Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_27.1259033833417760.0
Sklu_1926.434533513670.0
YPR056W (TFB4)33833613250.0
Scas_667.2033833413160.0
ADL323C34133012341e-171
CAGL0D01650g33531411851e-164
KLLA0B08569g33734011331e-156
ABL180W68172653.6
Scas_685.27446104654.0
CAGL0I10318g90662645.3
KLLA0F19085g137265645.7
CAGL0F06369g88956629.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.12590
         (334 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.12590                                                         688   0.0  
Sklu_1926.4 YPR056W, Contig c1926 2998-4035 reverse complement        531   0.0  
YPR056W (TFB4) [5486] chr16 (671121..672137) RNA polymerase II t...   514   0.0  
Scas_667.20                                                           511   0.0  
ADL323C [1418] [Homologous to ScYPR056W (TFB4) - SH] (127631..12...   479   e-171
CAGL0D01650g complement(172035..173042) highly similar to tr|Q12...   461   e-164
KLLA0B08569g complement(756558..757571) similar to sgd|S0006260 ...   441   e-156
ABL180W [412] [Homologous to ScYNL216W (RAP1) - SH] complement(6...    30   3.6  
Scas_685.27                                                            30   4.0  
CAGL0I10318g complement(999605..1002325) similar to sp|P32504 Sa...    29   5.3  
KLLA0F19085g 1758111..1762229 similar to sgd|S0004081 Saccharomy...    29   5.7  
CAGL0F06369g complement(628054..630723) similar to sp|P36016 Sac...    28   9.8  

>Kwal_27.12590
          Length = 338

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/334 (100%), Positives = 334/334 (100%)

Query: 1   MDAISDPSFQNTKSKIAVAEELPSLLTVIVDTMPKVWAELDKEGSQEGSLISALQSLIVF 60
           MDAISDPSFQNTKSKIAVAEELPSLLTVIVDTMPKVWAELDKEGSQEGSLISALQSLIVF
Sbjct: 1   MDAISDPSFQNTKSKIAVAEELPSLLTVIVDTMPKVWAELDKEGSQEGSLISALQSLIVF 60

Query: 61  LNAHLSFNSANQVAVIAAHSTGIKYLFPTPPSSQEEPAAKSPDLSIINSNMYRQFRNVDE 120
           LNAHLSFNSANQVAVIAAHSTGIKYLFPTPPSSQEEPAAKSPDLSIINSNMYRQFRNVDE
Sbjct: 61  LNAHLSFNSANQVAVIAAHSTGIKYLFPTPPSSQEEPAAKSPDLSIINSNMYRQFRNVDE 120

Query: 121 TVLEELYKLLQDEKKRKIPSGFQKSTLSGAMSAGFTYINRVIKEQSTASLKARLMVMTCG 180
           TVLEELYKLLQDEKKRKIPSGFQKSTLSGAMSAGFTYINRVIKEQSTASLKARLMVMTCG
Sbjct: 121 TVLEELYKLLQDEKKRKIPSGFQKSTLSGAMSAGFTYINRVIKEQSTASLKARLMVMTCG 180

Query: 181 SSGGKDEIFQYIPIMNCIFSATKLKCPIDVVKIGGSQESTFLQQATDATNGVYLHVPSTE 240
           SSGGKDEIFQYIPIMNCIFSATKLKCPIDVVKIGGSQESTFLQQATDATNGVYLHVPSTE
Sbjct: 181 SSGGKDEIFQYIPIMNCIFSATKLKCPIDVVKIGGSQESTFLQQATDATNGVYLHVPSTE 240

Query: 241 GLIQYLTTAMFIDPSLRPIVVKPNQGSVDFRTSCYLTGKVVAVGFVCSVCLCVLSIIPPG 300
           GLIQYLTTAMFIDPSLRPIVVKPNQGSVDFRTSCYLTGKVVAVGFVCSVCLCVLSIIPPG
Sbjct: 241 GLIQYLTTAMFIDPSLRPIVVKPNQGSVDFRTSCYLTGKVVAVGFVCSVCLCVLSIIPPG 300

Query: 301 NKCPACDSEFDEHVTTKLKRRPVVPGIAAKKKKR 334
           NKCPACDSEFDEHVTTKLKRRPVVPGIAAKKKKR
Sbjct: 301 NKCPACDSEFDEHVTTKLKRRPVVPGIAAKKKKR 334

