFT---YKSSLNCAYRI 295

>Kwal_27.12481
          Length = 304

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 71/172 (41%), Gaps = 19/172 (11%)

Query: 31  GTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA---------VEVVKKLVKNEGLRGFYKGT 81
           G AGG++ + V    D  + RL   +              V+V KK + ++G+ G Y+G 
Sbjct: 122 GAAGGLSLMFV-YSLDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAGLYRGF 180

Query: 82  LTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIE 141
           L  +VG+       FG  +++K      S +     +    ++ G+      S  + P++
Sbjct: 181 LPSVVGIVVYRGLYFGGYDSLKPLLLTGSLEG----SFLASFLLGWAVTTGASTASYPLD 236

Query: 142 HVRIRLQTQTASGTVAEFKGPLDCINKLRAN---GALMRGLSPTILREAQGC 190
            VR R+     SG   ++ G  D   K+ A     +L +G    ILR   G 
Sbjct: 237 TVRRRM--MMTSGQAVKYNGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGA 286

>Scas_328.1
          Length = 227

 Score = 43.1 bits (100), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 62/127 (48%), Gaps = 9/127 (7%)

Query: 62  VEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQ 121
           ++V KK +  +G+ G Y+G L  +VG+       FG+ +++K      S    +   LP 
Sbjct: 83  LDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPVLLTGS---FENAFLPS 139

Query: 122 YYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANG---ALMRG 178
            ++ G+   ++ S  + P++ VR R+     SG   ++KG +DC  ++ +     +L +G
Sbjct: 140 -FLLGWAVTISASTTSYPLDTVRRRM--MMTSGQAVKYKGAIDCFQQIVSQEGVYSLFKG 196

Query: 179 LSPTILR 185
               I R
Sbjct: 197 CGANIFR 203

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 78/198 (39%), Gaps = 17/198 (8%)

Query: 44  PFDTTKVRLQTSTTPTTA--VEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEA 101
           P D  K R+Q   T      V   K+++  EG      G    L+G     + +FG  E 
Sbjct: 37  PIDVVKTRIQLEPTVYNKGMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGAFKFGGYEV 96

Query: 102 MKRFFRGSSADPHKTLTLPQYYICGFVGGVANS-FLAS----PIEHVRIRL--QTQTASG 154
            K+FF     D     T  +Y    ++G  A + FLA     P+E  RIRL  Q Q A+G
Sbjct: 97  FKKFF----IDNLGYDTASRYKNSVYMGSAAMAEFLADIALCPLEATRIRLVSQPQFANG 152

Query: 155 TVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDV 214
            V  F      I K    G+   G +P + ++       FL +E       G    +  +
Sbjct: 153 LVGGF----SRILKEEGIGSFYSGFTPILFKQIPYNIAKFLVFERASEFYYGFAGPKEKL 208

Query: 215 PAWKLCLFGAVSGVTLWL 232
            +    L   +SG+T  L
Sbjct: 209 SSTSTTLLNLLSGLTAGL 226

 Score = 35.8 bits (81), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 69/168 (41%), Gaps = 17/168 (10%)

Query: 139 PIEHVRIRLQ---TQTASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFL 195
           PI+ V+ R+Q   T    G V  FK     I      GAL+ G  PT+L  +   A  F 
Sbjct: 37  PIDVVKTRIQLEPTVYNKGMVGSFK----QIIAGEGAGALLTGFGPTLLGYSIQGAFKFG 92

Query: 196 TYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLT---VYPLDVIK-SLMQTDNLKN 251
            YE      I   +       +K  ++   + +  +L    + PL+  +  L+      N
Sbjct: 93  GYEVFKKFFI-DNLGYDTASRYKNSVYMGSAAMAEFLADIALCPLEATRIRLVSQPQFAN 151

Query: 252 PVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELA 299
            + G      +R++  + G  SF+ GF P + +  P N A F  FE A
Sbjct: 152 GLVGG----FSRILKEE-GIGSFYSGFTPILFKQIPYNIAKFLVFERA 194

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/313 (18%), Positives = 105/313 (33%), Gaps = 28/313 (8%)

Query: 1   MPEETSSPLLIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTT 60
           M   + SP L  +   +  ++   L  ++AG+  G+    V  P DT K+R Q       
Sbjct: 1   MAASSGSPQLATEDHLRKGEAVSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQLQLASEH 60

Query: 61  A----VEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKT 116
                +   + + + EG+R  +KG +          S QFG    +      +   P   
Sbjct: 61  KYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQA- 119

Query: 117 LTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALM 176
                    G + G+ +S L  P++ +R RL     S      +     I          
Sbjct: 120 ----HSLAVGALAGLVSSLLTYPLDLLRTRL-VANRSAHFFSLRRQARVIWDTEGPAGFF 174

Query: 177 RGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYP 236
           RG +  I          F  YE         G+       W        +G+     V+P
Sbjct: 175 RGGAWAIAATTLTTGLIFGIYETCTIAADTYGL------PWLAAAASPTAGLVSKAAVFP 228

Query: 237 LDVIKSLMQTDNLKN------------PVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLR 284
           LD ++  +Q  + K+             +RG   + +A  +    G  S +KG    + +
Sbjct: 229 LDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCK 288

Query: 285 AAPANGATFATFE 297
           + P    T   ++
Sbjct: 289 STPTTVITLWVYQ 301

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 62/136 (45%), Gaps = 17/136 (12%)

Query: 62  VEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQ 121
           V+V KK + ++G+ G Y+G L  +VG+       FG+ +++K            T +L  
Sbjct: 161 VDVYKKTLASDGVAGLYRGFLPSVVGIVVYRGLYFGLYDSLKPLLL--------TGSLEN 212

Query: 122 YYICGFVGGVANSFLAS----PIEHVRIRLQTQTASGTVAEFKGPLDCINKLRAN---GA 174
            ++  F+ G A +  AS    P++ VR R+     SG   ++ G  D   K+ A     +
Sbjct: 213 SFLASFLLGWAVTTGASTASYPLDTVRRRM--MMTSGQAVKYDGAFDAFRKIVAAEGIKS 270

Query: 175 LMRGLSPTILREAQGC 190
           L +G    ILR   G 
Sbjct: 271 LFKGCGANILRGVAGA 286

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 70/149 (46%), Gaps = 15/149 (10%)

Query: 158 EFKGPLDCINKLR-ANGA--LMRGLSPTILREAQGCATYFLTYEALVAN-----QIGKGI 209
           ++KG LD + ++  A G   L RGL  + +       +YF  Y  +  +     Q   G 
Sbjct: 71  QYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHYFRLKQARGGD 130

Query: 210 ARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKY 269
           AR   P  +  + G V+  T  L V P++V+ +  QT          ++  VAR V+A+ 
Sbjct: 131 ARFSTP--EELVLGIVAAATSQLFVNPINVVATRQQTRG--QAAGAADMRTVAREVHAEN 186

Query: 270 GWKSFFKGFGPTM-LRAAPANGATFATFE 297
           GW+ F+ G   ++ L   P+   T+AT+E
Sbjct: 187 GWRGFWAGLKVSLVLTVNPS--ITYATYE 213

 Score = 34.7 bits (78), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 51/243 (20%), Positives = 92/243 (37%), Gaps = 16/243 (6%)

Query: 61  AVEVVKKLVKNEGLRGFYKGTLTPLV-GVGACVSCQFGVNEAMKRFFRGSSADP-HKTLT 118
           A++ ++++   EG+ G Y+G  +  V G     S  F      K +FR   A       +
Sbjct: 75  ALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHYFRLKQARGGDARFS 134

Query: 119 LPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRG 178
            P+  + G V    +    +PI  V  R QT+  +   A+ +     ++          G
Sbjct: 135 TPEELVLGIVAAATSQLFVNPINVVATRQQTRGQAAGAADMRTVAREVHAENGWRGFWAG 194

Query: 179 LSPTILREAQGCATYFLTYEALVANQIGKGIARSDV--------PAWKLCLFGAVSGVTL 230
           L  +++       TY  TYE L         A S +        P     + G +S +  
Sbjct: 195 LKVSLVLTVNPSITY-ATYERLREALFPTPAAASHLVDSAALLSPGQNFVM-GVLSKIVS 252

Query: 231 WLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANG 290
            +   PL + K+ +Q    ++    ++  QV   + +  G  S +KG GP + +     G
Sbjct: 253 TVLTQPLIIAKASLQ----RSGSCFQDFHQVLHHLYSTEGPLSLWKGLGPQITKGVLVQG 308

