Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_27.1257728828514720.0
Sklu_2177.42882859181e-125
KLLA0E11341g2892859171e-125
YBR101C (FES1)2902878731e-118
Scas_718.82922898581e-116
ADL319W2892858301e-111
CAGL0K12144g2912867981e-106
KLLA0A11286g57970653.1
Kwal_27.105811154126653.5
YNL221C (POP1)87547644.0
Scas_689.1790522645.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.12577
         (285 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.12577                                                         571   0.0  
Sklu_2177.4 YBR101C, Contig c2177 5523-6389 reverse complement        358   e-125
KLLA0E11341g 999242..1000111 similar to sp|P38260 Saccharomyces ...   357   e-125
YBR101C (FES1) [290] chr2 complement(443778..444650) Protein inv...   340   e-118
Scas_718.8                                                            335   e-116
ADL319W [1422] [Homologous to ScYBR101C - SH] complement(135162....   324   e-111
CAGL0K12144g complement(1187185..1188060) similar to sp|P3826 Sa...   311   e-106
KLLA0A11286g complement(978095..979834) highly similar to sp|P39...    30   3.1  
Kwal_27.10581                                                          30   3.5  
YNL221C (POP1) [4383] chr14 complement(231067..233694) Protein c...    29   4.0  
Scas_689.17                                                            29   5.0  

>Kwal_27.12577
          Length = 288

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/285 (100%), Positives = 285/285 (100%)

Query: 1   MEKLLHWSVANSQGDKEAAAKIGQPDPKVLQQLFGGGPDEPALMKQAIVVASNPEATLDA 60
           MEKLLHWSVANSQGDKEAAAKIGQPDPKVLQQLFGGGPDEPALMKQAIVVASNPEATLDA
Sbjct: 1   MEKLLHWSVANSQGDKEAAAKIGQPDPKVLQQLFGGGPDEPALMKQAIVVASNPEATLDA 60

Query: 61  KLVALDNFEMLIENLDNANNIENLKLWNPILELISDPEAEIRALALSIVGTAVQNNEKSQ 120
           KLVALDNFEMLIENLDNANNIENLKLWNPILELISDPEAEIRALALSIVGTAVQNNEKSQ
Sbjct: 61  KLVALDNFEMLIENLDNANNIENLKLWNPILELISDPEAEIRALALSIVGTAVQNNEKSQ 120

Query: 121 NNFLSYEQGLSKIIKIAQDGNEKAAVRAKAFYALSNLVRHNKTSSEKLKALGGLDIITAV 180
           NNFLSYEQGLSKIIKIAQDGNEKAAVRAKAFYALSNLVRHNKTSSEKLKALGGLDIITAV
Sbjct: 121 NNFLSYEQGLSKIIKIAQDGNEKAAVRAKAFYALSNLVRHNKTSSEKLKALGGLDIITAV 180

Query: 181 LKDESATDKLKLRVLAYLTAIMTANEISESLVIALRTKEIVESTLKYLNAQSSVYVVDRV 240
           LKDESATDKLKLRVLAYLTAIMTANEISESLVIALRTKEIVESTLKYLNAQSSVYVVDRV
Sbjct: 181 LKDESATDKLKLRVLAYLTAIMTANEISESLVIALRTKEIVESTLKYLNAQSSVYVVDRV 240

Query: 241 LNFLSHLISSGVAFTENELTALKAGIADIEQMRERLNEDDYQTVK 285
           LNFLSHLISSGVAFTENELTALKAGIADIEQMRERLNEDDYQTVK
Sbjct: 241 LNFLSHLISSGVAFTENELTALKAGIADIEQMRERLNEDDYQTVK 285

>Sklu_2177.4 YBR101C, Contig c2177 5523-6389 reverse complement
          Length = 288

 Score =  358 bits (918), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 179/285 (62%), Positives = 220/285 (77%)

Query: 1   MEKLLHWSVANSQGDKEAAAKIGQPDPKVLQQLFGGGPDEPALMKQAIVVASNPEATLDA 60
           MEKLLHWS+AN+ GDKEA  K GQPDPK+LQQLFG GPDEPALMKQAI+V +NPEA L+ 
Sbjct: 1   MEKLLHWSIANANGDKEAIEKAGQPDPKLLQQLFGSGPDEPALMKQAILVITNPEAELEN 60

