Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_27.1258369568535960.0
ADL321W69770814800.0
YBR102C (EXO84)75375313541e-178
KLLA0E11319g72071912431e-162
Scas_718.776475811971e-154
CAGL0K12166g76458310541e-133
AFR342C64952740.90
Kwal_56.2308476240684.1
Scas_666.13*47859658.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.12583
         (685 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.12583                                                        1389   0.0  
ADL321W [1420] [Homologous to ScYBR102C (EXO84) - SH] complement...   574   0.0  
YBR102C (EXO84) [291] chr2 complement(445019..447280) Subunit of...   526   e-178
KLLA0E11319g 996736..998898 similar to sp|P38261 Saccharomyces c...   483   e-162
Scas_718.7                                                            465   e-154
CAGL0K12166g complement(1188432..1190726) similar to sp|P38261 S...   410   e-133
AFR342C [3534] [Homologous to ScYDR496C (PUF6) - SH] (1058347..1...    33   0.90 
Kwal_56.23084                                                          31   4.1  
Scas_666.13*                                                           30   8.9  

>Kwal_27.12583
          Length = 695

 Score = 1389 bits (3596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 673/685 (98%), Positives = 673/685 (98%)

Query: 1   MVDLSLRKARNNWKQMSSPPKAKGRSRSPEDKNFKSNPYQNLKVPSNYSQLPTIGTKERN 60
           MVDLSLRKARNNWKQMSSPPKAKGRSRSPEDKNFKSNPYQNLKVPSNYSQLPTIGTKERN
Sbjct: 1   MVDLSLRKARNNWKQMSSPPKAKGRSRSPEDKNFKSNPYQNLKVPSNYSQLPTIGTKERN 60

Query: 61  KVGTSMQRRLSFHNPKYVPPTSDHMAVPLPQLGSSELLNVNSGDFATRHRSNSNFAKGPE 120
           KVGTSMQRRLSFHNPKYVPPTSDHMAVPLPQLGSSELLNVNSGDFATRHRSNSNFAKGPE
Sbjct: 61  KVGTSMQRRLSFHNPKYVPPTSDHMAVPLPQLGSSELLNVNSGDFATRHRSNSNFAKGPE 120

Query: 121 LDLYGNQSLRQILGDPKFKPKHFITQTLGNASALEIDRFTSDLNDLSLEVSDEIKDNISR 180
           LDLYGNQSLRQILGDPKFKPKHFITQTLGNASALEIDRFTSDLNDLSLEVSDEIKDNISR
Sbjct: 121 LDLYGNQSLRQILGDPKFKPKHFITQTLGNASALEIDRFTSDLNDLSLEVSDEIKDNISR 180

Query: 181 SYAQVSQVNKDIDRASSELKLLRSSITELKEVISEFETMAEKRLQLERRPSTRARSEQPS 240
           SYAQVSQVNKDIDRASSELKLLRSSITELKEVISEFETMAEKRLQLERRPSTRARSEQPS
Sbjct: 181 SYAQVSQVNKDIDRASSELKLLRSSITELKEVISEFETMAEKRLQLERRPSTRARSEQPS 240

Query: 241 LLPPAKASRARDRTSVMMLEKMWDSELASLFKAVEGAQKFIAPLPGRHILMETGDWYEVN 300
           LLPPAKASRARDRTSVMMLEKMWDSELASLFKAVEGAQKFIAPLPGRHILMETGDWYEVN
Sbjct: 241 LLPPAKASRARDRTSVMMLEKMWDSELASLFKAVEGAQKFIAPLPGRHILMETGDWYEVN 300

Query: 301 AATLKPLRSIHIFVLNDMLLIAARNQDRRQHEYVACHCHALRDTSINPQRENRIELCFGN 360
           AATLKPLRSIHIFVLNDMLLIAARNQDRRQHEYVACHCHALRDTSINPQRENRIELCFGN
Sbjct: 301 AATLKPLRSIHIFVLNDMLLIAARNQDRRQHEYVACHCHALRDTSINPQRENRIELCFGN 360

Query: 361 RSQCLVQAKNARNYDRLVSTVRGAQDDLNVISQAEEENARRLRDSFSYMQATQQTPGREL 420
           RSQCLVQAKNARNYDRLVSTVRGAQDDLNVISQAEEENARRLRDSFSYMQATQQTPGREL
Sbjct: 361 RSQCLVQAKNARNYDRLVSTVRGAQDDLNVISQAEEENARRLRDSFSYMQATQQTPGREL 420

