Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_27.119511869184295380.0
Sklu_2124.11830180277640.0
KLLA0E08107g1829180072400.0
YBR208C (DUR1,2)1835180169020.0
Scas_721.401834180365860.0
CAGL0M05533g1834180861660.0
ADR051C1819179959990.0
YBR218C (PYC2)11804597033e-75
CAGL0K06787g11754597007e-75
KLLA0C05764g11734776944e-74
Scas_686.1711764636821e-72
CAGL0F06941g11804616766e-72
Kwal_14.180311744636732e-71
YGL062W (PYC1)11784846651e-70
AAR162C11714876642e-70
Scas_563.1212164366545e-69
Sklu_1458.111324406472e-68
YMR207C (HFA1)21234656168e-64
Scas_720.7422314725943e-61
KLLA0F06072g22315065882e-60
Kwal_23.615722305085872e-60
AAR071W22314715836e-60
CAGL0L10780g22335065811e-59
YNR016C (ACC1)22334725731e-58
Scas_684.254824432581e-22
ABR140C4632042331e-19
Kwal_23.42494651912331e-19
KLLA0A09845g4694232304e-19
YMR293C4644432197e-18
CAGL0M13585g4671732125e-17
Kwal_56.222955832112021e-15
Scas_721.665731491781e-12
Sklu_2417.115911791691e-11
Sklu_2417.105911791691e-11
Sklu_1884.25461411512e-09
YDR242W (AMD2)5491291441e-08
Kwal_34.157245561261342e-07
KLLA0E15444g22281821352e-07
ACR263C22401831325e-07
CAGL0L05676g22112961308e-07
YJL130C (URA2)22142971253e-06
Kwal_33.1406122212971245e-06
Sklu_2413.411222181227e-06
Scas_582.4*21932971191e-05
Sklu_2331.122202961172e-05
Sklu_2072.34503861153e-05
Kwal_55.1978311212391137e-05
KLLA0F03190g11172151111e-04
Sklu_2136.36171371064e-04
KLLA0B08800g5701251020.001
Scas_691.191117270960.008
ABR157W1113233910.031
Kwal_27.10438569132890.037
CAGL0C04917g1113173900.038
YJR109C (CPA2)1118173850.14
KLLA0D12628g578139810.40
Kwal_27.1148547160790.68
Kwal_14.783128043761.5
CAGL0G00550g23054741.5
YHR014W (SPO13)29151741.7
YKL162C40252751.8
Scas_712.17793120743.0
Sklu_2372.4128043716.1
YLR443W (ECM7)44871699.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.11951
         (1842 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.11951                                                        3678   0.0  
Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement         2995   0.0  
KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharo...  2793   0.0  
YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea amid...  2663   0.0  
Scas_721.40                                                          2541   0.0  
CAGL0M05533g complement(588667..594171) similar to sp|P32528 Sac...  2379   0.0  
ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH] (796213..8...  2315   0.0  
YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate ca...   275   3e-75
CAGL0K06787g complement(659290..662817) highly similar to sp|P32...   274   7e-75
KLLA0C05764g complement(512470..515991) highly similar to sp|P32...   271   4e-74
Scas_686.17                                                           267   1e-72
CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharo...   265   6e-72
Kwal_14.1803                                                          263   2e-71
YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase...   260   1e-70
AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (P...   260   2e-70
Scas_563.12                                                           256   5e-69
Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement         253   2e-68
YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein w...   241   8e-64
Scas_720.74                                                           233   3e-61
KLLA0F06072g 583276..589971 highly similar to sp|Q00955 Saccharo...   231   2e-60
Kwal_23.6157                                                          230   2e-60
AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C (H...   229   6e-60
CAGL0L10780g complement(1149588..1156289) highly similar to sp|Q...   228   1e-59
YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-Co...   225   1e-58
Scas_684.25                                                           103   1e-22
ABR140C [732] [Homologous to ScYMR293C - SH] (662185..663576) [1...    94   1e-19
Kwal_23.4249                                                           94   1e-19
KLLA0A09845g complement(862467..863876) similar to sp|Q03557 Sac...    93   4e-19
YMR293C (YMR293C) [4247] chr13 complement(855398..856792) Protei...    89   7e-18
CAGL0M13585g complement(1335488..1336891) similar to sp|Q03557 S...    86   5e-17
Kwal_56.22295                                                          82   1e-15
Scas_721.66                                                            73   1e-12
Sklu_2417.11 , Contig c2417 20071-21846                                70   1e-11
Sklu_2417.10 , Contig c2417 20071-21846                                70   1e-11
Sklu_1884.2 YDR242W, Contig c1884 1484-3124 reverse complement         63   2e-09
YDR242W (AMD2) [1076] chr4 (946799..948448) Protein with similar...    60   1e-08
Kwal_34.15724                                                          56   2e-07
KLLA0E15444g 1370741..1377427 highly similar to sp|P07259 Saccha...    57   2e-07
ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH] (827830..83...    55   5e-07
CAGL0L05676g 619734..626369 highly similar to sp|P07259 Saccharo...    55   8e-07
YJL130C (URA2) [2788] chr10 complement(165641..172285) Multifunc...    53   3e-06
Kwal_33.14061                                                          52   5e-06
Sklu_2413.4 YJR109C, Contig c2413 10886-14254                          52   7e-06
Scas_582.4*                                                            50   1e-05
Sklu_2331.1 YJL130C, Contig c2331 2029-8691                            50   2e-05
Sklu_2072.3 , Contig c2072 3010-4362 reverse complement                49   3e-05
Kwal_55.19783                                                          48   7e-05
KLLA0F03190g complement(296883..300236) highly similar to sp|P03...    47   1e-04
Sklu_2136.3 , Contig c2136 3336-5189 reverse complement                45   4e-04
KLLA0B08800g complement(772732..774444) similar to ca|CA4426|CaA...    44   0.001
Scas_691.19                                                            42   0.008
ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH] complement(6...    40   0.031
Kwal_27.10438                                                          39   0.037
CAGL0C04917g 457506..460847 highly similar to sp|P03965 Saccharo...    39   0.038
YJR109C (CPA2) [3001] chr10 complement(629500..632856) Carbamoyl...    37   0.14 
KLLA0D12628g 1071637..1073373 weakly similar to sp|P22580 Saccha...    36   0.40 
Kwal_27.11485                                                          35   0.68 
Kwal_14.783                                                            34   1.5  
CAGL0G00550g 59768..60460 similar to sp|P40325 Saccharomyces cer...    33   1.5  
YHR014W (SPO13) [2300] chr8 (132039..132914) Meiosis-specific pr...    33   1.7  
YKL162C (YKL162C) [3108] chr11 complement(147635..148843) Protei...    33   1.8  
Scas_712.17                                                            33   3.0  
Sklu_2372.4 YKL215C, Contig c2372 8103-11945                           32   6.1  
YLR443W (ECM7) [3818] chr12 (1022621..1023967) Protein possibly ...    31   9.3  