Query: 61  KLVALDNFEMLIENLDNANNIENLKLWNPILELISDPEAEIRALALSIVGTAVQNNEKSQ 120
           KL+A DNFEMLIENLDNANNIENLKLW P++ ++   E E+RA ALS++GTAVQNN KSQ
Sbjct: 61  KLIAFDNFEMLIENLDNANNIENLKLWEPLISVLKSNEEELRAFALSVIGTAVQNNTKSQ 120

Query: 121 NNFLSYEQGLSKIIKIAQDGNEKAAVRAKAFYALSNLVRHNKTSSEKLKALGGLDIITAV 180
            NFL YE GL  +I+IA +  E  AVR KAFYALSNL+RHN    EK  +LGGL+II+ V
Sbjct: 121 ENFLKYEDGLPGVIEIAGNAKEVPAVRTKAFYALSNLIRHNSDVYEKFVSLGGLEIISPV 180

Query: 181 LKDESATDKLKLRVLAYLTAIMTANEISESLVIALRTKEIVESTLKYLNAQSSVYVVDRV 240
           L DE++ DKLK+RVLA L A++TA E + S V  LR   I+ESTL +L     +Y++DRV
Sbjct: 181 LGDETSNDKLKMRVLALLAAVLTAVEFNASFVEVLRKDGIIESTLDFLVPDGGLYIIDRV 240

Query: 241 LNFLSHLISSGVAFTENELTALKAGIADIEQMRERLNEDDYQTVK 285
           LNFLS LIS G  F + E++ L+ G  +IE +++RLNEDDYQTV+
Sbjct: 241 LNFLSQLISFGFKFNKQEMSKLRQGYENIESLKDRLNEDDYQTVR 285

>KLLA0E11341g 999242..1000111 similar to sp|P38260 Saccharomyces
           cerevisiae YBR101c singleton, start by similarity
          Length = 289

 Score =  357 bits (917), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 166/285 (58%), Positives = 217/285 (76%)

Query: 1   MEKLLHWSVANSQGDKEAAAKIGQPDPKVLQQLFGGGPDEPALMKQAIVVASNPEATLDA 60
           MEKLLHWS+AN+QGD EA A+ GQPDPK+L+QLFGGGPDEP LMK A+ V SNPEATL+ 
Sbjct: 1   MEKLLHWSIANAQGDDEAKARAGQPDPKLLEQLFGGGPDEPTLMKHAMAVISNPEATLEN 60

Query: 61  KLVALDNFEMLIENLDNANNIENLKLWNPILELISDPEAEIRALALSIVGTAVQNNEKSQ 120
           KLVA DNFEMLIENLDNANNIEN+KLW P++ ++ DPE E+RA ALS+ GTAVQNN++SQ
Sbjct: 61  KLVAFDNFEMLIENLDNANNIENMKLWEPLITVLDDPEPELRAFALSVTGTAVQNNDQSQ 120

Query: 121 NNFLSYEQGLSKIIKIAQDGNEKAAVRAKAFYALSNLVRHNKTSSEKLKALGGLDIITAV 180
           NNF  Y+  L+K+IK+A    E A VR KAFY LSNL+RHNK   ++   L GL II  V
Sbjct: 121 NNFAKYDGALAKVIKLASGRAEDAQVRTKAFYTLSNLIRHNKLIYDQFNQLNGLQIIAPV 180

Query: 181 LKDESATDKLKLRVLAYLTAIMTANEISESLVIALRTKEIVESTLKYLNAQSSVYVVDRV 240
           LKD +A++KLKLR +A L+ ++T  +++      LR   I+E+TL++L+ + ++Y++DRV
Sbjct: 181 LKDANASEKLKLRAMALLSTVLTVADMNADFFALLRAYNIIETTLEFLHPECNLYLIDRV 240

Query: 241 LNFLSHLISSGVAFTENELTALKAGIADIEQMRERLNEDDYQTVK 285
           LNF S LI+ G  F+  EL  LK G+ +IE +  +LNEDDY+TV+
Sbjct: 241 LNFFSQLINVGFEFSATELEKLKVGVKNIEPVEAQLNEDDYKTVQ 285

>YBR101C (FES1) [290] chr2 complement(443778..444650) Protein
           involved in resistance to H2O2 [873 bp, 290 aa]
          Length = 290