Query: 421 AISPTKGHGRNSSLGNNTPHPRDDPKESYLLQTITASMQSQPQFAGSNVGLGDFGRXXXX 480
           AISPTKGHGRNSSLGNNTPHPRDDPKESYLLQTITASMQSQPQFAGSNVGLGDFGR    
Sbjct: 421 AISPTKGHGRNSSLGNNTPHPRDDPKESYLLQTITASMQSQPQFAGSNVGLGDFGRFDDE 480

Query: 481 XXXXXXXXARHNYKEAIKKLESLKKAVQVLEQHTPHENLMILNLLGLRVSHRSQILVAKL 540
                   ARHNYKEAIKKLESLKKAVQVLEQHTPHENLMILNLLGLRVSHRSQILVAKL
Sbjct: 481 VEEFDIEFARHNYKEAIKKLESLKKAVQVLEQHTPHENLMILNLLGLRVSHRSQILVAKL 540

Query: 541 THLTATEIFDFSKLADYVQNLISLNYAHDALVLFLQNRSKYINELILKIGTFHDPVHYLS 600
           THLTATEIFDFSKLADYVQNLISLNYAHDALVLFLQNRSKYINELILKIGTFHDPVHYLS
Sbjct: 541 THLTATEIFDFSKLADYVQNLISLNYAHDALVLFLQNRSKYINELILKIGTFHDPVHYLS 600

Query: 601 QIAVIRFQTLKKVVLRVQEQFQNTGDNFSSTLVSWCDEEADKHFALINKQFLNLEMIPPS 660
           QIAVIRFQTLKKVVLRVQEQFQNTGDNFSSTLVSWCDEEADKHFALINKQFLNLEMIPPS
Sbjct: 601 QIAVIRFQTLKKVVLRVQEQFQNTGDNFSSTLVSWCDEEADKHFALINKQFLNLEMIPPS 660

Query: 661 SIKSSRRQIDELKSVGLDFVYKLDD 685
           SIKSSRRQIDELKSVGLDFVYKLDD
Sbjct: 661 SIKSSRRQIDELKSVGLDFVYKLDD 685

>ADL321W [1420] [Homologous to ScYBR102C (EXO84) - SH]
           complement(130700..132793) [2094 bp, 697 aa]
          Length = 697

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/708 (44%), Positives = 449/708 (63%), Gaps = 44/708 (6%)

Query: 1   MVDLSLRKARNNWKQMSSPPKAKGRSRSPEDKNFKSNPYQNLKVPSNYSQLPTIGTKERN 60
           MVD SLRKARNNW ++SSP K + +  SP     KSN Y++   P +  QLP IG K+R 
Sbjct: 1   MVDFSLRKARNNWSKLSSPGKTRQQG-SP--TKLKSNAYEDFVSPRDTLQLPEIGMKDRR 57

Query: 61  KVGTSMQRRLSFHNPKYVPPTSDHMAVP-------LP----QLGSSELLNVNSGDFATRH 109
           KVGTSMQRRLS HN KY+PP  D+ + P       LP     L SSEL+  N       H
Sbjct: 58  KVGTSMQRRLSVHNAKYIPPPIDYASAPALPTAVELPVRDNSLLSSELMKPN-------H 110

Query: 110 RSNSNFAKGPELDLYGNQSLRQILGDPKFKPKHFITQTLGNASALEIDRFTSDLNDLSLE 169
           R        P +D+YG +SLR+IL +P+F+ K F+ + LG+A+ALEID F S+LN LS E
Sbjct: 111 RR-------PPVDIYGGRSLREILSNPQFQAKRFVHEKLGDATALEIDHFASNLNHLSQE 163

Query: 170 VSDEIKDNISRSYAQVSQVNKDIDRASSELKLLRSSITELKEVISEFETMAEKRLQLERR 229
           +  EIK NI++SY ++ QVNK++  AS+ELK LRS + +L+ V+ +F  MAEKRL LE+ 
Sbjct: 164 IEQEIKSNINKSYNELMQVNKELAVASTELKDLRSKVQQLQVVMGQFTAMAEKRLLLEKE 223

Query: 230 ---------PSTRARSEQPSLLPPAKASRAR-DRTSVMMLEKMWDSELASLFKAVEGAQK 279
                     +T++ S    LLPP K+  A+ DR++V+ LEK+W +EL+SLF++VEGAQK
Sbjct: 224 HFRQSNTSVMTTKSGSTGSGLLPPVKSGAAKKDRSTVITLEKIWTNELSSLFRSVEGAQK 283