>Kwal_27.11951
          Length = 1869

 Score = 3678 bits (9538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1788/1842 (97%), Positives = 1788/1842 (97%)

Query: 1    MYIKKRKDEEVERNWMLKRVSSDMGLTQAKERIAQIPNNMSSVNTLGWSVQDWLGFHXXX 60
            MYIKKRKDEEVERNWMLKRVSSDMGLTQAKERIAQIPNNMSSVNTLGWSVQDWLGFH   
Sbjct: 1    MYIKKRKDEEVERNWMLKRVSSDMGLTQAKERIAQIPNNMSSVNTLGWSVQDWLGFHAEA 60

Query: 61   XXXXXXXXXXXXIGAQKSAPEDPAWISLVSQEHLEHQWRILQSKGDKKELPLYGVPIAVK 120
                        IGAQKSAPEDPAWISLVSQEHLEHQWRILQSKGDKKELPLYGVPIAVK
Sbjct: 61   TPEASLAALSALIGAQKSAPEDPAWISLVSQEHLEHQWRILQSKGDKKELPLYGVPIAVK 120

Query: 121  DNIDATGCETTAACPEFAYTPSNDSTVVALLRDAGAIVIGKTNLDQFATGLVGTRSPYGK 180
            DNIDATGCETTAACPEFAYTPSNDSTVVALLRDAGAIVIGKTNLDQFATGLVGTRSPYGK
Sbjct: 121  DNIDATGCETTAACPEFAYTPSNDSTVVALLRDAGAIVIGKTNLDQFATGLVGTRSPYGK 180

Query: 181  TPCVFSNEHXXXXXXXXXXXXXXXXIVPLALGTDTAGSGRVPAALNNLIGLKPSKGVFSC 240
            TPCVFSNEH                IVPLALGTDTAGSGRVPAALNNLIGLKPSKGVFSC
Sbjct: 181  TPCVFSNEHVSGGSSAGSASVVGRGIVPLALGTDTAGSGRVPAALNNLIGLKPSKGVFSC 240

Query: 241  SGVVPACKSLDCVSIFALNLGDAERCFKVMAQPDTEKDEYSRAMPANPLQKYAKDATIAV 300
            SGVVPACKSLDCVSIFALNLGDAERCFKVMAQPDTEKDEYSRAMPANPLQKYAKDATIAV
Sbjct: 241  SGVVPACKSLDCVSIFALNLGDAERCFKVMAQPDTEKDEYSRAMPANPLQKYAKDATIAV 300

Query: 301  PTKLPWYDETENFVHYAAAIENLKKTGAKVVEVDFEPLLELARCLYEGAWVAERYEATRD 360
            PTKLPWYDETENFVHYAAAIENLKKTGAKVVEVDFEPLLELARCLYEGAWVAERYEATRD
Sbjct: 301  PTKLPWYDETENFVHYAAAIENLKKTGAKVVEVDFEPLLELARCLYEGAWVAERYEATRD 360

Query: 361  FFAKNPSESSLDPTVTKIIKGGANYDAADAFRYEYKRQGILQKVSKLLETIDVLCVPTCP 420
            FFAKNPSESSLDPTVTKIIKGGANYDAADAFRYEYKRQGILQKVSKLLETIDVLCVPTCP
Sbjct: 361  FFAKNPSESSLDPTVTKIIKGGANYDAADAFRYEYKRQGILQKVSKLLETIDVLCVPTCP 420

Query: 421  HNPTFAQLEAMPVEMNSRQGTWTNFVNLADLAALAVPCGFRSDGLPTGITLIGKTFTDYA 480
            HNPTFAQLEAMPVEMNSRQGTWTNFVNLADLAALAVPCGFRSDGLPTGITLIGKTFTDYA
Sbjct: 421  HNPTFAQLEAMPVEMNSRQGTWTNFVNLADLAALAVPCGFRSDGLPTGITLIGKTFTDYA 480

Query: 481  LLELANRYFQIAFPNNSRTYGKFLETPITTQDNLQGPPFSTEDSIKLAVVGAHLKGLPLH 540
            LLELANRYFQIAFPNNSRTYGKFLETPITTQDNLQGPPFSTEDSIKLAVVGAHLKGLPLH
Sbjct: 481  LLELANRYFQIAFPNNSRTYGKFLETPITTQDNLQGPPFSTEDSIKLAVVGAHLKGLPLH 540

Query: 541  WQLEKVNAQYIGSPKTSPNYRLYALPKTGPVLKPGLRRVDSEGGAQIQLEVYSVPKDQFG 600
            WQLEKVNAQYIGSPKTSPNYRLYALPKTGPVLKPGLRRVDSEGGAQIQLEVYSVPKDQFG
Sbjct: 541  WQLEKVNAQYIGSPKTSPNYRLYALPKTGPVLKPGLRRVDSEGGAQIQLEVYSVPKDQFG 600

Query: 601  TFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQDGTKDITELGSFKTYVDQLAREESE 660
            TFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQDGTKDITELGSFKTYVDQLAREESE
Sbjct: 601  TFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQDGTKDITELGSFKTYVDQLAREESE 660