 Score =  340 bits (873), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 169/287 (58%), Positives = 216/287 (75%), Gaps = 2/287 (0%)

Query: 1   MEKLLHWSVANSQGDKEAAAKIGQPDPKVLQQLFGGG-PDEPALMKQAIVVASNPEATLD 59
           MEKLL WS+ANSQGDKEA A+ GQPDPK+LQQLFGGG PD+P LMK+++ V  NPE  L+
Sbjct: 1   MEKLLQWSIANSQGDKEAMARAGQPDPKLLQQLFGGGGPDDPTLMKESMAVIMNPEVDLE 60

Query: 60  AKLVALDNFEMLIENLDNANNIENLKLWNPILE-LISDPEAEIRALALSIVGTAVQNNEK 118
            KLVA DNFEMLIENLDNANNIENLKLW P+L+ L+   + E+RA ALSI+GTAVQNN  
Sbjct: 61  TKLVAFDNFEMLIENLDNANNIENLKLWEPLLDVLVQTKDEELRAAALSIIGTAVQNNLD 120

Query: 119 SQNNFLSYEQGLSKIIKIAQDGNEKAAVRAKAFYALSNLVRHNKTSSEKLKALGGLDIIT 178
           SQNNF+ Y+ GL  +I+IA D  +   VR KAFYALSNL+R++K  SEK   L GLD I 
Sbjct: 121 SQNNFMKYDNGLRSLIEIASDKTKPLDVRTKAFYALSNLIRNHKDISEKFFKLNGLDCIA 180

Query: 179 AVLKDESATDKLKLRVLAYLTAIMTANEISESLVIALRTKEIVESTLKYLNAQSSVYVVD 238
            VL D +A  KLK+R +A LTA +++ +I E+++  LR   ++EST++ L+ +S++ ++D
Sbjct: 181 PVLSDNTAKPKLKMRAIALLTAYLSSVKIDENIISVLRKDGVIESTIECLSDESNLNIID 240

Query: 239 RVLNFLSHLISSGVAFTENELTALKAGIADIEQMRERLNEDDYQTVK 285
           RVL+FLSHLISSG+ F E EL  L  G   IE +++RLNEDDY  VK
Sbjct: 241 RVLSFLSHLISSGIKFNEQELHKLNEGYKHIEPLKDRLNEDDYLAVK 287

>Scas_718.8
          Length = 292

 Score =  335 bits (858), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 162/289 (56%), Positives = 217/289 (75%), Gaps = 4/289 (1%)

Query: 1   MEKLLHWSVANSQGDKEAAAKIGQPDPKVLQQLFGG----GPDEPALMKQAIVVASNPEA 56
           MEKLLHWS+AN+QGDKEA AK GQPDP++LQQLFGG    GPD+P LMK+ + V  NP+ 
Sbjct: 1   MEKLLHWSIANAQGDKEAIAKAGQPDPRLLQQLFGGAGSSGPDDPTLMKEQMEVIMNPDV 60

Query: 57  TLDAKLVALDNFEMLIENLDNANNIENLKLWNPILELISDPEAEIRALALSIVGTAVQNN 116
            LD KLVA+DNFEMLIENLDNANNIENLKLW+PIL+++   E E+ + ALSI+GT+VQNN
Sbjct: 61  ELDIKLVAIDNFEMLIENLDNANNIENLKLWDPILKILEFEEDELVSQALSIIGTSVQNN 120

Query: 117 EKSQNNFLSYEQGLSKIIKIAQDGNEKAAVRAKAFYALSNLVRHNKTSSEKLKALGGLDI 176
             SQ+ FL +E GL+K+I++A D ++   VR KA YALSNLVR+++  + K + L GLDI
Sbjct: 121 TNSQDKFLKHENGLNKVIQLANDKSQSFEVRTKALYALSNLVRNHEHMATKFRELNGLDI 180

Query: 177 ITAVLKDESATDKLKLRVLAYLTAIMTANEISESLVIALRTKEIVESTLKYLNAQSSVYV 236
           I  +L D  A  KLK+R +A LTA +T+ EISESL+  +R    +E+T+  LN+++ + +
Sbjct: 181 IPPILNDPKAKTKLKMRAIALLTAFLTSTEISESLISDMRKDGTIEATIDCLNSETDLNL 240