Query: 280 FIAPLPGRHILMETGDWYEVNAATLKPLRSIHIFVLNDMLLIAARNQDRRQHEYVACHCH 339
           +IAP PGR IL+E+ DW E+N ATLKPL +  IF+LNDM+L+A    D++  E VA  C 
Sbjct: 284 YIAPAPGRRILLESNDWMEINIATLKPLHATRIFLLNDMILVAVCRSDKK-GELVANQCC 342

Query: 340 ALRDTSINPQRENRIELCFGNRSQCLVQAKNARNYDRLVSTVRGAQDDLNVISQAEEENA 399
           +LR+ ++  +    +   FGN+   L +++    Y  L++ ++ A+D+L  I QAEE+NA
Sbjct: 343 SLRELTVAEESNYTLSFHFGNKHHSLYRSRTPTGYTALLNEIKSAKDELRDIYQAEEDNA 402

Query: 400 RRLRDSFSYMQATQQTPGRELAISPTKGHGRNSSLGN--NTPHPRDDPKESYLLQTITAS 457
           R+LRD F+Y+Q+TQQ+P R+++ SP +GH R  SLG   NTP  R    +  LLQ I+ S
Sbjct: 403 RKLRDFFTYLQSTQQSPSRDIS-SPARGHSRQRSLGTLQNTP-SRASTYQENLLQNISMS 460

Query: 458 MQSQPQFAGSNVGLGDFGRXXXXXXXXXXXXARHNYKEAIKKLESLKKAVQVLEQHTPHE 517
           M ++ +  G N                     R N+  AIKKL S++  ++ +      E
Sbjct: 461 MHTRSRSGGVNQTAVKLNLVYEELEELSVPVTRMNFGLAIKKLHSIENILKGITAEAEGE 520

Query: 518 NLMILNLLGLRVSHRSQILVAKLTHLTATEIFDFSKLADYVQNLISLNYAHDALVLFLQN 577
            +M+LNLL ++ +    ++  KLTH+  TE  D +KL    ++LI L    +AL LFL N
Sbjct: 521 -VMLLNLLRMKCNQTRTLITQKLTHVINTEYSDANKLESSTKSLILLGMPAEALQLFLHN 579

Query: 578 RSKYINELILKIGTFHDPVHYLSQIAVIRFQTLKKVVLRVQEQFQNTGDNFSSTLVSWCD 637
           RS +I +L+L++G   +   Y++Q+AVIR QT+KKV ++ Q+ F+ T   +SS LVSWC+
Sbjct: 580 RSNFIQDLVLQVGVHDNSNSYITQVAVIRCQTIKKVAIQFQKLFEGTTAKYSSVLVSWCN 639

Query: 638 EEADKHFALINKQFLNLEMIPPSSIKSSRRQIDELKSVGLDFVYKLDD 685
           +E DKHF L+ KQ +N + + P +IK SR+QIDELKSVG+DFVYKLDD
Sbjct: 640 DEVDKHFFLMKKQLINDDQLTPQAIKISRKQIDELKSVGMDFVYKLDD 687

>YBR102C (EXO84) [291] chr2 complement(445019..447280) Subunit of
           the exocyst complex, required for pre-spliceosome
           formation and intron-dependent mRNA splicing [2262 bp,
           753 aa]
          Length = 753

 Score =  526 bits (1354), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 302/753 (40%), Positives = 440/753 (58%), Gaps = 78/753 (10%)

Query: 1   MVDLSLRKARNNWKQMSSPPKAKGRSRSPED-----KNFKSNPYQNLKVPSNYSQLPTIG 55
           MV+ SL+KARNNWK +     +  + ++P       +  K NPY +LK P+    LPTI 
Sbjct: 1   MVEFSLKKARNNWKHVKKSASSPAKQKTPPSPAKPKQKTKKNPYSDLKDPATSYTLPTIN 60

Query: 56  TKERNKVGTSMQRRLSFHNPKYVPPTSDHMAVPLPQL----------------------- 92
            +ER++V TSMQRRLS HN  Y PPT D+ ++PLP +                       
Sbjct: 61  ARERSRVATSMQRRLSIHNTNYAPPTLDY-SMPLPDMPNMIVPNDNVDSSHNNSSFTTEN 119

Query: 93  ------GSSELLNVNSGDF--------------ATRHRSNSNFAKGPELDLYGNQSLRQI 132
                 G S  LN+++ D               A R+  N + +  P      + SLR++
Sbjct: 120 ESVSSKGPSNSLNLSTADLSLNDSSYNKVPARSAMRNTVNPSGSNDP---FNNSTSLRKM 176