Query: 661  KKKPFETVLVANRGEIAVRXXXXXXXXXXXSVAVYSDPDKYSQHVTDADVAVALKGRTAA 720
            KKKPFETVLVANRGEIAVR           SVAVYSDPDKYSQHVTDADVAVALKGRTAA
Sbjct: 661  KKKPFETVLVANRGEIAVRIIKTLKKLKIKSVAVYSDPDKYSQHVTDADVAVALKGRTAA 720

Query: 721  ETYLDIDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGIVFVGPAGDAIRKLGLKH 780
            ETYLDIDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGIVFVGPAGDAIRKLGLKH
Sbjct: 721  ETYLDIDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGIVFVGPAGDAIRKLGLKH 780

Query: 781  SAREIAEKAGVPLVPGSGLVKTPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIE 840
            SAREIAEKAGVPLVPGSGLVKTPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIE
Sbjct: 781  SAREIAEKAGVPLVPGSGLVKTPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIE 840

Query: 841  RVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKAIAIGERDCSLQRRNQKV 900
            RVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKAIAIGERDCSLQRRNQKV
Sbjct: 841  RVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKAIAIGERDCSLQRRNQKV 900

Query: 901  IEETPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEH 960
            IEETPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEH
Sbjct: 901  IEETPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEH 960

Query: 961  PITEMVTGLDLVEWMLLIAAGTPPDFDATKITVTGASIEARLYAENPVKDFRPSPGQLTD 1020
            PITEMVTGLDLVEWMLLIAAGTPPDFDATKITVTGASIEARLYAENPVKDFRPSPGQLTD
Sbjct: 961  PITEMVTGLDLVEWMLLIAAGTPPDFDATKITVTGASIEARLYAENPVKDFRPSPGQLTD 1020

Query: 1021 VSFPEWARVDTWVSKGTTISAEYDPTLAKIIVHGKDRDEAIQKLNQALNETSIYGCITNI 1080
            VSFPEWARVDTWVSKGTTISAEYDPTLAKIIVHGKDRDEAIQKLNQALNETSIYGCITNI
Sbjct: 1021 VSFPEWARVDTWVSKGTTISAEYDPTLAKIIVHGKDRDEAIQKLNQALNETSIYGCITNI 1080

Query: 1081 DYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEITSPGAYTTVQDYPGRVRHWRIGVPPS 1140
            DYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEITSPGAYTTVQDYPGRVRHWRIGVPPS
Sbjct: 1081 DYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEITSPGAYTTVQDYPGRVRHWRIGVPPS 1140

Query: 1141 GPMDSYSFRLANRIVGNHYKAPAIEITLNGPKLLFHTDAVIAITGAKAPCTINGSDVSQN 1200
            GPMDSYSFRLANRIVGNHYKAPAIEITLNGPKLLFHTDAVIAITGAKAPCTINGSDVSQN
Sbjct: 1141 GPMDSYSFRLANRIVGNHYKAPAIEITLNGPKLLFHTDAVIAITGAKAPCTINGSDVSQN 1200

Query: 1201 KPLSVKKGDQLTVGKLSDGCRAYLAIRGGIDVPEYLGSRSTFALGNMGGYNGRVLKLGDV 1260
            KPLSVKKGDQLTVGKLSDGCRAYLAIRGGIDVPEYLGSRSTFALGNMGGYNGRVLKLGDV
Sbjct: 1201 KPLSVKKGDQLTVGKLSDGCRAYLAIRGGIDVPEYLGSRSTFALGNMGGYNGRVLKLGDV 1260

Query: 1261 LFLNQPELPSSGIPAPVYDPSEPPASLLPAISGSKEWKIGVTCGPHGSPDFFKPESVEEF 1320
            LFLNQPELPSSGIPAPVYDPSEPPASLLPAISGSKEWKIGVTCGPHGSPDFFKPESVEEF
Sbjct: 1261 LFLNQPELPSSGIPAPVYDPSEPPASLLPAISGSKEWKIGVTCGPHGSPDFFKPESVEEF 1320