Query: 291 ATF 293
             F
Sbjct: 309 LLF 311

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/246 (21%), Positives = 97/246 (39%), Gaps = 17/246 (6%)

Query: 60  TAVEVVKKLVKNEGLRGFYKG-TLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKT-L 117
           +  + + K+ K EG+RG Y+G T + + G     S  F  +   K +FR    +   T  
Sbjct: 77  STFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFRVKLINRKNTKF 136

Query: 118 TLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINK-LRANGALM 176
           T  +  + G V    +    +PI  +  R QT+       +F      I K  R+     
Sbjct: 137 TTIEELLLGIVAAATSQIFTNPISLISARQQTRQGIDGDNDFLTVAKEIYKEQRSIKGFW 196

Query: 177 RGLSPTILREAQGCATYFLTYEALV-------ANQIGKGI--ARSDVPAWKLCLFGAVSG 227
           +GL  +++       TY  +YE L           + K +  + S +  ++    G +S 
Sbjct: 197 KGLKVSLMLTINPSITY-TSYEKLKDALFTTDTMNLKKELVDSSSQLSPYQNFTLGVLSK 255

Query: 228 VTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAP 287
           +   +   PL + K+ +Q    +N     +  QV   +    G +S++KG  P + +   
Sbjct: 256 MISAIITMPLIISKAWLQ----RNGSNFSSFQQVLYYLYKNEGLRSWWKGLSPQLAKGVL 311

Query: 288 ANGATF 293
             G  F
Sbjct: 312 VQGLLF 317

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 66/266 (24%), Positives = 104/266 (39%), Gaps = 27/266 (10%)

Query: 41  VGQPFDTTKVRLQTSTTPTTAVEVV---KKLVKNEGLR-GFYKGTLTPLVGVGACVSCQF 96
           V    DT K R Q +        ++   + L   EG+R G Y G    ++G     +  F
Sbjct: 70  VMHSLDTVKTRQQGAPGEVKYRHMISAYRTLALEEGVRRGLYGGYGAAMLGSFPSAAVFF 129

Query: 97  GVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTV 156
           G  E +KR    +    H+T +   +   GF+G + +S +  P E ++ RLQ Q      
Sbjct: 130 GTYEWVKRQMI-NEWQIHETYS---HLAAGFLGDLFSSVVYVPSEVLKTRLQLQGCYNNR 185

Query: 157 A-----EFKGPLDCINKL-RANG--ALMRGLSPTILREAQGCATYFLTYEALV--ANQIG 206
                  ++G  D +  + R  G  AL  G   T+ R+    A  F  YE     A  + 
Sbjct: 186 HFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAFYERFRKWAFLLE 245

Query: 207 KGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTD--------NLKNPVRGKNI 258
           +      +      + GA +G    +   PLDV+K+ +QT         +   P R    
Sbjct: 246 RKPVDGHLSFTAEVVTGASAGGLAGIITTPLDVVKTRIQTQPRGSAGTPDASAPARLNGS 305

Query: 259 IQVARLVNAKY-GWKSFFKGFGPTML 283
           I  + LV  +Y G    F G GP  +
Sbjct: 306 IFRSLLVVLRYEGLGGAFSGVGPRFI 331

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 67/177 (37%), Gaps = 49/177 (27%)

Query: 28  LLAGTAGGMAQVLVGQPFDTTKV---------------------------RLQTSTTPTT 60
           L+AGT  G+ + L   PF+  K                            ++ T +TP  
Sbjct: 79  LIAGTLTGIVESLFIIPFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHKVATKSTPVA 138

Query: 61  AVE----VVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKT 116
            +E     VK + +  G   F +GT   +    A  S QF    A KR  +  +      
Sbjct: 139 RIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQARNDKASSV 198

Query: 117 LTLPQYYICGFVGGVANSF----LASPIEHVRIRLQTQTASGTVAEFKGPLDCINKL 169
           +T           G+A SF    +  PI+ V+ R+ +Q A     E+K  L+C+ ++
Sbjct: 199 IT-----------GLATSFTLVAMTQPIDVVKTRMMSQNAK---TEYKNTLNCMYRI 241

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/202 (20%), Positives = 74/202 (36%), Gaps = 36/202 (17%)

Query: 124 ICGFVGGVANSFLASPIEHVRIRL-------------------------QTQTASGTVAE 158
           I G + G+  S    P E+++  L                         +  T S  VA 
Sbjct: 80  IAGTLTGIVESLFIIPFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHKVATKSTPVAR 139

Query: 159 FKGPLDCINKL---RANGALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVP 215
            +  L  +  +   R   A ++G + TI R+    +  F  Y A       K + ++   
Sbjct: 140 IEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAF------KRLLQARND 193

Query: 216 AWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFF 275
                + G  +  TL     P+DV+K+ M + N K     KN +     +  + G  +F+
Sbjct: 194 KASSVITGLATSFTLVAMTQPIDVVKTRMMSQNAKTEY--KNTLNCMYRIFVQEGMATFW 251

Query: 276 KGFGPTMLRAAPANGATFATFE 297
           KG     ++   + G TF  +E
Sbjct: 252 KGSIFRFMKVGISGGLTFTVYE 273

 Score = 31.6 bits (70), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 33/77 (42%), Gaps = 3/77 (3%)

Query: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPT---TAVEVVKKLVKNEGLRGFYKGTLT 83
            ++ G A     V + QP D  K R+ +    T     +  + ++   EG+  F+KG++ 
Sbjct: 197 SVITGLATSFTLVAMTQPIDVVKTRMMSQNAKTEYKNTLNCMYRIFVQEGMATFWKGSIF 256

Query: 84  PLVGVGACVSCQFGVNE 100
             + VG      F V E
Sbjct: 257 RFMKVGISGGLTFTVYE 273

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 67/164 (40%), Gaps = 17/164 (10%)

Query: 44  PFDTTKVRLQTSTTPTTA--VEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEA 101
           P D  K R+Q   T      V   +K++  EG      G    L+G     + +FG  E 
Sbjct: 33  PIDVVKTRIQLEPTVYNKGMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQGAFKFGGYEV 92

Query: 102 MKRFFRGSSADPHKTLTLPQYYICGFVGGVANS-FLAS----PIEHVRIRLQTQT--ASG 154
            K+FF     D     T  +Y    ++G  A + FLA     P+E  RIRL +Q   A+G
Sbjct: 93  FKKFF----IDTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEATRIRLVSQPTFANG 148

Query: 155 TVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYE 198
            V  F      I K    G+   G +P + ++       FL +E
Sbjct: 149 LVGGF----SRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFE 188

 Score = 33.5 bits (75), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 71/168 (42%), Gaps = 17/168 (10%)

Query: 139 PIEHVRIRLQTQTASGTVAEFKGPLDCINKLRAN---GALMRGLSPTILREAQGCATYFL 195
           PI+ V+ R+Q +    TV   KG +    K+ A    GAL+ G  PT+L  +   A  F 
Sbjct: 33  PIDVVKTRIQLEP---TVYN-KGMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQGAFKFG 88

Query: 196 TYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLT---VYPLDVIK-SLMQTDNLKN 251
            YE      I   +       +K  ++   +    +L    + PL+  +  L+      N
Sbjct: 89  GYEVFKKFFIDT-LGYDTAARYKNSVYIGSAAAAEFLADIALCPLEATRIRLVSQPTFAN 147

Query: 252 PVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELA 299
            + G      +R++  + G  SF+ GF P + +  P N A F  FE A
Sbjct: 148 GLVGG----FSRILKEE-GVGSFYSGFTPILFKQIPYNIAKFLVFERA 190

>Scas_715.45
          Length = 305

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 61/144 (42%), Gaps = 15/144 (10%)

Query: 6   SSPLLIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTP--TTAVE 63
           S+ L+ D+     + +   L  L + TA   A +++  PF+  KV+ QT+  P     +E
Sbjct: 100 STHLVKDEATAYKYRTSIYL--LSSATAEFFADIMLC-PFEAIKVKQQTTMPPWCNNVIE 156

Query: 64  VVKKLVKNEGLRGFYKGTLTPLVGVGAC-----VSCQFGVNEAMKRFFRGSSADPHKTLT 118
             KK+   EGL GFYKG +TPL     C       C+F   E +              ++
Sbjct: 157 GWKKMYAKEGLNGFYKG-ITPL----WCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMS 211