Query: 237 VDRVLNFLSHLISSGVAFTENELTALKAGIADIEQMRERLNEDDYQTVK 285
           +DRVLN L+ LIS+G+ F + E+  LK G   +E +++RLNEDDY TVK
Sbjct: 241 IDRVLNLLAQLISAGIKFNQVEMEKLKTGFQKVEPLKDRLNEDDYLTVK 289

>ADL319W [1422] [Homologous to ScYBR101C - SH]
           complement(135162..136031) [870 bp, 289 aa]
          Length = 289

 Score =  324 bits (830), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 154/285 (54%), Positives = 212/285 (74%)

Query: 1   MEKLLHWSVANSQGDKEAAAKIGQPDPKVLQQLFGGGPDEPALMKQAIVVASNPEATLDA 60
           M+KLLHWS+AN+QGDKEAAAK G PDPK+LQQLFGGGPDEPALM+ A+ V  NPEAT+D 
Sbjct: 1   MDKLLHWSIANAQGDKEAAAKAGAPDPKLLQQLFGGGPDEPALMRDAMAVIMNPEATVDN 60

Query: 61  KLVALDNFEMLIENLDNANNIENLKLWNPILELISDPEAEIRALALSIVGTAVQNNEKSQ 120
           KLVA DNFEMLIENLDNANNIEN++LW P++ ++   E ++R  ALS+VGTAVQNNEKSQ
Sbjct: 61  KLVAFDNFEMLIENLDNANNIENMRLWAPLISILESEEEQLRECALSVVGTAVQNNEKSQ 120

Query: 121 NNFLSYEQGLSKIIKIAQDGNEKAAVRAKAFYALSNLVRHNKTSSEKLKALGGLDIITAV 180
           +NFL ++  + KII++A+  +E   VR KAFYALSN+VRHNK +S      GGL+I+  V
Sbjct: 121 SNFLKHDGAMKKIIELARKDSESEQVRTKAFYALSNIVRHNKDASALFVDNGGLEIMAPV 180

Query: 181 LKDESATDKLKLRVLAYLTAIMTANEISESLVIALRTKEIVESTLKYLNAQSSVYVVDRV 240
           LK ++  +K+K+R LA LT+++T+    E     +R  +I+E++L++L   ++ Y++DRV
Sbjct: 181 LKHQNTGEKMKIRALALLTSVLTSLSADEKFSDRIREDKILEASLEHLAPSANPYLIDRV 240

Query: 241 LNFLSHLISSGVAFTENELTALKAGIADIEQMRERLNEDDYQTVK 285
           LN L  +  SG  F  +EL+ ++   A +  ++++LNEDDY  VK
Sbjct: 241 LNLLVLMKGSGAKFDTDELSKIRKSFASLYPVKDQLNEDDYNAVK 285

>CAGL0K12144g complement(1187185..1188060) similar to sp|P3826
           Saccharomyces cerevisiae YBR101c, start by similarity
          Length = 291

 Score =  311 bits (798), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 160/286 (55%), Positives = 211/286 (73%), Gaps = 2/286 (0%)

Query: 1   MEKLLHWSVANSQGDKEAAAKIGQPDPKVLQQLFGGG-PDEPALMKQAIVVASNPEATLD 59
           MEKLLHWS+AN+QGDKEA  K G PDPK+L+QLFGGG PD+P LMK+A+ V  NPEA L+
Sbjct: 1   MEKLLHWSIANAQGDKEAIEKAGAPDPKLLEQLFGGGGPDDPTLMKEAMAVIMNPEADLE 60

Query: 60  AKLVALDNFEMLIENLDNANNIENLKLWNPILELISDPEAEIRALALSIVGTAVQNNEKS 119
            KL+A DNFEMLIENLDNANNIEN+KLW PIL+ + D EA++RA  LS++GTAVQNN  S
Sbjct: 61  NKLIAYDNFEMLIENLDNANNIENMKLWEPILKTLEDNEADLRASGLSVIGTAVQNNTDS 120

Query: 120 QNNFLSYEQGLSKIIKIAQDGNEKAAVRAKAFYALSNLVRHNKTSSEKLKALGGLDIITA 179
           Q NFL YE GL  +I IA+   E + VR KAFYALSNL+R++  + +K +ALGGLD+   
Sbjct: 121 QTNFLKYEGGLKILIAIAKSSEEPSDVRIKAFYALSNLLRNHIEAGKKFQALGGLDVFPV 180