Query: 1321 FSEQWKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHPSNAHDYVYSLGAINFTGDEPVII 1380
            FSEQWKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHPSNAHDYVYSLGAINFTGDEPVII
Sbjct: 1321 FSEQWKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHPSNAHDYVYSLGAINFTGDEPVII 1380

Query: 1381 TADGPSLGGFVCQAVVPEGELWKVGQVKPGDLIQFVPVSYETARVLKESQDQAIETFENG 1440
            TADGPSLGGFVCQAVVPEGELWKVGQVKPGDLIQFVPVSYETARVLKESQDQAIETFENG
Sbjct: 1381 TADGPSLGGFVCQAVVPEGELWKVGQVKPGDLIQFVPVSYETARVLKESQDQAIETFENG 1440

Query: 1441 SLRTLTSELVLPAAENPVLAQLPRYSEFSPKVTYRQAGDRYVLVEYGENEMDLNISYRVN 1500
            SLRTLTSELVLPAAENPVLAQLPRYSEFSPKVTYRQAGDRYVLVEYGENEMDLNISYRVN
Sbjct: 1441 SLRTLTSELVLPAAENPVLAQLPRYSEFSPKVTYRQAGDRYVLVEYGENEMDLNISYRVN 1500

Query: 1501 RLINLVEKNKTIGIVEMSQGVRSVLVEFDGYKISQKALLETLIAYEGEIKFDRNWSIKSK 1560
            RLINLVEKNKTIGIVEMSQGVRSVLVEFDGYKISQKALLETLIAYEGEIKFDRNWSIKSK
Sbjct: 1501 RLINLVEKNKTIGIVEMSQGVRSVLVEFDGYKISQKALLETLIAYEGEIKFDRNWSIKSK 1560

Query: 1561 VFKLPLAFEDSETLECVKRYQETIRSKAPWLPNNVDFIADVNGISHSDVEDMLYQARXXX 1620
            VFKLPLAFEDSETLECVKRYQETIRSKAPWLPNNVDFIADVNGISHSDVEDMLYQAR   
Sbjct: 1561 VFKLPLAFEDSETLECVKRYQETIRSKAPWLPNNVDFIADVNGISHSDVEDMLYQARFLV 1620

Query: 1621 XXXXXXXXXAPCAVPLNPTHRFLGSKYNPSRTYTKNGTVGIGGMYMCIYAMDSPGGYQLV 1680
                     APCAVPLNPTHRFLGSKYNPSRTYTKNGTVGIGGMYMCIYAMDSPGGYQLV
Sbjct: 1621 LGLGDVFLGAPCAVPLNPTHRFLGSKYNPSRTYTKNGTVGIGGMYMCIYAMDSPGGYQLV 1680

Query: 1681 GRTIPIWDKLQLGAHSSQHPWLLTPFDQVEYYQVTEDELNKFTEECENGQFPVQVEESTF 1740
            GRTIPIWDKLQLGAHSSQHPWLLTPFDQVEYYQVTEDELNKFTEECENGQFPVQVEESTF
Sbjct: 1681 GRTIPIWDKLQLGAHSSQHPWLLTPFDQVEYYQVTEDELNKFTEECENGQFPVQVEESTF 1740

Query: 1741 DHGEYLKWIDANSEIIKEFQNKQNGEKAEEFAKLIQESNAELEKAPDSQGAVEEEFPEDA 1800
            DHGEYLKWIDANSEIIKEFQNKQNGEKAEEFAKLIQESNAELEKAPDSQGAVEEEFPEDA
Sbjct: 1741 DHGEYLKWIDANSEIIKEFQNKQNGEKAEEFAKLIQESNAELEKAPDSQGAVEEEFPEDA 1800

Query: 1801 EMVYSEYSGRFWKPLVSVGDVVKAGDGLIVVEAMKTEMMVSA 1842
            EMVYSEYSGRFWKPLVSVGDVVKAGDGLIVVEAMKTEMMVSA
Sbjct: 1801 EMVYSEYSGRFWKPLVSVGDVVKAGDGLIVVEAMKTEMMVSA 1842

>Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement
          Length = 1830