>Sklu_1926.4 YPR056W, Contig c1926 2998-4035 reverse complement
          Length = 345

 Score =  531 bits (1367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/335 (75%), Positives = 291/335 (86%), Gaps = 8/335 (2%)

Query: 1   MDAISDPSFQNTKSKIAVAEELPSLLTVIVDTMPKVWAELDKEGSQEGSLISALQSLIVF 60
           MDAISD +FQNTKSK ++ EE PSLLTV+VDT PK+WAELDKE + +G+LISALQSLIVF
Sbjct: 1   MDAISDSTFQNTKSKTSITEENPSLLTVVVDTTPKLWAELDKESNSKGNLISALQSLIVF 60

Query: 61  LNAHLSFNSANQVAVIAAHSTGIKYLFPTPPSSQEEPAAKS------PDLSIINSNMYRQ 114
           LNAHL+FN++NQVAVIAAHSTG+KYL+P   +++   A+ S       DLSIIN++MYRQ
Sbjct: 61  LNAHLAFNNSNQVAVIAAHSTGLKYLYPKTATTEGTGASSSSVVSGRKDLSIINNDMYRQ 120

Query: 115 FRNVDETVLEELYKLLQDEKKRK--IPSGFQKSTLSGAMSAGFTYINRVIKEQSTASLKA 172
           FRNVDETV+EELYKL Q EK+      +G  +STLSGA+SAG TYINRV KE    +LK+
Sbjct: 121 FRNVDETVVEELYKLFQQEKEENNSTSNGVGRSTLSGAISAGLTYINRVNKENENITLKS 180

Query: 173 RLMVMTCGSSGGKDEIFQYIPIMNCIFSATKLKCPIDVVKIGGSQESTFLQQATDATNGV 232
           RL+V TCGSSGG+DEIFQYIPIMNCIF+ATK+KCPIDVVKIGG QESTFLQQATDATNGV
Sbjct: 181 RLLVTTCGSSGGRDEIFQYIPIMNCIFTATKMKCPIDVVKIGGVQESTFLQQATDATNGV 240

Query: 233 YLHVPSTEGLIQYLTTAMFIDPSLRPIVVKPNQGSVDFRTSCYLTGKVVAVGFVCSVCLC 292
           YLHV STEGLIQYL TAMFIDPSLR ++VKPNQGSVDFRTSC+LTG+VVAVGFVCSVCLC
Sbjct: 241 YLHVDSTEGLIQYLCTAMFIDPSLRHVIVKPNQGSVDFRTSCFLTGRVVAVGFVCSVCLC 300

Query: 293 VLSIIPPGNKCPACDSEFDEHVTTKLKRRPVVPGI 327
           VLSIIPPGNKCPACD+EFDE V TKLKR+PVVPG+
Sbjct: 301 VLSIIPPGNKCPACDAEFDERVITKLKRKPVVPGM 335

>YPR056W (TFB4) [5486] chr16 (671121..672137) RNA polymerase II
           transcription initiation factor TFIIH (factor b), 37 kDa
           subunit [1017 bp, 338 aa]
          Length = 338

 Score =  514 bits (1325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/336 (72%), Positives = 287/336 (85%), Gaps = 6/336 (1%)

Query: 1   MDAISDPSFQNTKSKIAVAEELPSLLTVIVDTMPKVWAELDKEGSQEGSLISALQSLIVF 60
           MDAISDP+F++ +S+  V EE PSLLTVI++  PK+W   D+EG+++GS+I  L++LIVF
Sbjct: 1   MDAISDPTFKHARSRKQVTEESPSLLTVIIEIAPKLWTTFDEEGNEKGSIIKVLEALIVF 60

Query: 61  LNAHLSFNSANQVAVIAAHSTGIKYLFPTPPS----SQEEPAAKSPDLSIINSNMYRQFR 116
           LNAHL+FNSAN+VAVIAA+S GIKYL+P   S    S+ E   +S DL IINS+MYR+FR
Sbjct: 61  LNAHLAFNSANKVAVIAAYSQGIKYLYPESTSALKASESENKTRS-DLKIINSDMYRRFR 119