Query: 119 LPQYYICGFVGGVANSFLASPIEH 142
             Q     FVGG     L + + H
Sbjct: 212 ALQQISVSFVGGYMAGILCAIVSH 235

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 3/62 (4%)

Query: 236 PLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFAT 295
           P + IK   QT     P    N+I+  + + AK G   F+KG  P   R  P     F +
Sbjct: 135 PFEAIKVKQQTTM---PPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTS 191

Query: 296 FE 297
           FE
Sbjct: 192 FE 193

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 64/276 (23%), Positives = 110/276 (39%), Gaps = 38/276 (13%)

Query: 44  PFDTTKVRLQT----STTPTTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVN 99
           PF+  K RLQ     S      + ++ +  + +G    Y G    +VG     +C+ GV 
Sbjct: 30  PFEFAKTRLQLAQQGSGESRNPLVLLYRTARTQGAGALYVGCPAFVVG----NTCKAGVR 85

Query: 100 ----EAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLA-SPIEHVRIRL-QTQTAS 153
               +A++R  +    D    L+ P+  + G   G+  S LA +P E V+  L   + A+
Sbjct: 86  FLGFDALRRALQ----DERGALSGPRGMLAGLGAGLLESVLAVTPFEAVKTALIDDRQAA 141

Query: 154 GTVAEFKGPLDCINKLRANGALMRGLS-----PTILREAQGCATYFLTYEALVANQIGKG 208
               +  G     N       L          P  LR+A   A  F  Y      Q+ + 
Sbjct: 142 RPRYQHNGRGAARNYALLLRELGLRGLYGGLVPVALRQASNQAVRFGCY-----TQLKQA 196

Query: 209 IAR-----SDVP--AWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQV 261
           + R     +D P  + +  L GA+SG+       P+D +K+ MQ     +  R  + +  
Sbjct: 197 VQRYAGTPADQPLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQA---LDAARYGSTVGC 253

Query: 262 ARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297
            R V  + G ++ ++G  P + R   + G  F  +E
Sbjct: 254 FRAVVREEGVRALWRGATPRLGRLVLSGGIVFTAYE 289

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 66/310 (21%), Positives = 116/310 (37%), Gaps = 53/310 (17%)

Query: 30  AGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA--VEVVKKLVKNEGLRGFYKGTLTPLVG 87
           AG+  G+    +  PF+  K  LQ       A   EV+   V     R ++ G     +G
Sbjct: 15  AGSVSGLFSATITYPFEFLKTGLQLHRNVVAAKPFEVLGYQV-----RTYFAGCSAVNIG 69

Query: 88  VGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRI-- 145
           V    S +F   +    + R  +      L+  Q  + G + G   S    P E+V++  
Sbjct: 70  VVMKTSLRFLAFDKASEWLRPPALAKDAPLSGVQLLMAGALTGTMESLCIIPFENVKVAM 129

Query: 146 ---------RLQTQTAS--GTVA-EFKGPLDCINKLRAN--------------------- 172
                    RL T T++  G VA E K        LR++                     
Sbjct: 130 IQNSLLSHERLNTTTSNVQGQVANEVKKTFHKKPTLRSSYEALFPEKLPTNVLTTAAELY 189

Query: 173 -----GALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSG 227
                 A  +G  PT++R+       F T+  L   Q      +++   +   L G +S 
Sbjct: 190 RQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTML--KQFAPKEYQNN--EYFATLLGLISS 245

Query: 228 VTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAP 287
             +     PLDVIK+ MQ  +  + +  +N I  A  +  + G+   +KG+ P +++   
Sbjct: 246 CAVVGATQPLDVIKTRMQAKD--SVLLYRNSINCAYRIFVEEGFAMLWKGWLPRLMKVGL 303

Query: 288 ANGATFATFE 297
           +   +F  ++
Sbjct: 304 SGSVSFGIYQ 313

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 24/42 (57%)

Query: 257 NIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFEL 298
           N++  A  +  ++G +++FKG  PT++R    +   F TF +
Sbjct: 180 NVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTM 221

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 66/284 (23%), Positives = 108/284 (38%), Gaps = 32/284 (11%)

Query: 43  QPFDTTKVRLQTSTTPTTA-----VEVVKKLVKNEGLR-GFYKGTLTPLVGVGACVSCQF 96
              DT K R Q +  P+T      +   + ++  EGLR G Y G    ++G     +  F
Sbjct: 74  HSLDTVKTRQQGA--PSTVKYKNMIGAYRTIILEEGLRKGLYGGYSGAMLGSFPSAAIFF 131

Query: 97  GVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASG-- 154
              E  KR   G     ++T +   +   GF+G   +SF+  P E ++ RLQ Q      
Sbjct: 132 ATYEYTKRKMIGEWG-INETFS---HLTAGFLGDFISSFVYVPSEVLKTRLQLQGRYNNP 187

Query: 155 ---TVAEFKGPLDCINKL-RANG--ALMRGLSPTILREAQGCATYFLTYEAL--VANQIG 206
              +   +K   D +  + R  G   L  G   T+ R+       F  YE    +A  + 
Sbjct: 188 FFRSGYNYKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPFSGLQFAFYEKFRQLAFAVE 247

Query: 207 KGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQT----------DNLKNPVRGK 256
                 D+      + GA +G    +   PLDV+K+ +QT           NLK      
Sbjct: 248 NKTFDEDLSLSNEIITGAAAGGLAGIITTPLDVVKTRIQTQLPDIPENSSQNLKQQTLTN 307

Query: 257 NIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAM 300
           +I +    V    G    F G GP  +  +  +      +++A+
Sbjct: 308 SITKGMMTVYKTEGLAGLFSGVGPRFIWTSIQSSIMLLLYQVAL 351

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 56/215 (26%), Positives = 91/215 (42%), Gaps = 26/215 (12%)

Query: 44  PFDTTKVRLQTS-------TTPTTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQF 96
           P  T   R+Q S       T   + +E V+++ + EG+ GFY G  + + G+ A     +
Sbjct: 36  PLVTLATRMQVSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYGMAANSLNYY 95

Query: 97  GVNEAMKRF---FRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQT-QTA 152
              E   R     RGS     + L   +  +   V G   +  ++PI  V  R+   ++ 
Sbjct: 96  YFYELAARATMRVRGS-----RRLNTSEAILSSAVAGSMTAIASNPIWVVNTRMTVAKSE 150

Query: 153 SGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARS 212
             T+A     LD + K     AL  GL P ++  +     Y + +E L  N + K  + S
Sbjct: 151 QSTLAVL---LDIVRK-DGVTALFNGLRPALMLVSNPIIQYTV-FEQL-KNVVLKW-SGS 203

Query: 213 DV--PAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQ 245
           DV  P+W   L GAV  +    + YP   +K+ M 
Sbjct: 204 DVLLPSWAF-LLGAVGKLAATGSTYPYITLKTRMH 237

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 82/213 (38%), Gaps = 24/213 (11%)

Query: 44  PFDTTKVRLQT-----STTPTTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGV 98
           P  T   +LQT     +    + +E +K++ + +GL GFY G  + + G+       +  
Sbjct: 33  PLVTITTKLQTQGNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALTNFVYYYF 92

Query: 99  NEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRL----QTQTASG 154
            E   R         HK L   +  + G V G   +  ++PI     R+      +TA  
Sbjct: 93  YELTSR--NVLKVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRMTVTKSEKTALA 150

Query: 155 TVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATY--FLTYEALVANQIGKGIARS 212
           T+ E       I K  +   L  GL P ++        Y  F   + LV     +GI   
Sbjct: 151 TIIE-------IVKKDSAKTLFNGLKPALVLVMNPIVQYTVFEQLKNLVLAWNKQGILS- 202

Query: 213 DVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQ 245
             P+W   L GA+  +    + YP   +K+ M 
Sbjct: 203 --PSWAF-LLGALGKLAATGSTYPYITLKTRMH 232

>Kwal_55.21338
          Length = 323

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 77/181 (42%), Gaps = 8/181 (4%)

Query: 26  KDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYKGTLTPL 85
           + +L G+  G        P      R+    +    +  +  +VK+EG+ G +KG L P 
Sbjct: 120 ESMLVGSIAGSLNATAANPLWVANTRMTVQKSDRGTLSTIFDIVKDEGISGLFKG-LNPA 178