Query: 133 LGDPKFKPKHFITQTLGNASALEIDRFTSDLNDLSLEVSDEIKDNISRSYAQVSQVNKDI 192
           L +P F  K F+   LGNASA+ ID+FTS+L DLS++V +E+K NI++SY ++  VN D+
Sbjct: 177 LANPHFNAKDFVHDKLGNASAITIDKFTSNLTDLSIQVQEEVKLNINKSYNEIMTVNNDL 236

Query: 193 DRASSELKLLRSSITELKEVISEFETMAEKRLQL------ERRPS---TRARSEQPSLLP 243
           + A  ELK +R++I +L EV+ +   +AEKRLQL      ER+ +     + S  P+LLP
Sbjct: 237 NVAMLELKRVRANINDLNEVLDQCTKIAEKRLQLQDQIDQERQGNFNNVESHSNSPALLP 296

Query: 244 PAKASRA-----RDRTSVMMLEKMWDSELASLFKAVEGAQKFIAPLPGRHILMETGDWYE 298
           P KA +      RDR+SV++LEK WD+EL  LFK VEGAQKFI    GRHILM + +W E
Sbjct: 297 PLKAGQNGNLMRRDRSSVLILEKFWDTELDQLFKNVEGAQKFINSTKGRHILMNSANWME 356

Query: 299 VNAATLKPLRSIHIFVLNDMLLIAARNQDRRQHEYVACHCHALRDTSINPQR--ENRIEL 356
           +N  T KPL+ + IF+LND++LIA +++D+ Q++++   C+ L+D ++  +     R+  
Sbjct: 357 LNTTTGKPLQMVQIFILNDLVLIADKSRDK-QNDFIVSQCYPLKDVTVTQEEFSTKRLLF 415

Query: 357 CFGNRSQCLVQAKNARNYDRLVSTVRGAQDDLNVISQAEEENARRLRDSFSYMQATQQTP 416
            F N +  L + ++A    RL+  +R A+DDL  I   EEEN++R+R+SF Y+Q+TQQTP
Sbjct: 416 KFSNSNSSLYECRDADECSRLLDVIRKAKDDLCDIFHVEEENSKRIRESFRYLQSTQQTP 475

Query: 417 GRELAISPTKGHGRNSSLGNNTPHPRD--DPKESYLLQTITASMQSQPQFAGSNVGLGDF 474
           GRE   SP K   R  S+G +    R+     + YLLQ +T SM S+P+    +      
Sbjct: 476 GRENNRSPNKNKRR--SMGGSITPGRNVTGAMDQYLLQNLTLSMHSRPRSRDMSSTAQRL 533

Query: 475 GRXXXXXXXXXXXXARHNYKEAIKKLESLKKAVQVLEQHTPHENLMILNLLGLRVSHRSQ 534
                         AR  ++ A++ L  ++  ++ L +    E LM+LNL+ L++  R +
Sbjct: 534 KFLDEGVEEIDIELARLRFESAVETLLDIESQLEDLSERISDEELMLLNLISLKIEQRRE 593

Query: 535 ILVAKLTH--LTATEIFDFSKLADYVQNLISLNYAHDALVLFLQNRSKYINELILKIGTF 592
            + +KL+   L++ EI     L    +N+I L     AL LFLQNRS +I +LIL+IG+ 
Sbjct: 594 AISSKLSQSILSSNEIV---HLKSGTENMIKLGLPEQALDLFLQNRSNFIQDLILQIGSV 650

Query: 593 HDPVHYLSQIAVIRFQTLKKVVLRVQEQFQNTGDNFSSTLVSWCDEEADKHFALINKQFL 652
            +P +YL+Q+AVIRFQT+KK V   Q+ F+  G   SS LV WC +E D HF LI+KQ L
Sbjct: 651 DNPTNYLTQLAVIRFQTIKKTVEDFQDIFKELGAKISSILVDWCSDEVDNHFKLIDKQLL 710

Query: 653 NLEMIPPSSIKSSRRQIDELKSVGLDFVYKLDD 685
           N EM+ P SIKSSR+QID LK+VGLDFVYKLD+
Sbjct: 711 NDEMLSPGSIKSSRKQIDGLKAVGLDFVYKLDE 743

>KLLA0E11319g 996736..998898 similar to sp|P38261 Saccharomyces
           cerevisiae YBR102c EXO84 exocyst protein essential for
           secretion singleton, start by similarity
          Length = 720

 Score =  483 bits (1243), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 284/719 (39%), Positives = 425/719 (59%), Gaps = 43/719 (5%)