Query: 180 VLKDESATDKLKLRVLAYLTAIMTANEISESLVIALRTKEIVESTLKYLNAQSSVYVVDR 239
            L D  AT KLK+R ++ L+A +++++I E L+  LR   ++ S ++ L    +V V+DR
Sbjct: 181 ALNDPKATPKLKMRAISALSAFLSSSKIDEQLLDTLRKDGVLVSVIENL-GTDNVNVIDR 239

Query: 240 VLNFLSHLISSGVAFTENELTALKAGIADIEQMRERLNEDDYQTVK 285
           VL+ LSHLISSG+ F ++EL  L+     I+ +++RLNEDDY  VK
Sbjct: 240 VLSVLSHLISSGIKFNDSELEMLQKEFEKIDSLKDRLNEDDYLAVK 285

>KLLA0A11286g complement(978095..979834) highly similar to sp|P39968
           Saccharomyces cerevisiae YEL013w VAC8 required for
           vacuole inheritance and protein targeting from the
           cytoplasm to vacuole singleton, start by similarity
          Length = 579

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 6/70 (8%)

Query: 89  PILELISDPEAEIRALALSIVGTAVQNNEKSQNNFLSYEQ-GLSKIIKIAQDGNEKAAVR 147
           PIL L+++P+ +IR  + + +G    NNE   N  L  E  GL  +I+  Q  ++   V+
Sbjct: 91  PILMLLTNPDPQIRIASCAALGNLAVNNE---NKLLIVEMGGLEPLIE--QMKSDNVEVQ 145

Query: 148 AKAFYALSNL 157
             A   ++NL
Sbjct: 146 CNAVGCITNL 155

>Kwal_27.10581
          Length = 1154

 Score = 29.6 bits (65), Expect = 3.5,   Method: Composition-based stats.
 Identities = 28/126 (22%), Positives = 51/126 (40%), Gaps = 14/126 (11%)

Query: 26  DPKVLQQLFGGGPDEPALMKQAIVVASNPEATLDAKLVALDNFEMLIENLDNANNIENLK 85
           DP +  +L    PD        ++V + PE   D K  A +  ++ I N+ +A N E   
Sbjct: 663 DPSLTPELTFNNPD--------VIVDNVPENEPDRKSWAKEQRKIQIANMKDAQNFEERS 714

Query: 86  LWNPILELISDPEAEIRALALSIVGTAVQNNEKSQNNFLSYEQGLSKIIKIAQDGNEKAA 145
                 +L  D    +       + T+ Q+ + S +  +     L++   +A DGNE+  
Sbjct: 715 ------DLPDDEIVRLETRQNPFIDTSEQHKDVSLSTAVPDLTNLNEAPHMAHDGNEQKR 768

Query: 146 VRAKAF 151
           +    F
Sbjct: 769 IEVDQF 774

>YNL221C (POP1) [4383] chr14 complement(231067..233694) Protein
           component of both RNase P and RNase MRP, involved in
           both tRNA maturation (RNase P) and in 5.8S rRNA
           processing (RNase MRP) [2628 bp, 875 aa]
          Length = 875

 Score = 29.3 bits (64), Expect = 4.0,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 3/47 (6%)

Query: 77  NANNIENLKLWNPILELISDPEAEIRALALSI---VGTAVQNNEKSQ 120
           NA  + ++   N +LE   D EA+ +A++LSI   +  A+  N K Q
Sbjct: 693 NAQGVRDINCVNDVLEFCKDYEAKTKAMSLSIEENIPVALCKNRKCQ 739

>Scas_689.17
          Length = 905

 Score = 29.3 bits (64), Expect = 5.0,   Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 18/22 (81%)

Query: 205 NEISESLVIALRTKEIVESTLK 226
           NEI+ SL+I+LRT+EI E  +K
Sbjct: 797 NEIARSLIISLRTREIKEVFMK 818

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.129    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,421,796
Number of extensions: 327822
Number of successful extensions: 1070
Number of sequences better than 10.0: 36
Number of HSP's gapped: 1063
Number of HSP's successfully gapped: 37
Length of query: 285
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 185
Effective length of database: 13,134,309
Effective search space: 2429847165
Effective search space used: 2429847165
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 61 (28.1 bits)