Query: 86  VGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRI 145
           + +      Q+ V E +K +    S+   +TL+    +I G VG +A +    P   ++ 
Sbjct: 179 LILVINPIIQYTVYEQLKNWIL--SSRQTRTLSPSWAFILGAVGKLAATGSTYPYVTMKA 236

Query: 146 RLQT--QTASGTVAEFKGPLDCINK-LRANG--ALMRGLSPTILREAQGCATYFLTYEAL 200
           R+    +  S T A  +  L  + + ++ +G   L RG+   +++     A  F   E L
Sbjct: 237 RMHLLGEHKSSTAAPPRSLLSLMAEIIKKDGILGLYRGIGIKLVQSILTAAFLFFFKEGL 296

Query: 201 V 201
           V
Sbjct: 297 V 297

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 57/248 (22%), Positives = 97/248 (39%), Gaps = 18/248 (7%)

Query: 2   PEETSSPLLIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTT---P 58
           P+ T S + ID     P  +      L  G  G ++  L   P      +LQT       
Sbjct: 6   PKSTGSMVAID-----PSQADAFAHALAGGAGGAISMTLT-YPLIVVTTKLQTQDAKGEK 59

Query: 59  TTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLT 118
            +  + +K + + +G  GF+ G  + L G        +   EA  R      A   + LT
Sbjct: 60  LSLADTIKDIYRKDGAMGFFAGLESALFGTTLSNFVYYYCYEASSRCVL--RARHTQRLT 117

Query: 119 LPQYYICGFVGGVANSFLASPIEHVRIRLQTQTAS-GTVAEFKGPLDCINKLRANGALMR 177
             +  + G + G  N+  A+P+     R+  Q +  GT++      D +     +G L +
Sbjct: 118 TAESMLVGSIAGSLNATAANPLWVANTRMTVQKSDRGTLSTI---FDIVKDEGISG-LFK 173

Query: 178 GLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPL 237
           GL+P ++        Y + YE L    +     R+  P+W   L GAV  +    + YP 
Sbjct: 174 GLNPALILVINPIIQYTV-YEQLKNWILSSRQTRTLSPSWAFIL-GAVGKLAATGSTYPY 231

Query: 238 DVIKSLMQ 245
             +K+ M 
Sbjct: 232 VTMKARMH 239

>Scas_673.17
          Length = 314

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 90/207 (43%), Gaps = 30/207 (14%)

Query: 109 SSADPHKTLTLPQYY--------ICGFVG-GVANSFLASPIEHVRIRLQTQTASGTVAEF 159
           ++ D HK   +P Y         + G +G G  +S L  P++ V+ R+Q +    TV   
Sbjct: 5   TTTDAHK---IPDYAASDYFKFALAGAIGCGTTHSSLV-PVDVVKTRIQLEP---TVYN- 56

Query: 160 KGPLDCINKLRAN---GALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPA 216
           KG +    K+ A+   GAL+ G  PT+L  +   A  F  YE      I   I   +   
Sbjct: 57  KGMVGSFKKIIADEGAGALLTGFGPTLLGYSVQGAFKFGGYEVFKKLSIDT-IGYENAVH 115

Query: 217 WKLCLFGAVSGVTLWLT---VYPLDVIK-SLMQTDNLKNPVRGKNIIQVARLVNAKYGWK 272
           +K  ++   + V  +L    + PL+  +  L+      N + G      +R++  + G  
Sbjct: 116 YKNSVYMGSAAVAEFLADIALCPLEATRIRLVSQPTFANGLVGG----FSRILKEE-GVG 170

Query: 273 SFFKGFGPTMLRAAPANGATFATFELA 299
           SF+ GF P + +  P N A F  FE A
Sbjct: 171 SFYSGFTPILFKQIPYNIAKFLVFERA 197

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 2/80 (2%)

Query: 27  DLLAGTAGGMAQVLVGQPFDT--TKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYKGTLTP 84
           +LL+G   G A   V QP DT  +KV         + + ++ +L K  G+ G + G  T 
Sbjct: 220 NLLSGLTAGFAAAFVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLGVIGSFAGLPTR 279

Query: 85  LVGVGACVSCQFGVNEAMKR 104
           L+ VG   S QF +  ++K 
Sbjct: 280 LIMVGTLTSLQFAIYGSLKN 299

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 64/164 (39%), Gaps = 17/164 (10%)

Query: 44  PFDTTKVRLQTSTTPTTA--VEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEA 101
           P D  K R+Q   T      V   KK++ +EG      G    L+G     + +FG  E 
Sbjct: 40  PVDVVKTRIQLEPTVYNKGMVGSFKKIIADEGAGALLTGFGPTLLGYSVQGAFKFGGYEV 99

Query: 102 MKRFFRGSSADPHKTLTLPQYYICGFVGGVA-NSFLAS----PIEHVRIRLQTQT--ASG 154
            K+     S D         Y    ++G  A   FLA     P+E  RIRL +Q   A+G
Sbjct: 100 FKKL----SIDTIGYENAVHYKNSVYMGSAAVAEFLADIALCPLEATRIRLVSQPTFANG 155

Query: 155 TVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYE 198
            V  F      I K    G+   G +P + ++       FL +E
Sbjct: 156 LVGGF----SRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFE 195

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 55/128 (42%), Gaps = 6/128 (4%)

Query: 170 RANGALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVT 229
           R      +G  PTI R+    A  F TY  L    I      S+  A+ + +F + + V 
Sbjct: 204 RGFTTFFQGSMPTIFRQVGNSAVRFTTYTTL-KQMISPNKPLSEYYAFGIGVFSSCAVVA 262

Query: 230 LWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPAN 289
           L     P+DV+K+ MQ+    +  R  N +        + G  S +KG+ P + +   + 
Sbjct: 263 L---TQPIDVVKTRMQSKYTWSLYR--NSLNCVYRTFIEEGLTSLWKGWVPRLFKVGLSG 317

Query: 290 GATFATFE 297
           G +F  ++
Sbjct: 318 GVSFGVYQ 325

 Score = 32.7 bits (73), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 31/71 (43%), Gaps = 3/71 (4%)

Query: 31  GTAGGMAQVLVGQPFDTTKVRLQTSTTPT---TAVEVVKKLVKNEGLRGFYKGTLTPLVG 87
           G     A V + QP D  K R+Q+  T +    ++  V +    EGL   +KG +  L  
Sbjct: 253 GVFSSCAVVALTQPIDVVKTRMQSKYTWSLYRNSLNCVYRTFIEEGLTSLWKGWVPRLFK 312

Query: 88  VGACVSCQFGV 98
           VG      FGV
Sbjct: 313 VGLSGGVSFGV 323

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 60/135 (44%), Gaps = 14/135 (10%)

Query: 28  LLAGTAGGMAQVLVGQPF-------DTTKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYKG 80
           ++ G +GG+AQ  +   F       + TK +   +    ++    K++   EG+RG  KG
Sbjct: 109 IMGGVSGGVAQAYLTMGFCTCMKTVEITKHKSAAAGAKQSSWAAFKEIYNKEGIRGINKG 168

Query: 81  TLTPLVGVGACVSCQFG----VNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFL 136
                +        +FG    V E +++F      +P   LT  +      +GG  +++ 
Sbjct: 169 VNAVAIRQMTNWGSRFGFSRLVEEGLRKF--TGKTNPDDKLTALEKIFASAIGGGLSAW- 225

Query: 137 ASPIEHVRIRLQTQT 151
             PIE +R+ +Q++T
Sbjct: 226 NQPIEVIRVEMQSKT 240

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 64/164 (39%), Gaps = 17/164 (10%)

Query: 44  PFDTTKVRLQTSTTPTTA--VEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEA 101
           P D  K R+Q   T      +   K+++ +EG      G    L+G     S +FG  E 
Sbjct: 33  PIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGYEV 92

Query: 102 MKRFF-----RGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQT--ASG 154
            K+ F        + +   ++ +    I  F   +A      P+E  RIRL +Q   A+G
Sbjct: 93  FKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFADIA----LCPLEATRIRLVSQPTFANG 148

Query: 155 TVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYE 198
            V  F      I K    G+   G +P + ++       FL +E
Sbjct: 149 LVGGF----SRILKEEGAGSFYNGFTPILFKQIPYNIAKFLVFE 188

 Score = 35.4 bits (80), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 93/203 (45%), Gaps = 26/203 (12%)