Query: 1   MVDLSLRK-ARNNWKQ--MSSPPKAKGRSRSPEDKNFKSNPYQNLKVPSNYSQLPTIGTK 57
           MVD SL+K   ++W +  +S    + G S S     FKS+ YQ++KV     +LP +  K
Sbjct: 1   MVDFSLKKHGVSSWGRGSLSRKESSAGDSSS----TFKSSRYQDMKVSD--PELPKVSAK 54

Query: 58  ERNKVGTSMQRRLSFH---NPKYVPPTSDHM-AVPLPQLGSSELLNVNSG---------- 103
           ER+K GT M+RRLS H   N   V    D+M A+P      S   NV +           
Sbjct: 55  ERSKAGTMMKRRLSVHQSNNFGAVKMDFDNMPALPSSAADYSFASNVGNATQTSLITEDQ 114

Query: 104 --DFATRHRSNSNFAKGPELDLYGNQSLRQILGDPKFKPKHFITQTLGNASALEIDRFTS 161
             D  T   S +   + P+ +LY ++SLRQIL +P FK K FIT+ LG+A+A++ID+FTS
Sbjct: 115 LPDRNTSLASLNTNTRRPDQELYSSKSLRQILSNPDFKAKKFITEKLGDATAVDIDQFTS 174

Query: 162 DLNDLSLEVSDEIKDNISRSYAQVSQVNKDIDRASSELKLLRSSITELKEVISEFETMAE 221
           +LNDLSLE+ DEIK NI +S+ ++  VNK ++ A++ELK+LR+ + E+K+++++F T+AE
Sbjct: 175 NLNDLSLEIQDEIKFNIDKSFKEILIVNKGLETATTELKVLRTKVQEMKDIMNQFVTIAE 234

Query: 222 KRLQLERRPSTRA-------------RSEQPSLLPPAKASRARDRTSVMMLEKMWDSELA 268
           K+LQ E+  +  A              S  P L P   A+R +DRTSV +LE+MW+ EL 
Sbjct: 235 KKLQAEQAANETADLNRTSSSASLSNHSLLPPLKPTPSATR-KDRTSVYILERMWNEELM 293

Query: 269 SLFKAVEGAQKFIAPLPGRHILMETGDWYEVNAATLKPLRSIHIFVLNDMLLIAARNQDR 328
           +LFK V+GA K+I   PGRHIL+E+ +W E+N ATLKPL+ + +F+LND++LIAA  +  
Sbjct: 294 TLFKNVDGAHKYITSTPGRHILLESDNWIEINPATLKPLQKVRLFILNDVVLIAA-PKPS 352

Query: 329 RQHEYVACHCHALRDTSINPQRENRIELCFGNRSQCLVQAKNARNYDRLVSTVRGAQDDL 388
           +Q E        LRD ++  Q E+ +   F N+   L + ++ + + +++  +R A+D L
Sbjct: 353 KQTELTVSRFSPLRDVTVEVQSEHELSFNFSNKQHTLYRHRDPQVFSKVIDIIRQAKDAL 412

Query: 389 NVISQAEEENARRLRDSFSYMQATQQTPGRELAISPTKGHGRNSSLGNN-TP-HPRDDPK 446
             ISQAEE+  R++R+S++ +Q  ++TP R+   SP K HGR  S G   TP   R D +
Sbjct: 413 REISQAEEDTTRKIRNSYTLLQQ-ERTPNRDATTSPVKVHGRQRSYGGTGTPSRHRSDAQ 471

Query: 447 ESYLLQTITASMQSQPQFAGSNVGLGDFGRXXXXXXXXXXXXARHNYKEAIKKLESLKKA 506
              LL  IT S+  +     +        R             R N+  AI KL  ++ +
Sbjct: 472 NDALLTNITRSIHVRMGSEETTEVTKRLKRLDDALEDLDLEIGRQNFDLAITKLNHIQSS 531

Query: 507 VQVLEQHTPHENLMILNLLGLRVSHRSQILVAKLTHLTATEIFDFSKLADYVQNLISLNY 566
           ++ L      +  +++ LL L+ S R  IL  KLT+L A E  D +KL  Y+ NL++LN 
Sbjct: 532 LKSLYSSATFDESVMVELLSLKCSQRKTILYTKLTNLLACETSDMTKLKSYMLNLVALNE 591

Query: 567 AHDALVLFLQNRSKYINELILKIGTFHDPVHYLSQIAVIRFQTLKKVVLRVQEQFQNTGD 626
             DAL +FLQNRS +IN+L L+IG   +   +++Q+A+IRFQTLKKV  +  E  +N   
Sbjct: 592 PVDALEVFLQNRSNFINDLTLQIGIIDNVTSFITQVAIIRFQTLKKVTQQYLEVSKNLKR 651