Query: 117 NVDETVLEELYKLLQDEKKRKIPSGFQKSTLSGAMSAGFTYINRVIKEQSTASLKARLMV 176
           NVDET++EE+YKL + EKK +I    Q+STL+GAMSAG TY+NR+ KE  T SLK+RL+V
Sbjct: 120 NVDETLVEEIYKLFELEKK-QIEQNSQRSTLAGAMSAGLTYVNRISKESVTTSLKSRLLV 178

Query: 177 MTCGSSGGKDEIFQYIPIMNCIFSATKLKCPIDVVKIGGSQESTFLQQATDATNGVYLHV 236
           +TCGS   KDEIFQYIPIMNCIFSATK+KCPIDVVKIGGS+ESTFLQQ TDATNGVYLHV
Sbjct: 179 LTCGSGSSKDEIFQYIPIMNCIFSATKMKCPIDVVKIGGSKESTFLQQTTDATNGVYLHV 238

Query: 237 PSTEGLIQYLTTAMFIDPSLRPIVVKPNQGSVDFRTSCYLTGKVVAVGFVCSVCLCVLSI 296
            STEGLIQYL TAMFIDPSLRPI+VKPN GSVDFRTSCYLTG+VVAVGF+CSVCLCVLSI
Sbjct: 239 ESTEGLIQYLATAMFIDPSLRPIIVKPNHGSVDFRTSCYLTGRVVAVGFICSVCLCVLSI 298

Query: 297 IPPGNKCPACDSEFDEHVTTKLKRRPVVPGIAAKKK 332
           IPPGNKCPACDS+FDEHV  KLKR+PVVP + AKKK
Sbjct: 299 IPPGNKCPACDSQFDEHVIAKLKRKPVVPRLKAKKK 334

>Scas_667.20
          Length = 338

 Score =  511 bits (1316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/334 (73%), Positives = 284/334 (85%), Gaps = 2/334 (0%)

Query: 1   MDAISDPSFQNTKSKIAVAEELPSLLTVIVDTMPKVWAELDKEGSQEGSLISALQSLIVF 60
           MDAI+DP+FQ+TK + ++ EE PSLLTVIVD  PK+WAELD+E +++G+LI+ L+SL+VF
Sbjct: 1   MDAIADPTFQHTKVRSSITEETPSLLTVIVDITPKLWAELDEEINEKGNLINVLKSLLVF 60

Query: 61  LNAHLSFNSANQVAVIAAHSTGIKYLFPTPPSSQEEPAAKSPDLSIINSNMYRQFRNVDE 120
           LNAHL+FNS+NQVAVIAAHS GIKYLFP    S +   +   DLSIIN +MYR+FRNVDE
Sbjct: 61  LNAHLAFNSSNQVAVIAAHSQGIKYLFPKNSISVKGVNSGKKDLSIINKDMYRRFRNVDE 120

Query: 121 TVLEELYKLLQDEKKRKIPSGFQKSTLSGAMSAGFTYINRVIKEQSTASLKARLMVMTCG 180
           T+++ELY L ++E K+ + +  QKSTLSGAMSAG TYINRV KE    SLK+RLMV+TCG
Sbjct: 121 TLVDELYALFEEELKQ-VNTVTQKSTLSGAMSAGLTYINRVTKELEAISLKSRLMVLTCG 179

Query: 181 SSG-GKDEIFQYIPIMNCIFSATKLKCPIDVVKIGGSQESTFLQQATDATNGVYLHVPST 239
             G  KDEIFQYIPIMNCIFSATK+KCPIDVVKIGGS+ESTFLQQ TDATNG YLHV ST
Sbjct: 180 GKGESKDEIFQYIPIMNCIFSATKIKCPIDVVKIGGSKESTFLQQTTDATNGAYLHVEST 239

Query: 240 EGLIQYLTTAMFIDPSLRPIVVKPNQGSVDFRTSCYLTGKVVAVGFVCSVCLCVLSIIPP 299
           +GLIQYL TAMFIDPSLR I+VKPN GSVDFRTSCYLTGKVVAVGF+CSVCLCVLSIIPP
Sbjct: 240 KGLIQYLATAMFIDPSLRQIIVKPNHGSVDFRTSCYLTGKVVAVGFICSVCLCVLSIIPP 299

Query: 300 GNKCPACDSEFDEHVTTKLKRRPVVPGIAAKKKK 333
           GNKCPACDSEFDEHV  KLK++PVVP +A K  K
Sbjct: 300 GNKCPACDSEFDEHVIAKLKKKPVVPRVAKKGNK 333