Query: 109 SSADPHKTLT-LPQYYICGFVG-GVANSFLASPIEHVRIRLQ---TQTASGTVAEFKGPL 163
           S+A P  +L+   ++ + G +G G  +S +  PI+ V+ R+Q   T    G ++ FK  +
Sbjct: 2   SAAIPDYSLSDYAKFALAGAIGCGTTHSAMV-PIDVVKTRIQLEPTVYNKGMISSFKQII 60

Query: 164 DCINKLRANGALMRGLSPTILREA-QGCATY--FLTYEALVANQIGKGIARSDVPAWKLC 220
                    GAL+ G  PT+L  + QG   +  +  ++ L  + +G   A +    +K  
Sbjct: 61  SS----EGAGALLTGFGPTLLGYSLQGSFKFGGYEVFKKLFIDVLGYDQAVN----YKNS 112

Query: 221 LF---GAVSGVTLWLTVYPLDVIK-SLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFK 276
           ++    A++     + + PL+  +  L+      N + G      +R++  + G  SF+ 
Sbjct: 113 IYIGSAAIAEFFADIALCPLEATRIRLVSQPTFANGLVGG----FSRILKEE-GAGSFYN 167

Query: 277 GFGPTMLRAAPANGATFATFELA 299
           GF P + +  P N A F  FE A
Sbjct: 168 GFTPILFKQIPYNIAKFLVFERA 190

>Kwal_33.15597
          Length = 305

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 92/203 (45%), Gaps = 26/203 (12%)

Query: 109 SSADPHKTLT-LPQYYICGFVG-GVANSFLASPIEHVRIRLQ---TQTASGTVAEFKGPL 163
           S+A P  T++   ++ + G +G G  +S +  PI+ V+ R+Q   T    G ++ FK  +
Sbjct: 2   SAAIPQYTISDYAKFALAGAIGCGTTHSAMV-PIDVVKTRIQLEPTVYNKGMISSFKQII 60

Query: 164 DCINKLRANGALMRGLSPTIL-REAQGCATY--FLTYEALVANQIGKGIARSDVPAWKLC 220
                    GAL+ G  PT+L    QG   +  +  ++ L  + +G   A +    +K  
Sbjct: 61  SS----EGAGALLTGFGPTLLGYSLQGSFKFGGYEVFKKLFIDTLGYDQAVN----YKNS 112

Query: 221 LF---GAVSGVTLWLTVYPLDVIK-SLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFK 276
           ++    A++     + + PL+  +  L+      N + G      +R++  + G  SF+ 
Sbjct: 113 IYIGSAAIAEFFADIALCPLEATRIRLVSQPTFANGLVGG----FSRILKEE-GLSSFYN 167

Query: 277 GFGPTMLRAAPANGATFATFELA 299
           GF P + +  P N A F  FE A
Sbjct: 168 GFTPILFKQIPYNIAKFLVFERA 190

 Score = 35.8 bits (81), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 63/164 (38%), Gaps = 17/164 (10%)

Query: 44  PFDTTKVRLQTSTTPTTA--VEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEA 101
           P D  K R+Q   T      +   K+++ +EG      G    L+G     S +FG  E 
Sbjct: 33  PIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGYEV 92

Query: 102 MKRFF-----RGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQT--ASG 154
            K+ F        + +   ++ +    I  F   +A      P+E  RIRL +Q   A+G
Sbjct: 93  FKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIA----LCPLEATRIRLVSQPTFANG 148

Query: 155 TVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYE 198
            V  F      I K     +   G +P + ++       FL +E
Sbjct: 149 LVGGF----SRILKEEGLSSFYNGFTPILFKQIPYNIAKFLVFE 188

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 3/72 (4%)

Query: 17  QPHDSGRV--LKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTP-TTAVEVVKKLVKNEG 73
             +D+G +  +++ + G    M   LV QP    K  LQ++ +  TT  E +  L KNEG
Sbjct: 213 HSNDAGSLSAVQNFILGVLSKMISTLVTQPLIVAKAMLQSAGSKFTTFQEALLYLYKNEG 272

Query: 74  LRGFYKGTLTPL 85
           L+  +KG L  L
Sbjct: 273 LKSLWKGVLPQL 284

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 71/182 (39%), Gaps = 17/182 (9%)

Query: 26  KDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA--VEVVKKLVKNEGLRGFYKGTLT 83
           K  LAG  G  A      P D  K R+Q      ++  V   +K+V  EG      G   
Sbjct: 17  KFALAGAIGCGATHSAMVPIDVVKTRIQLEPLKYSSGMVGSFRKIVGEEGAAALLTGFGP 76

Query: 84  PLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVA-NSFLAS---- 138
            L+G     + +FG  E  K+ F     D     T  QY    ++G  A   F A     
Sbjct: 77  TLLGYSMQGAFKFGGYEVFKKAF----VDALGYETACQYRTPIYIGSAAIAEFFADIALC 132

Query: 139 PIEHVRIRLQTQT--ASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLT 196
           P+E  RIRL +Q   A+G V  F      I K    G+   G +P + ++       F+ 
Sbjct: 133 PLEATRIRLVSQPTFANGLVGGFA----RILKEEGIGSFYNGFTPILFKQIPYNIAKFVV 188

Query: 197 YE 198
           +E
Sbjct: 189 FE 190

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 82/195 (42%), Gaps = 18/195 (9%)

Query: 113 PHKTLT-LPQYYICGFVGGVANSFLASPIEHVRIRLQTQ---TASGTVAEFKGPLDCINK 168
           P+ +L+   ++ + G +G  A      PI+ V+ R+Q +    +SG V  F+     I  
Sbjct: 8   PNYSLSDYAKFALAGAIGCGATHSAMVPIDVVKTRIQLEPLKYSSGMVGSFRK----IVG 63

Query: 169 LRANGALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLF---GAV 225
                AL+ G  PT+L  +   A  F  YE      +   +       ++  ++    A+
Sbjct: 64  EEGAAALLTGFGPTLLGYSMQGAFKFGGYEVFKKAFV-DALGYETACQYRTPIYIGSAAI 122

Query: 226 SGVTLWLTVYPLDVIK-SLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLR 284
           +     + + PL+  +  L+      N + G      AR++  + G  SF+ GF P + +
Sbjct: 123 AEFFADIALCPLEATRIRLVSQPTFANGLVGG----FARILKEE-GIGSFYNGFTPILFK 177

Query: 285 AAPANGATFATFELA 299
             P N A F  FE A
Sbjct: 178 QIPYNIAKFVVFEHA 192

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 2/67 (2%)

Query: 40  LVGQPFDT--TKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFG 97
           ++ QP DT  +KV         +   ++ +L K  G  G + G  T LV VG   S QFG
Sbjct: 228 VISQPADTLLSKVNKTKKAPGQSTFGLLMQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFG 287

Query: 98  VNEAMKR 104
           +   +K+
Sbjct: 288 IYGKLKQ 294

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 68/164 (41%), Gaps = 16/164 (9%)

Query: 44  PFDTTKVRLQTS-TTPTTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAM 102
           P D  K RLQ +    T+ ++  +K++ NEG +  Y G     VG     + ++G  E  
Sbjct: 38  PLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYF 97

Query: 103 KRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEF-KG 161
           K  +  S   P  T+ L       F+  +    +  P E ++++ QT     T+  F   
Sbjct: 98  KHLY-SSWLSPGVTVYLMASATAEFLADI----MLCPFEAIKVKQQT-----TMPPFCNN 147

Query: 162 PLDCINKLRANG----ALMRGLSPTILREAQGCATYFLTYEALV 201
            +D   K+ A      A  +G+ P   R+       F ++E +V
Sbjct: 148 VVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIV 191

 Score = 32.3 bits (72), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 4/65 (6%)

Query: 233 TVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGAT 292
           ++ PLD++K  +Q     NP    + +Q  R + A  GWK  + GFG T +  +      
Sbjct: 35  SITPLDLVKCRLQV----NPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGK 90

Query: 293 FATFE 297
           +  +E
Sbjct: 91  YGGYE 95

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 82/187 (43%), Gaps = 19/187 (10%)

Query: 121 QYYICGFVG-GVANSFLASPIEHVRIRLQ---TQTASGTVAEFKGPLDCINKLRANGALM 176
           ++ + G +G G+ +S +  PI+ V+ R+Q   T    G V+ FK  +         GAL+
Sbjct: 15  KFALAGAIGCGITHSSMV-PIDVVKTRIQLEPTVYNKGMVSSFKQIISS----EGAGALL 69