Query: 627 NFSSTLVSWCDEEADKHFALINKQFLNLEMIPPSSIKSSRRQIDELKSVGLDFVYKLDD 685
           +++S LV WC EE DKHF L+ ++  N   +   +IK +R+QIDELK VG+D+VYKLDD
Sbjct: 652 DYTSLLVCWCSEEVDKHFQLMERELSNSSTLSVQAIKITRKQIDELKPVGMDYVYKLDD 710

>Scas_718.7
          Length = 764

 Score =  465 bits (1197), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 287/758 (37%), Positives = 429/758 (56%), Gaps = 77/758 (10%)

Query: 1   MVDLSLRKARNNWK--QMSSPPKAKGRSR------------SPEDK--------NFKSNP 38
           MVD SLRKARNNWK  +++SP K K  S             S  DK        N  +NP
Sbjct: 1   MVDFSLRKARNNWKSSKLTSPIKQKTPSSPSKTHHTPSPTPSSNDKPKKRTAKTNKGANP 60

Query: 39  YQNLKVPSNYSQLPTIGTKERNKVGTSMQRRLSFHNPKYVPPTSDHMAVPLPQLG----S 94
           Y  +++ S+YS LPT+ +K +NKV TSMQRRLS HN  YVPP  D+ ++PLP +     S
Sbjct: 61  YSTMQMTSDYSSLPTMDSKSKNKVATSMQRRLSIHNSNYVPPKLDY-SMPLPSMSQIPES 119

Query: 95  SELLNVNSGDFATRHRSNSNFAKGPELDLYGNQSLRQILGDPKFKPKHFITQTLGNASAL 154
              L+  S      +      A+     +   ++LR IL +P F  K+F+ + L  A+A+
Sbjct: 120 PNKLDTTSHMQKPLNTGRPKEARSSLAKISQPKTLRSILSNPSFNAKNFVHENLSEANAI 179

Query: 155 EIDRFTSDLNDLSLEVSDEIKDNISRSYAQVSQVNKDIDRASSELKLLRSSITELKEVIS 214
           +ID+FTS+L +L+  VS+EIK NI+ SY ++  VNKD++ A +ELK LR +I +L  V+ 
Sbjct: 180 DIDQFTSNLTNLAEYVSEEIKRNINDSYHEIMNVNKDLNVAMNELKQLRINIVQLSGVME 239

Query: 215 EFETMAEKRLQLER-------------RPSTRARSEQPSLLPPAKAS-----RARDRTSV 256
           +FET+A++RL LE                +   R    +LLPP K++     + RDR+SV
Sbjct: 240 QFETLAQRRLDLEYSSMQEHENEDEDLNATQSQRRGNSTLLPPMKSTTDGKGKYRDRSSV 299

Query: 257 MMLEKMWDSELASLFKAVEGAQKFI----------APLPGRHILMETGDWYEVNAATLKP 306
           M+LEK+WD EL +LFK +EG QKFI               RH+L+E+ DW E+N  TLKP
Sbjct: 300 MILEKVWDEELTNLFKNIEGIQKFINNDEFKNNSKLKKNARHLLLESNDWMELNVNTLKP 359

Query: 307 LRSIHIFVLNDMLLIAARNQDR---RQHEYVACHCHALRD---TSINPQRENRIELCFGN 360
            +++ IF+LND++L+ A    R   +Q+E+V   C  L +    + +    NR+   FGN
Sbjct: 360 FQNVKIFILNDLILVVAGKHGRDLIKQNEFVVSQCVPLGNVVGVTKDKMIRNRLYFDFGN 419

Query: 361 RSQCLVQAKNARNYDRLVSTVRGAQDDLNVISQAEEENARRLRDSFSYMQA-TQQTPG-- 417
            + CL + +     D+++  VR A+DDL  I Q E+EN+R++R+SF Y+Q+  QQTP   
Sbjct: 420 GNHCLYENRTEEECDKVMDRVRKAKDDLCDIFQTEQENSRKIRESFKYLQSQNQQTPSGN 479

Query: 418 RELAISPTKGHGRNSSLGNNTPHPRDD---------PKESYLLQTITASMQSQPQFAGSN 468
           +++  SP K   R  SLG  TPH  +            E + LQT++ SM S+ +    N
Sbjct: 480 KDMNKSPMKSQRR--SLG-MTPHRMNSLATNSNNVTSTEQFFLQTLSFSMHSRTRSHDMN 536