 Score = 2995 bits (7764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1415/1802 (78%), Positives = 1576/1802 (87%), Gaps = 1/1802 (0%)

Query: 42   SVNTLGWSVQDWLGFHXXXXXXXXXXXXXXXIGAQKSAPEDPAWISLVSQEHLEHQWRIL 101
            SV+TLGWS QDW+ FH               + +QKSAPEDPAWISL+++ +L HQW++L
Sbjct: 2    SVDTLGWSAQDWIDFHGKSTPEHSYNTLLSLLKSQKSAPEDPAWISLINEANLAHQWKVL 61

Query: 102  QSKGDKKELPLYGVPIAVKDNIDATGCETTAACPEFAYTPSNDSTVVALLRDAGAIVIGK 161
            QSK +K++LPLYGVPIAVKDNID+ G  TTAACP F Y PS DSTVVALL+DAGAIVIGK
Sbjct: 62   QSKANKQQLPLYGVPIAVKDNIDSKGSPTTAACPAFEYNPSADSTVVALLKDAGAIVIGK 121

Query: 162  TNLDQFATGLVGTRSPYGKTPCVFSNEHXXXXXXXXXXXXXXXXIVPLALGTDTAGSGRV 221
            TNLDQFATGLVGTRSPYGKTPCVFS++H                IVP+ALGTDTAGSGRV
Sbjct: 122  TNLDQFATGLVGTRSPYGKTPCVFSDKHVSGGSSAGSASAVGRGIVPIALGTDTAGSGRV 181

Query: 222  PAALNNLIGLKPSKGVFSCSGVVPACKSLDCVSIFALNLGDAERCFKVMAQPDTEKDEYS 281
            PAALNNLIGLKP+KG+FSCSGVVPACKSLDCVS+FA+NL DAERCFKVMA+PD E DEYS
Sbjct: 182  PAALNNLIGLKPTKGLFSCSGVVPACKSLDCVSVFAMNLSDAERCFKVMAKPDLENDEYS 241

Query: 282  RAMPANPLQKYAKDATIAVPTKLPWYDETENFVHYAAAIENLKKTGAKVVEVDFEPLLEL 341
            R +P+NPLQKY K+ TIA+P ++PWY ETEN   YA AIENLK  GA +V +DFEPLL L
Sbjct: 242  RPLPSNPLQKYPKNVTIAIPKEVPWYGETENPKLYAKAIENLKVAGASIVTIDFEPLLAL 301

Query: 342  ARCLYEGAWVAERYEATRDFFAKNPSESSLDPTVTKIIKGGANYDAADAFRYEYKRQGIL 401
            ARCLYEGAWVAERYEAT+DFFA NP ESSLDPTVT IIK    YDAAD+FRYEY+RQGIL
Sbjct: 302  ARCLYEGAWVAERYEATKDFFATNPPESSLDPTVTSIIKTATKYDAADSFRYEYQRQGIL 361

Query: 402  QKVSKLLETIDVLCVPTCPHNPTFAQLEAMPVEMNSRQGTWTNFVNLADLAALAVPCGFR 461
            QKV + L+ IDVLCVPTCP NPTF ++ A PV +NSRQGTWTNFVNLAD+AALAVP GFR
Sbjct: 362  QKVDQTLKDIDVLCVPTCPLNPTFEEVAAEPVLVNSRQGTWTNFVNLADMAALAVPAGFR 421

Query: 462  SDGLPTGITLIGKTFTDYALLELANRYFQIAFPNNSRTYGKFLETPITTQDN-LQGPPFS 520
             DGLP G+TLIGK FTD+ALLELANRYF++AFP  SRT+GKF++  +TT+D+ L+GP  S
Sbjct: 422  PDGLPQGVTLIGKKFTDFALLELANRYFKVAFPQGSRTFGKFIDRQVTTKDDELRGPDIS 481