Query: 177 RGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLF---GAVSGVTLWLT 233
            G  PT+L  +   +  F  YE      I   +   +   +K  ++    A++     + 
Sbjct: 70  TGFGPTLLGYSLQGSFKFGGYELFKKLAI-DNMGYDNAVNYKNTIYIGSAAIAEFFADIA 128

Query: 234 VYPLDVIK-SLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGAT 292
           + PL+  +  L+      N + G      +R++  + G  SF+ GF P + +  P N A 
Sbjct: 129 LCPLEATRIRLVSQPTFANGLFGG----FSRILKEE-GVGSFYNGFTPILFKQIPYNIAK 183

Query: 293 FATFELA 299
           F  FE A
Sbjct: 184 FFVFEHA 190

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 2/67 (2%)

Query: 40  LVGQPFDT--TKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFG 97
           +V QP DT  +KV         + + ++ +L K  G  G + G  T LV VG   S QFG
Sbjct: 226 VVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLGFVGSFTGLPTRLVMVGTLTSLQFG 285

Query: 98  VNEAMKR 104
           +   +K+
Sbjct: 286 IYGTLKK 292

 Score = 32.7 bits (73), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 62/164 (37%), Gaps = 17/164 (10%)

Query: 44  PFDTTKVRLQTSTTPTTA--VEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEA 101
           P D  K R+Q   T      V   K+++ +EG      G    L+G     S +FG  E 
Sbjct: 33  PIDVVKTRIQLEPTVYNKGMVSSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGYEL 92

Query: 102 MKRFF-----RGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQT--ASG 154
            K+         ++ +   T+ +    I  F   +A      P+E  RIRL +Q   A+G
Sbjct: 93  FKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIA----LCPLEATRIRLVSQPTFANG 148

Query: 155 TVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYE 198
               F      I K    G+   G +P + ++       F  +E
Sbjct: 149 LFGGF----SRILKEEGVGSFYNGFTPILFKQIPYNIAKFFVFE 188

>Scas_613.24
          Length = 177

 Score = 36.6 bits (83), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 35/170 (20%), Positives = 74/170 (43%), Gaps = 21/170 (12%)

Query: 122 YYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSP 181
           + + GF+GG++++    P++ ++ R+Q    +   +  K   D I          RG  P
Sbjct: 11  HLVSGFIGGLSSAVTLQPLDLLKTRIQQHKGATLWSAIKDIKDPIQ-------FWRGTLP 63

Query: 182 TILREAQGCATYFLTYEALVANQIGKGIARS--------DVPAWKLCLFGAVS-GVTLWL 232
           + LR + G A Y      +    +      +         +  ++  L GA++ G+  ++
Sbjct: 64  SALRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTGAMARGLVGYI 123

Query: 233 TVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTM 282
           T+ P+ ++K   ++         K++ +  + +    G   FFKGFGPT+
Sbjct: 124 TM-PITILKVRYESTYYSY----KSMNEAIKDIYKMEGISGFFKGFGPTV 168

 Score = 28.9 bits (63), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 73/178 (41%), Gaps = 21/178 (11%)

Query: 15  DQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPT--TAVEVVKKLVKNE 72
           D+ P  S      L++G  GG++  +  QP D  K R+Q     T  +A++ +K  ++  
Sbjct: 3   DKSPKTS----VHLVSGFIGGLSSAVTLQPLDLLKTRIQQHKGATLWSAIKDIKDPIQ-- 56

Query: 73  GLRGFYKGTLTPL----VGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFV 128
               F++GTL       +G    +SC   +   +    +GS+A    +L     Y     
Sbjct: 57  ----FWRGTLPSALRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLT 112

Query: 129 GGVAN---SFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSPTI 183
           G +A     ++  PI  +++R ++   S         +  I K+       +G  PT+
Sbjct: 113 GAMARGLVGYITMPITILKVRYESTYYS--YKSMNEAIKDIYKMEGISGFFKGFGPTV 168

>Kwal_23.3529
          Length = 395

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 63/265 (23%), Positives = 95/265 (35%), Gaps = 26/265 (9%)

Query: 41  VGQPFDTTKVRLQTSTTP---TTAVEVVKKLVKNEGLR-GFYKGTLTPLVGVGACVSCQF 96
           V    DT K R Q +         +   +K+   EG+R G Y G    ++G     +  F
Sbjct: 102 VMHSLDTVKTRQQGAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAIFF 161

Query: 97  GVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQ------ 150
           G  E  KR       D         +   G  G + +S +  P E ++ RLQ Q      
Sbjct: 162 GTYELTKR----KLIDDWGVNETLSHLTAGLSGDLVSSVVYVPSEVLKTRLQLQGCYNNP 217

Query: 151 --TASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYEALV--ANQIG 206
              +       +  +  I +L     L  G   T+ R+    A  F  YE     A  + 
Sbjct: 218 HFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFRQWAFTLE 277

Query: 207 KGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQT-------DNLKNPVRGKN-I 258
                 D+      L GA +G    +   P+DVIK+ +QT        +    VR +N +
Sbjct: 278 GKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQMPSTVASDSTRLVRIENSL 337

Query: 259 IQVARLVNAKYGWKSFFKGFGPTML 283
           I+    V    G   FF G GP  +
Sbjct: 338 IKGLTAVYRSEGTLGFFSGVGPRFI 362

>Kwal_34.15907
          Length = 312

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 59/134 (44%), Gaps = 13/134 (9%)

Query: 28  LLAGTAGGMAQVLVGQPF-------DTTKVRLQTS-TTPTTAVEVVKKLVKNEGLRGFYK 79
           ++ G +GG+AQ  +   F       + TK +   +   P ++    K++   EG++G  K
Sbjct: 112 IMGGVSGGVAQAYLTMGFCTCMKTVEITKAKSAVAGAIPQSSWSAFKEIYSKEGIKGINK 171

Query: 80  GTLTPLVGVGACVSCQFGVNEAMK---RFFRGSSADPHKTLTLPQYYICGFVGGVANSFL 136
           G     +        +FG++  ++   R F G +    K   L + +     GG+  S  
Sbjct: 172 GVNAVAIRQMTNWGSRFGLSRLVEQGIRDFTGKTNPDDKLTALEKIFASALGGGL--SAW 229

Query: 137 ASPIEHVRIRLQTQ 150
             PIE +R+ +Q++
Sbjct: 230 NQPIEVIRVEMQSK 243

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 57/135 (42%), Gaps = 14/135 (10%)

Query: 28  LLAGTAGGMAQVLVGQPF----DTTKVRLQTSTT-----PTTAVEVVKKLVKNEGLRGFY 78
           ++ G  GG+ Q  +   F     T ++  Q +       P ++ +V K + K EG+RG  
Sbjct: 106 IMGGITGGVTQAYLTMGFCTCMKTVEITRQKAANVPGVIPQSSWQVFKSIYKKEGIRGIN 165

Query: 79  KGTLTPLVGVGACVSCQFGVNEAMK---RFFRGSSADPHKTLTLPQYYICGFVGGVANSF 135
           KG     +        +FG++  ++   R   G +    K   L +       GG+  S 
Sbjct: 166 KGVNAVAIRQMTNWGSRFGLSRLVEDGIRKLTGKTGKDDKLTALEKIMASAIGGGL--SA 223

Query: 136 LASPIEHVRIRLQTQ 150
              PIE +R+ +Q++
Sbjct: 224 WNQPIEVIRVEMQSK 238

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 44/94 (46%), Gaps = 13/94 (13%)

Query: 7   SPLLIDDIDQQPHDSGR-----VLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTP--- 58
           S L+ D I +    +G+      L+ ++A   GG       QP +  +V +Q+       
Sbjct: 186 SRLVEDGIRKLTGKTGKDDKLTALEKIMASAIGGGLSAW-NQPIEVIRVEMQSKKEDPNR 244

Query: 59  ---TTAVEVVKKLVKNEGLRGFYKGTLTPLVGVG 89
               T  +  K + ++ GL+G Y+G +TP VG+G
Sbjct: 245 PKNLTVGKTFKYIYQSNGLKGLYRG-VTPRVGLG 277

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 35.0 bits (79), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 59/153 (38%), Gaps = 18/153 (11%)

Query: 44  PFDTTKVRLQT---STTPTTAVEVVKKLV---KNEGLRGFYKGTLTPLVGVGACVSCQFG 97
           P    K R+Q       P     + ++LV   K+ G+RG Y+G    L+  G   + Q  
Sbjct: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196