Query: 469 VGLGDFGRXXXXXXXXXXXXARHNYKEAIKKLESLKKAVQVLEQHTPHENLMILNLLGLR 528
                  +             R  +  A+  L  ++  +  +      E+LM+  L+ L+
Sbjct: 537 SISRKLKKLDDSIEEVDIELTRLKFDIAVDTLLDIESQLTEIFDKINDEDLMLHKLISLK 596

Query: 529 VSHRSQILVAKLTHLTATEIFDFSKLADYVQNLISLNYAHDALVLFLQNRSKYINELILK 588
           V  R +++++KL+        + S+L   ++ +I L     +L LFL NRS  I +LIL+
Sbjct: 597 VDQRRELIISKLSQNILFSNNEISQLMTNLKTMIKLGLPEQSLDLFLTNRSNLIQDLILQ 656

Query: 589 IGTFHDPVHYLSQIAVIRFQTLKKVVLRVQEQFQN-TGDNFSSTLVSWCDEEADKHFALI 647
           IG+F +  +YL+Q+AVIRFQT+K+ VL  ++ FQ       SS LVSWC+EE DK+F L+
Sbjct: 657 IGSFDNSTNYLTQLAVIRFQTMKQTVLNFEQIFQKLCSSKISSILVSWCNEEVDKYFRLV 716

Query: 648 NKQFLNLEMIPPSSIKSSRRQIDELKSVGLDFVYKLDD 685
           ++Q LN E +   SIK+SR+Q+D+LKSVGLDFVYKLD+
Sbjct: 717 DQQLLNDENLSIESIKASRKQLDDLKSVGLDFVYKLDE 754

>CAGL0K12166g complement(1188432..1190726) similar to sp|P38261
           Saccharomyces cerevisiae YBR102c EXO84 exocyst protein
           essential for secretion, start by similarity
          Length = 764

 Score =  410 bits (1054), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 228/583 (39%), Positives = 358/583 (61%), Gaps = 18/583 (3%)

Query: 118 GPELDLYGNQSLRQILGDPKFKPKHFITQTLGNASALEIDRFTSDLNDLSLEVSDEIKDN 177
            P  +L+   SLR+IL DP+F  K FI + L  ASA++ID FTS+L +LS +V +E+K N
Sbjct: 175 SPYANLFHPASLRKILSDPQFSAKKFIHERLSEASAVDIDLFTSNLTELSTDVQEEVKRN 234

Query: 178 ISRSYAQVSQVNKDIDRASSELKLLRSSITELKEVISEFETMAEKRLQLE--------RR 229
           I +SY ++  VN D+  AS+ELK LRSSI+EL +V  +F T+A+ R+Q++        +R
Sbjct: 235 IYKSYNEIITVNNDLHEASAELKQLRSSISELTKVTDQFVTVAKSRIQMDEQQKMLHTQR 294

Query: 230 PSTRARSEQPSLLPPAK-----ASRARDRTSVMMLEKMWDSELASLFKAVEGAQKFIAPL 284
           PS+  +++  SLLPP        +  RDRTSVM+LEKMWD++LA+L+K VEGAQK + P 
Sbjct: 295 PSSPQKTQSSSLLPPVSSDINGTNPKRDRTSVMILEKMWDTQLATLYKNVEGAQKHLGPA 354

Query: 285 PGRHILMETGDWYEVNAATLKPLRSIHIFVLNDMLLIAARNQDRRQHEYVACHCHALRDT 344
             RH+L+E+ DW E+N +T KPL+++ +++LND +L+A + +++ QHE +   C  +RD 
Sbjct: 355 SNRHLLIESSDWTELNISTQKPLQTVQLYILNDAVLVAGKTKNK-QHELIVSQCCPIRDV 413

Query: 345 SINPQRENRIELCF--GNRSQCLVQAKNARNYDRLVSTVRGAQDDLNVISQAEEENARRL 402
           +I+  RE R +L F  GN + CL + ++     R++   R A+DDL  I++ E+EN++R+
Sbjct: 414 TISTDREYRTKLMFNFGNSNTCLYETRDINECMRVLDAFRKAKDDLRDITENEKENSKRI 473

Query: 403 RDSFSYMQATQQTPGRELAISPTKGHGRNSSLGNNTPHPRDDPKESYLLQTITASMQSQP 462
           ++S  Y+Q TQQTPGRE + SP K      S  ++   P     + ++LQ ++ S+ S+ 
Sbjct: 474 KESLVYLQNTQQTPGREGSKSPAKRRSMGLS-PSSASRPLSASMDQFILQNLSISVHSRS 532