>ADL323C [1418] [Homologous to ScYPR056W (TFB4) - SH]
           (127631..128656) [1026 bp, 341 aa]
          Length = 341

 Score =  479 bits (1234), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 230/330 (69%), Positives = 268/330 (81%), Gaps = 5/330 (1%)

Query: 1   MDAISDPSFQNTKSKIAVAEELPSLLTVIVDTMPKVWAELDKEGSQEGSLISALQSLIVF 60
           MDAI+D +FQ  KSK+ + EE PSLLT+++DT PK+WAE D+E  ++G L+  L+S IVF
Sbjct: 1   MDAIADSTFQINKSKVQLVEETPSLLTLVIDTNPKLWAEFDREVGKKGQLMQVLKSTIVF 60

Query: 61  LNAHLSFNSANQVAVIAAHSTGIKYLFPTPPSSQ-EEPAAKSPDLSIINSNMYRQFRNVD 119
           LNAHLSFN++NQV+VIAA S GIKYL+P     +      KS D SIIN NMYR FRNVD
Sbjct: 61  LNAHLSFNNSNQVSVIAACSRGIKYLYPQADDKEGSTKKKKSEDRSIINRNMYRGFRNVD 120

Query: 120 ETVLEELYKLLQDEKKR---KIPSGFQKSTLSGAMSAGFTYINRVIKEQSTASLKARLMV 176
           E V+EELY++ Q E K+    +P  F +STLSGAMSAG TYINR+  E    SLK+RL+V
Sbjct: 121 EAVVEELYRVFQQESKQLEDGVPQPF-RSTLSGAMSAGLTYINRITHETEGVSLKSRLLV 179

Query: 177 MTCGSSGGKDEIFQYIPIMNCIFSATKLKCPIDVVKIGGSQESTFLQQATDATNGVYLHV 236
           +TCGSS  KDE+FQYIPIMNCIFSATK+KCPIDVVK+GG +ESTFLQQATDATNG YLHV
Sbjct: 180 ITCGSSASKDEVFQYIPIMNCIFSATKMKCPIDVVKVGGVKESTFLQQATDATNGNYLHV 239

Query: 237 PSTEGLIQYLTTAMFIDPSLRPIVVKPNQGSVDFRTSCYLTGKVVAVGFVCSVCLCVLSI 296
            +T+GLIQYL+TAMFIDPSLR  VVKPNQ SVDFRTSCYLTGKVVA+GFVCSVCLCVLSI
Sbjct: 240 ANTDGLIQYLSTAMFIDPSLRQWVVKPNQSSVDFRTSCYLTGKVVAIGFVCSVCLCVLSI 299

Query: 297 IPPGNKCPACDSEFDEHVTTKLKRRPVVPG 326
           IPPGNKCPACDSEFDE V  KL R+PV+ G
Sbjct: 300 IPPGNKCPACDSEFDEKVVAKLSRKPVITG 329

>CAGL0D01650g complement(172035..173042) highly similar to tr|Q12004
           Saccharomyces cerevisiae YPR056w TFB4, start by
           similarity
          Length = 335

 Score =  461 bits (1185), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 214/314 (68%), Positives = 261/314 (83%), Gaps = 1/314 (0%)

Query: 1   MDAISDPSFQNTKSKIAVAEELPSLLTVIVDTMPKVWAELDKEGSQEGSLISALQSLIVF 60
           MDAI+DP+FQ TK +    E++PSLLTV++D  P++WAE D    ++ S+ + L+SLIVF
Sbjct: 1   MDAIADPNFQQTKLRSTATEDIPSLLTVVLDISPRLWAEFDHRSGEKQSVTTVLKSLIVF 60

Query: 61  LNAHLSFNSANQVAVIAAHSTGIKYLFPTPPSSQEEPAAKSPDLSIINSNMYRQFRNVDE 120
           LN+HL+FNSANQVAVIAA S GI+YL+P    + E+ A  S DLSII+S+MYR+FRNVDE
Sbjct: 61  LNSHLAFNSANQVAVIAAFSQGIQYLYPRSSDTSEQNAGNSKDLSIISSHMYRRFRNVDE 120