Query: 521  TEDSIKLAVVGAHLKGLPLHWQLEKVNAQYIGSPKTSPNYRLYALPKTGPVLKPGLRRVD 580
             EDS+KLAVVGAHLKGLPL+WQLEKVNA Y+GSPKTS NY+LYALPKTGP+LKPGLRRV 
Sbjct: 482  PEDSVKLAVVGAHLKGLPLYWQLEKVNATYLGSPKTSKNYKLYALPKTGPILKPGLRRVG 541

Query: 581  SEGGAQIQLEVYSVPKDQFGTFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQDGTKD 640
             E G+QIQLEVYSVPK+ FG FISMVPEPLGIGSVELESGEWVKSFICEEFGYTQ GT D
Sbjct: 542  EETGSQIQLEVYSVPKENFGEFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQKGTVD 601

Query: 641  ITELGSFKTYVDQLAREESEKKKPFETVLVANRGEIAVRXXXXXXXXXXXSVAVYSDPDK 700
            IT+ G FK Y+D L +EE++ KKPFETVL+ANRGEIAVR           SVAVYSDPDK
Sbjct: 602  ITKYGGFKKYIDFLKQEEAKVKKPFETVLIANRGEIAVRIIKTLKKLNIRSVAVYSDPDK 661

Query: 701  YSQHVTDADVAVALKGRTAAETYLDIDKIIAAAKETGTEAIIPGYGFLSENADFSDRCAS 760
            YSQHV DAD+ VAL GRTAAETYLDIDKII AAK+T  +AIIPGYGFLSENA+F+D+C  
Sbjct: 662  YSQHVIDADLGVALNGRTAAETYLDIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCVE 721

Query: 761  EGIVFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGSGLVKTPQEAREIAKALEYPVMVK 820
            EGIVFVGP+G+AIRKLGLKHSAREIAEKAGVPLVPGSGLV + +EA+EIA  LEYPVMVK
Sbjct: 722  EGIVFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPGSGLVTSAKEAKEIANKLEYPVMVK 781

Query: 821  STAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGK 880
            STAGGGGIGLQKVDSE +IERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDG 
Sbjct: 782  STAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGY 841

Query: 881  GKAIAIGERDCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIY 940
            GKAIAIGERDCSLQRRNQK+IEETPAPNL E TR +MR+A+E+LGSLLKY+CAGTVEFIY
Sbjct: 842  GKAIAIGERDCSLQRRNQKIIEETPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFIY 901

Query: 941  DERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAGTPPDFDATKITVTGASIEA 1000
            DERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWML IAA   PDF++  I VTGASIEA
Sbjct: 902  DERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAADDAPDFESANIVVTGASIEA 961

Query: 1001 RLYAENPVKDFRPSPGQLTDVSFPEWARVDTWVSKGTTISAEYDPTLAKIIVHGKDRDEA 1060
            RLYAENP KDFRPSPG LTDV FPEWARVDTWVSKGTT+SAEYDPTLAKIIVHGKDR++A
Sbjct: 962  RLYAENPAKDFRPSPGLLTDVHFPEWARVDTWVSKGTTVSAEYDPTLAKIIVHGKDRNDA 1021

Query: 1061 IQKLNQALNETSIYGCITNIDYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEITSPGAY 1120
            I K+N+ALNET +YGCITNIDYLRSIASSEMFKTAKVATK+LDSYDY+P AFE+TSPGAY
Sbjct: 1022 IMKMNKALNETVVYGCITNIDYLRSIASSEMFKTAKVATKILDSYDYKPCAFEVTSPGAY 1081

Query: 1121 TTVQDYPGRVRHWRIGVPPSGPMDSYSFRLANRIVGNHYKAPAIEITLNGPKLLFHTDAV 1180
            TTVQDYPGRV +WRIGVPPSGPMD+YSFRLANRIVGNHYKAPAIE+TLNGPK+LFHT+ +
Sbjct: 1082 TTVQDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNHYKAPAIELTLNGPKILFHTETI 1141

Query: 1181 IAITGAKAPCTINGSDVSQNKPLSVKKGDQLTVGKLSDGCRAYLAIRGGIDVPEYLGSRS 1240
            IAI+G  A C++N   + QNKP+ V +GD L +GKLS GCRAYLAIRGGIDVPEYLGSRS
Sbjct: 1142 IAISGGIAACSLNDKPIEQNKPIQVNRGDHLAIGKLSVGCRAYLAIRGGIDVPEYLGSRS 1201