Query: 98  VNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVA 157
           V    K        D      +  Y +   +  VA     +P +    R+          
Sbjct: 197 VYSHAKEALSRHVPD-----GMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRG----G 247

Query: 158 EFKGPLDCINK-LRANG--ALMRGLSPTILREA 187
            ++GPLDC+ K +R  G  AL +G    +LR A
Sbjct: 248 LYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIA 280

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 35.0 bits (79), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 64/134 (47%), Gaps = 11/134 (8%)

Query: 28  LLAGTAGGMAQVLVGQPFDTTK-----VRLQTSTTPT----TAVEVVKKLVKNEGLRGFY 78
           +L G +GG+AQ  +   F T        R + ++ P     ++++V K++   EGLRG  
Sbjct: 111 ILGGVSGGVAQAYLTMGFCTCMKTVEITRSKAASAPGVPVPSSLQVFKQIFAAEGLRGIN 170

Query: 79  KGTLTPLVGVGACVSCQFGVNEAMKRFFRG-SSADPHKTLTLPQYYICGFVGGVANSFLA 137
           KG     +        +FG++  ++   R  +     + L+  +  +   +GG  +++  
Sbjct: 171 KGVNAVAIRQMTNWGSRFGLSRLVEDGIRRVTHKRSDEKLSAMEKIVASALGGGLSAW-N 229

Query: 138 SPIEHVRIRLQTQT 151
            PIE +R+ +Q++T
Sbjct: 230 QPIEVIRVEMQSRT 243

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 43/93 (46%), Gaps = 12/93 (12%)

Query: 7   SPLLIDDIDQQPHDSG----RVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTP---- 58
           S L+ D I +  H         ++ ++A   GG       QP +  +V +Q+ T      
Sbjct: 191 SRLVEDGIRRVTHKRSDEKLSAMEKIVASALGGGLSAW-NQPIEVIRVEMQSRTNDPNRP 249

Query: 59  --TTAVEVVKKLVKNEGLRGFYKGTLTPLVGVG 89
              T  +  + + +N GLRG Y+G +TP +G+G
Sbjct: 250 KNLTVGKTFRYIYENNGLRGLYRG-VTPRIGLG 281

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 34.3 bits (77), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 57/134 (42%), Gaps = 13/134 (9%)

Query: 28  LLAGTAGGMAQVLVGQPF----DTTKVRLQTSTT----PTTAVEVVKKLVKNEGLRGFYK 79
           +L G  GG+ Q  +   F     T ++    S +    P ++  V K + K EG+RG  K
Sbjct: 114 ILGGVTGGVTQAYLTMGFCTCMKTVEITRHKSASAGGVPQSSWSVFKNIYKKEGIRGINK 173

Query: 80  GTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICG---FVGGVANSFL 136
           G     +        +FG++  ++   R  +   +K   L  +   G     GG+  S  
Sbjct: 174 GVNAVAIRQMTNWGSRFGLSRLVEDGIRKITGKTNKDDKLNPFEKIGASALGGGL--SAW 231

Query: 137 ASPIEHVRIRLQTQ 150
             PIE +R+ +Q++
Sbjct: 232 NQPIEVIRVEMQSK 245

>Scas_696.9
          Length = 312

 Score = 34.3 bits (77), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 64/147 (43%), Gaps = 13/147 (8%)

Query: 46  DTTKVRLQTSTTPT-TAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKR 104
           + T+++  ++  P  ++  V + +   EGLRG YKG     +        +FG +  ++ 
Sbjct: 137 EITRLKSASAGAPVQSSWNVFRSIYAKEGLRGIYKGVNAVAIRQMTNWGSRFGFSRLVED 196

Query: 105 FFRGSSA--DPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASG------TV 156
           + R ++    P   L   +      VGG  +++   PIE +R+ +Q++          TV
Sbjct: 197 WVRKATGKTKPEDRLNAWEKIGATAVGGGLSAW-NQPIEVIRVEMQSKKEDPNRPKNLTV 255

Query: 157 AEFKGPLDCINKLRANGALMRGLSPTI 183
           A+       I K      L RG++P I
Sbjct: 256 AK---TFKYIMKTNGVKGLYRGVTPRI 279

>Kwal_23.5757
          Length = 307

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 83/193 (43%), Gaps = 20/193 (10%)

Query: 116 TLTLPQYYICGFVGGVA----NSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKL-R 170
           TL  P+YY    +GG+          +P++ V+ R Q        + +K  LD   ++ R
Sbjct: 12  TLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVD-----ASLYKSNLDGWRQIVR 66

Query: 171 ANGA--LMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGV 228
           + GA  +  G+  T +  +   A  +  YE    +Q  + ++     +++  +F A S  
Sbjct: 67  SEGATKVFTGVGATAIGYSLQGAFKYGGYE-FFKHQYSQLVSPETAHSYRTGIFLAASAS 125

Query: 229 TLWLT---VYPLDVIKSLMQTDNLKNPVRGKNIIQV-ARLVNAKYGWKSFFKGFGPTMLR 284
             ++    + P + IK   QT     P   +N+    +++V A+ G+ S +KG  P   R
Sbjct: 126 AEFIADIFLCPWEAIKVRQQTA--VPPPFARNVFDAYSKMVGAE-GFASLYKGITPLWFR 182

Query: 285 AAPANGATFATFE 297
             P     F +FE
Sbjct: 183 QIPYTMCKFTSFE 195

 Score = 31.6 bits (70), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 41/103 (39%), Gaps = 5/103 (4%)

Query: 44  PFDTTKVRLQTSTTPTTAVEVV---KKLVKNEGLRGFYKGTLTPLVGVGACVS-CQFGVN 99
           P++  KVR QT+  P  A  V     K+V  EG    YKG +TPL       + C+F   
Sbjct: 136 PWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKG-ITPLWFRQIPYTMCKFTSF 194

Query: 100 EAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEH 142
           E +          P + ++        F GG     L + + H
Sbjct: 195 ERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSH 237

>AEL060C [2446] [Homologous to NOHBY] (525069..526358) [1290 bp, 429
           aa]
          Length = 429

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 44/90 (48%), Gaps = 4/90 (4%)

Query: 124 IC-GFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGP-LDCINKLRANGAL--MRGL 179
           +C GF+ GVA +  ++PI+ +  R        +  ++    L  I+KL+  G +    G 
Sbjct: 160 VCAGFMAGVAQAVASAPIDAIYTRSTANDLLSSAKKYNSLWLYGIDKLKEIGLVGCFGGF 219

Query: 180 SPTILREAQGCATYFLTYEALVANQIGKGI 209
             ++++E+ G A YF T+E L      K I
Sbjct: 220 GLSLVKESVGFAVYFTTFELLKGQVCNKTI 249

 Score = 29.6 bits (65), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 5/127 (3%)

Query: 177 RGLSPTILREAQGCATY--FLTYEALVANQIGKGIARSDVPAW--KLCLFGAVSGVTLWL 232
           R L P +L  A G   Y  +L+  + +   +G G      P     +   G ++GV   +
Sbjct: 113 RVLPPLVLNSAAGVVLYTTYLSSLSFLRGPLGAGGEHGQSPPRISDVVCAGFMAGVAQAV 172

Query: 233 TVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAK-YGWKSFFKGFGPTMLRAAPANGA 291
              P+D I +    ++L +  +  N + +  +   K  G    F GFG ++++ +     
Sbjct: 173 ASAPIDAIYTRSTANDLLSSAKKYNSLWLYGIDKLKEIGLVGCFGGFGLSLVKESVGFAV 232

Query: 292 TFATFEL 298
            F TFEL
Sbjct: 233 YFTTFEL 239

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 68/157 (43%), Gaps = 14/157 (8%)

Query: 148 QTQTASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYEALVANQIGK 207
           + Q  +GT+  F+     I K      L RG+S T+L        YF  YE +       
Sbjct: 106 RNQKFNGTLEAFEK----IAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVRDRSPLN 161

Query: 208 GIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQ---TDNLKN--PVRGKNIIQVA 262
           G+     P     + GA +      +V PL++IK+ +Q   + ++KN   +  +++    
Sbjct: 162 GL----YPTINPLICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEI 217

Query: 263 RLVNAKYG-WKSFFKGFGPTMLRAAPANGATFATFEL 298
           +   A  G  ++ FKG   T+ R  P +   +A++E 
Sbjct: 218 KSEIAMRGVAQTMFKGLEITLWRDVPFSAIYWASYEF 254