Query: 121 TVLEELYKLLQDEKKRKIPSGFQKSTLSGAMSAGFTYINRVIKEQSTASLKARLMVMTCG 180
           T++EE YKL Q E+   I    QKSTLSGAM+A  TY NR+ KE  + SL++RL+V+TCG
Sbjct: 121 TLIEEFYKLYQREESL-IDKPVQKSTLSGAMAAALTYTNRLTKEFESISLRSRLLVITCG 179

Query: 181 SSGGKDEIFQYIPIMNCIFSATKLKCPIDVVKIGGSQESTFLQQATDATNGVYLHVPSTE 240
           SS  KDEIFQYIPIMNCIFSATKLKCPIDV+KIGG+++STFLQQ TDATNGVY+H+ ST 
Sbjct: 180 SSREKDEIFQYIPIMNCIFSATKLKCPIDVIKIGGNKQSTFLQQTTDATNGVYIHLESTN 239

Query: 241 GLIQYLTTAMFIDPSLRPIVVKPNQGSVDFRTSCYLTGKVVAVGFVCSVCLCVLSIIPPG 300
           G+IQYL+TAM IDPSLR I+V+P QGSVDFRTSCYLTGKVVA+G++CSVCLCVLSIIPPG
Sbjct: 240 GIIQYLSTAMSIDPSLRQIIVRPTQGSVDFRTSCYLTGKVVAIGYICSVCLCVLSIIPPG 299

Query: 301 NKCPACDSEFDEHV 314
           NKCPACDS+FDE V
Sbjct: 300 NKCPACDSQFDERV 313

>KLLA0B08569g complement(756558..757571) similar to sgd|S0006260
           Saccharomyces cerevisiae YPR056w TFB4 component of RNA
           polymerase transcription initiation TFIIH factor, start
           by similarity
          Length = 337

 Score =  441 bits (1133), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 213/340 (62%), Positives = 262/340 (77%), Gaps = 16/340 (4%)

Query: 1   MDAISDPSFQNTKSKIAVAEELPSLLTVIVDTMPKVWAELDKE--------GSQEGSLIS 52
           MDAI+D  FQ TKSK    E+ PSLLTV+VDT    W +L K+         S E  LI 
Sbjct: 1   MDAIADTVFQGTKSKTQEIEDTPSLLTVVVDTSIHSWVQLTKQQSGSGSEGSSGEKQLIE 60

Query: 53  ALQSLIVFLNAHLSFNSANQVAVIAAHSTGIKYLFPTPPSSQEEPAAKSPDLSIINSNMY 112
           AL+S++VFLNAHL+FNS NQV +IAAHS G+KYL+P+  S         P +S+++S+MY
Sbjct: 61  ALKSIVVFLNAHLAFNSGNQVCLIAAHSEGMKYLYPSADSK--------PSMSMVSSDMY 112

Query: 113 RQFRNVDETVLEELYKLLQDEKKRKIPSGFQKSTLSGAMSAGFTYINRVIKEQSTASLKA 172
           R FRNVDE V+E+ Y+L ++E + +      KS+LSGAMS+  TY+NR++KE    SL++
Sbjct: 113 RGFRNVDEIVVEQWYRLFKEELEGQESKVSMKSSLSGAMSSALTYVNRILKENENTSLRS 172

Query: 173 RLMVMTCGSSGGKDEIFQYIPIMNCIFSATKLKCPIDVVKIGGSQESTFLQQATDATNGV 232
           RL+V+TCG+S GKDEIFQYIPIMNCIFSATK+KC IDVVKIGG  ESTFLQQATDAT+GV
Sbjct: 173 RLLVITCGTSQGKDEIFQYIPIMNCIFSATKMKCSIDVVKIGGGIESTFLQQATDATSGV 232

Query: 233 YLHVPSTEGLIQYLTTAMFIDPSLRPIVVKPNQGSVDFRTSCYLTGKVVAVGFVCSVCLC 292
           YLHV +T GLIQYL+TAMFIDPSLR +++KPNQGSVDFRTSC+LTGKVVAVGFVCSVCLC
Sbjct: 233 YLHVENTRGLIQYLSTAMFIDPSLRNVIIKPNQGSVDFRTSCFLTGKVVAVGFVCSVCLC 292

Query: 293 VLSIIPPGNKCPACDSEFDEHVTTKLKRRPVVPGIAAKKK 332
           VLS+IPPG KCPACDS FD  +  +L+R+PV+     KKK
Sbjct: 293 VLSVIPPGQKCPACDSPFDSKIIARLRRKPVLSNGVPKKK 332