Query: 463 QFAGSNVGLGDFGRXXXXXXXXXXXXARHNYKEAIKKLESLKKAVQVLEQHTPHENLMIL 522
           +    +     F              AR  +  A+  L   +  +  ++  T  E+ +IL
Sbjct: 533 KSHDWSSLSHKFKLVDNLIEEVDIDLARLKFDSAVNTLLEAESQLATMKDPTKEEDAIIL 592

Query: 523 NLLGLRVSHRSQILVAKLTHLTATEIFDFSKLADYVQNLISLNYAHDALVLFLQNRSKYI 582
           N+L L++  R   ++ K+T      I + + L + V+ LI L      L L LQN+S  I
Sbjct: 593 NVLTLKLDQRRDDILTKVTQRNLF-INEIAHLREGVKTLIRLGLPEAGLDLLLQNKSNLI 651

Query: 583 NELILKIGTFHDPVHYLSQIAVIRFQTLKKVVLRVQEQFQNTGDNFSSTLVSWCDEEADK 642
            EL+L++G+   P  YL+++A++RFQ +K+ V+  +E F    D  SS LVSWC  E +K
Sbjct: 652 QELLLQVGSSEHPSLYLTELAIVRFQIIKRTVIVFRELFHRDHDKLSSILVSWCSHEVEK 711

Query: 643 HFALINKQFLNLEMIPPSSIKSSRRQIDELKSVGLDFVYKLDD 685
           HF L++KQ LN + + P +I+ SR+QID+LK+VGLDFVYKLD+
Sbjct: 712 HFNLVSKQLLNGDKLSPDAIRYSRKQIDDLKTVGLDFVYKLDE 754

 Score = 83.2 bits (204), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 62/106 (58%), Gaps = 7/106 (6%)

Query: 1   MVDLSLRKARNNWKQMSSPPKAKGRS--RSPEDKNFKSNPYQNLKVPSNYSQLPTIGTKE 58
           MVD SLRK RN WK  +S  K       ++ E K   +NPY NL VP N + LPT+  KE
Sbjct: 1   MVDFSLRKTRNYWKGSNSSSKQNSEVSLKNAEKKKPVTNPYANLTVP-NAANLPTLDAKE 59

Query: 59  RNKVGTSMQRRLSFHNPKYVPPTSDHMAVPLPQLGSSELLNVNSGD 104
           RNK  +SMQRRLS H   Y  P  D+ ++PLP   SS L++   GD
Sbjct: 60  RNKAASSMQRRLSIHTANYTAPNLDY-SMPLP---SSNLIDQAMGD 101

>AFR342C [3534] [Homologous to ScYDR496C (PUF6) - SH]
           (1058347..1060296) [1950 bp, 649 aa]
          Length = 649

 Score = 33.1 bits (74), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%)

Query: 389 NVISQAEEENARRLRDSFSYMQATQQTPGRELAISPTKGHGRNSSLGNNTPH 440
           +V +QAE E +  L DS S  +  +Q  G E A S + G G   + G  + H
Sbjct: 42  DVAAQAESEESDALDDSDSEEEEIKQKDGEEAAGSASDGEGEKQAGGEGSQH 93

>Kwal_56.23084
          Length = 762

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 3/40 (7%)

Query: 65  SMQRRL---SFHNPKYVPPTSDHMAVPLPQLGSSELLNVN 101
           S+Q R+   S H  KYV   SD++ VPLP+    ++L  N
Sbjct: 430 SLQDRIECTSCHGVKYVTQVSDYLQVPLPESDDPQMLITN 469

>Scas_666.13*
          Length = 478

 Score = 29.6 bits (65), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 4/59 (6%)

Query: 205 SITELKEVISEFETMAEKRLQLERRPSTRARSEQPSLLPPAKASRARDRTSVMMLEKMW 263
           +IT+L EV+SEF    EKR +L +   T ++ ++  +L  A   R  D  +  + E  W
Sbjct: 333 NITQLVEVVSEF----EKRDRLLKHLETASQDQESKILIFASTKRTCDEVTKYLREDGW 387

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.131    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,261,846
Number of extensions: 907709
Number of successful extensions: 3663
Number of sequences better than 10.0: 60
Number of HSP's gapped: 3758
Number of HSP's successfully gapped: 64
Length of query: 685
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 577
Effective length of database: 12,857,365
Effective search space: 7418699605
Effective search space used: 7418699605
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)