 Score = 32.0 bits (71), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 113 PHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQ 150
           P  TLT+ +  +   VG +  S + +P++ VRIRLQ Q
Sbjct: 5   PPATLTIQERMMSATVGSLLTSVILTPMDVVRIRLQQQ 42

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 35/87 (40%), Gaps = 11/87 (12%)

Query: 123 YICGFVGGVANSFLASPIEHVRIRLQTQTAS-----------GTVAEFKGPLDCINKLRA 171
           ++ GF+ G   +    P +  + R Q    +           G+     G L+ I K   
Sbjct: 281 FLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKTEG 340

Query: 172 NGALMRGLSPTILREAQGCATYFLTYE 198
            GAL  GL+P + + A  CA    +YE
Sbjct: 341 IGALYTGLAPRVAKIAPSCAIMISSYE 367

>Scas_687.15*
          Length = 328

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 69/164 (42%), Gaps = 15/164 (9%)

Query: 29  LAGTAGGMAQVLVGQPFDTT---KVRLQTSTTPTTAV-EVVKKLVKNEGLRGFYKGTLTP 84
           +AGT        V +P   +   + R   S  P++ +  VVK++    GLRGF +G +  
Sbjct: 144 IAGTLKKKVTFHVAKPKQLSPQEQWRQVYSKYPSSNIFSVVKEIYLTRGLRGFAQGAMPT 203

Query: 85  LVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVR 144
           +    +  + +F     +K+        P + L     +  G     A   L  PI+ V+
Sbjct: 204 VFRQVSNSTVRFTAYTTLKQLI-----SPTQPLNEVYAFGIGLFSSCAVVALTQPIDVVK 258

Query: 145 IRLQTQTASGTVAEFKGPLDCINKLRANG---ALMRGLSPTILR 185
            R+Q++TA      +K  L+C  ++       +L +G  P + +
Sbjct: 259 TRMQSKTAHYF---YKNSLNCAYRVFVEEGMVSLWKGWLPRLFK 299

 Score = 31.6 bits (70), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 33/76 (43%), Gaps = 3/76 (3%)

Query: 31  GTAGGMAQVLVGQPFDTTKVRLQTSTTP---TTAVEVVKKLVKNEGLRGFYKGTLTPLVG 87
           G     A V + QP D  K R+Q+ T       ++    ++   EG+   +KG L  L  
Sbjct: 240 GLFSSCAVVALTQPIDVVKTRMQSKTAHYFYKNSLNCAYRVFVEEGMVSLWKGWLPRLFK 299

Query: 88  VGACVSCQFGVNEAMK 103
           VG      FGV + ++
Sbjct: 300 VGLSGGISFGVYQYVE 315

>KLLA0E22880g complement(2033077..2034387) similar to
           ca|CA2800|IPF11366 Candida albicans unknown function,
           hypothetical start
          Length = 436

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 3/79 (3%)

Query: 125 CGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGP-LDCINKLRANGAL--MRGLSP 181
            GF+ G A + +++PI+ +  R        +  ++    L   +K+R  G +    G   
Sbjct: 166 AGFLAGAAQAIVSAPIDAIYTRANIDELLSSAKKYDNLWLYSRDKIREIGLIGCFGGFGL 225

Query: 182 TILREAQGCATYFLTYEAL 200
           + +RE+ G A YF T+E +
Sbjct: 226 SFIRESFGFALYFTTFEMI 244

>YDR470C (UGO1) [1287] chr4 complement(1399694..1401202) Protein of
           the mitochondrial outer membrane required for
           mitochondrial fusion, member of the mitochondrial
           carrier family (MCF) of membrane transporters [1509 bp,
           502 aa]
          Length = 502

 Score = 32.3 bits (72), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 26/122 (21%), Positives = 47/122 (38%), Gaps = 7/122 (5%)

Query: 31  GTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGA 90
            TA  MA+       + T + L  +      ++V+  L   EG+RG +K   T  +    
Sbjct: 199 STAPIMAEETDHSHHEPTDISLTIAPQSLHTIDVINALFDQEGIRGLWKANNTTFIYNFL 258

Query: 91  CVSCQFGVNEAMKRFFRGSSADPH-----KTLTLPQYYICGFVGGVANSFLASPIEHVRI 145
            +S        +  F      DP+      +  + + +I     GV  S +  P++ +R 
Sbjct: 259 SLSIDTWFTGLLSSFL--GVPDPYFMEVINSPDISKSFILALGAGVFTSIILLPVDLIRT 316

Query: 146 RL 147
           RL
Sbjct: 317 RL 318

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 32.0 bits (71), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 2/68 (2%)

Query: 26  KDLLAGTAGGMAQVLVGQPFDTTKVRLQ-TSTTPTTAVEVVKKLVKNEGLRGFYKGTLTP 84
           ++ L G    M    V QP    K+ LQ   +   T  EV++ + +NEG    +KG + P
Sbjct: 223 ENFLLGMFSKMISTFVTQPLIVAKITLQGKGSKFKTFQEVLQHIYQNEGFLSLWKGVI-P 281

Query: 85  LVGVGACV 92
            V  G  V
Sbjct: 282 QVSKGVIV 289

 Score = 30.0 bits (66), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 9/68 (13%)

Query: 223 GAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRG--------KNIIQVARLVNAKYGWKSF 274
           GAV+      TVYPLD+ K+L+QT + KN   G        KN+I     +  K G+   
Sbjct: 10  GAVASSLAATTVYPLDLAKTLIQTQH-KNADSGDSKEEEKYKNVIDCIIKIFKKRGFLGL 68

Query: 275 FKGFGPTM 282
           ++G    +
Sbjct: 69  YQGLATNV 76

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
           Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 30.4 bits (67), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 35/84 (41%), Gaps = 9/84 (10%)

Query: 29  LAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLV--------KNEGLRGFYKG 80
           +   +GG+AQ LV  PFD  + R Q        +    K V        K EG +G+YKG
Sbjct: 16  MGAISGGVAQTLV-YPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEGPKGYYKG 74

Query: 81  TLTPLVGVGACVSCQFGVNEAMKR 104
               L  V    +  + V E ++ 
Sbjct: 75  LTANLFKVIPSTAVSWLVYEVIRE 98

 Score = 28.9 bits (63), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/85 (22%), Positives = 38/85 (44%), Gaps = 4/85 (4%)

Query: 217 WKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNP---VRGKNIIQVARLVNAKYGWKS 273
           +KL + GA+SG      VYP D+++   Q   +       R K++      +    G K 
Sbjct: 12  YKLAM-GAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEGPKG 70

Query: 274 FFKGFGPTMLRAAPANGATFATFEL 298
           ++KG    + +  P+   ++  +E+
Sbjct: 71  YYKGLTANLFKVIPSTAVSWLVYEV 95

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 29/67 (43%), Gaps = 2/67 (2%)

Query: 41  VGQPFDTTKVRLQTSTTP-TTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVN 99
           V  PFDT K R+Q   +  T +      +VKNE +   + G    L          +G+ 
Sbjct: 240 VTAPFDTIKTRMQLEPSKFTNSFNTFTSIVKNENVLKLFSGLSMRLARKAFSAGIAWGIY 299

Query: 100 EAM-KRF 105
           E + KRF
Sbjct: 300 EELVKRF 306

>Kwal_55.21106
          Length = 328

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query: 223 GAVSGVTLWLTVYPLDVIKSLMQTDNLKNP 252
           GAV+     + VYPLD++K+L+QT N K P
Sbjct: 10  GAVASSLANVVVYPLDLVKTLIQTQN-KEP 38

>YBR296C (PHO89) [473] chr2 complement(796754..798478) High-affinity
           Na+-dependent phosphate transporter [1725 bp, 574 aa]
          Length = 574

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 5/56 (8%)

Query: 203 NQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNI 258
           N IG   A+S+VP W L   G    +  W   Y  ++IK+L     L++P RG +I
Sbjct: 440 NTIG---AKSEVPVWVLAYGGVALVIGCW--TYGYNIIKNLGNKMILQSPSRGFSI 490

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.136    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,191,204
Number of extensions: 354348
Number of successful extensions: 2121
Number of sequences better than 10.0: 211
Number of HSP's gapped: 1247
Number of HSP's successfully gapped: 467
Length of query: 300
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 199
Effective length of database: 13,099,691
Effective search space: 2606838509
Effective search space used: 2606838509
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)