>ABL180W [412] [Homologous to ScYNL216W (RAP1) - SH]
           complement(66983..69028) [2046 bp, 681 aa]
          Length = 681

 Score = 29.6 bits (65), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 3/72 (4%)

Query: 252 IDPSLRPIVVKPNQGSVDFRTSCYLTGKVVAVGFVCSVCLCVLSIIPPGNKCPACDSEFD 311
           ID + + +      G++D  T+   +G+V AVG      L   S +PP NK    + E D
Sbjct: 175 IDDARQELASSTRSGALD--TNTAQSGQVGAVGEPAKAMLTRSSNLPPHNKSSFTEEE-D 231

Query: 312 EHVTTKLKRRPV 323
           E +   +++ P 
Sbjct: 232 EFILDVVRKNPT 243

>Scas_685.27
          Length = 446

 Score = 29.6 bits (65), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 50/104 (48%), Gaps = 14/104 (13%)

Query: 91  PSSQEEPAAKSPDL-SIINSNMYRQFRNVDETVLEELYKLLQDEKKRKIPSGFQKSTLSG 149
           P+++  P  K+ +  SI N N+       DE ++ E  +LLQ    + I     K+ L+ 
Sbjct: 71  PATRASPRQKTSEAQSIHNENLNTLQNMTDEQIINEQRELLQSLNPKLI-----KNLLAN 125

Query: 150 AMSAGFTYINRVIKEQSTASLKARLMVMTCGSSGGKDEIFQYIP 193
                   IN+  + +S+A L A +   +    GGK+E F+++P
Sbjct: 126 --------INKRTEGESSAPLFAEIEGASGTWVGGKNENFKHLP 161

>CAGL0I10318g complement(999605..1002325) similar to sp|P32504
           Saccharomyces cerevisiae YGR140w kinetochore protein
           complex CBF3, hypothetical start
          Length = 906

 Score = 29.3 bits (64), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 15/62 (24%), Positives = 34/62 (54%), Gaps = 4/62 (6%)

Query: 29  IVDTMPKVWAELDKEGSQEGSLISALQSLIVFLNAHLSFNSANQVAV----IAAHSTGIK 84
           ++DT  KV+ +LD + S    +I+  ++L  ++NA L+  ++ ++      I     G++
Sbjct: 561 MIDTFKKVFEKLDMKRSTREFIINKFETLTKYVNARLNSVTSEEITSYFDDILEKKNGLR 620

Query: 85  YL 86
           Y+
Sbjct: 621 YI 622

>KLLA0F19085g 1758111..1762229 similar to sgd|S0004081 Saccharomyces
           cerevisiae YLR086w SMC4 Stable Maintenance of
           Chromosomes, start by similarity
          Length = 1372

 Score = 29.3 bits (64), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 11  NTKSKIAVAEELPSLLTVIVDTMPKVWAELDKEGSQEGSLISALQSL---IVFLNAHLSF 67
           N +S +++  E+ S L  + D +P++  ++ K   ++GS ++ ++S    +  L   LS 
Sbjct: 830 NYRSALSMVHEMESALQKLTDRLPEIDIQISKIQLEKGSRVAEVESYHQRLSQLARELSM 889

Query: 68  NSANQ 72
           N  NQ
Sbjct: 890 NEKNQ 894

>CAGL0F06369g complement(628054..630723) similar to sp|P36016
           Saccharomyces cerevisiae YKL073w LHS1 chaperone of the
           ER lumen, hypothetical start
          Length = 889

 Score = 28.5 bits (62), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 1/56 (1%)

Query: 148 SGAMSAGFTYINRVIKEQSTASLKARLMVMTCGSSG-GKDEIFQYIPIMNCIFSAT 202
           + A   G  Y+N      S    K + + + C S G  K+E F++I ++N +  AT
Sbjct: 504 TSACKKGQLYLNVTFDLDSNRVFKIKDITVLCDSDGNAKEEEFEFIDVINDVTKAT 559

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,586,240
Number of extensions: 440953
Number of successful extensions: 1485
Number of sequences better than 10.0: 15
Number of HSP's gapped: 1495
Number of HSP's successfully gapped: 15
Length of query: 334
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 232
Effective length of database: 13,065,073
Effective search space: 3031096936
Effective search space used: 3031096936
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)