Query: 1241 TFALGNMGGYNGRVLKLGDVLFLNQPELPSSGIPAPVYDPSEPPASLLPAISGSKEWKIG 1300
            TFALGNMGGYNGRVLKLGDVLFLNQPEL SS +P P Y+P  PPA+LLP IS  KEW IG
Sbjct: 1202 TFALGNMGGYNGRVLKLGDVLFLNQPELASSSLPGPAYEPQAPPANLLPKISDDKEWTIG 1261

Query: 1301 VTCGPHGSPDFFKPESVEEFFSEQWKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHPSNA 1360
            VTCGPHGSPDFFKPESVEEFFSE+WKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHPSNA
Sbjct: 1262 VTCGPHGSPDFFKPESVEEFFSEKWKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHPSNA 1321

Query: 1361 HDYVYSLGAINFTGDEPVIITADGPSLGGFVCQAVVPEGELWKVGQVKPGDLIQFVPVSY 1420
            HDYVYSLGAINFTGDEPVIIT+DGPSLGGFVCQAVVPE ELWKVGQVKPGD IQFVP+SY
Sbjct: 1322 HDYVYSLGAINFTGDEPVIITSDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVPISY 1381

Query: 1421 ETARVLKESQDQAIETFENGSLRTLTSELVLPAAENPVLAQLPRYSEFSPKVTYRQAGDR 1480
            + AR LKESQD AIET E+G L+TLTS+L+LP  E+PVL QLP+ S  SPKVTYRQAGDR
Sbjct: 1382 QVARQLKESQDAAIETLEDGKLQTLTSDLILPTYEDPVLVQLPKKSNLSPKVTYRQAGDR 1441

Query: 1481 YVLVEYGENEMDLNISYRVNRLINLVEKNKTIGIVEMSQGVRSVLVEFDGYKISQKALLE 1540
            Y+LVEYGEN+MDLNI+YR+N+LINLV K+KT+GIVEMSQGVRSVL+E+DGYKISQ ALL+
Sbjct: 1442 YILVEYGENQMDLNIAYRINQLINLVGKHKTVGIVEMSQGVRSVLIEYDGYKISQGALLD 1501

Query: 1541 TLIAYEGEIKFDRNWSIKSKVFKLPLAFEDSETLECVKRYQETIRSKAPWLPNNVDFIAD 1600
            TL+AYE EI+FD+NWSIKSK+FKLPLAFEDS+TLECV RYQETIRSKAPWLPNNVDF+A+
Sbjct: 1502 TLVAYESEIQFDKNWSIKSKIFKLPLAFEDSKTLECVTRYQETIRSKAPWLPNNVDFVAE 1561

Query: 1601 VNGISHSDVEDMLYQARXXXXXXXXXXXXAPCAVPLNPTHRFLGSKYNPSRTYTKNGTVG 1660
            VN I+H DVE+MLY AR            APCAVPL+P HRFLGSKYNPSRTYTKNG VG
Sbjct: 1562 VNDITHKDVENMLYSARFLVLGLGDVFLGAPCAVPLDPRHRFLGSKYNPSRTYTKNGVVG 1621

Query: 1661 IGGMYMCIYAMDSPGGYQLVGRTIPIWDKLQLGAHSSQHPWLLTPFDQVEYYQVTEDELN 1720
            IGGMYMCIYAMDSPGGYQLVGRTIPIWDKL+LG+HS +HPWLLTPFDQVE+Y V+E+EL+
Sbjct: 1622 IGGMYMCIYAMDSPGGYQLVGRTIPIWDKLKLGSHSQEHPWLLTPFDQVEFYPVSEEELD 1681

Query: 1721 KFTEECENGQFPVQVEESTFDHGEYLKWIDANSEIIKEFQNKQNGEKAEEFAKLIQESNA 1780
            +FTE+CENG+FPVQVEES FDH  YLKWI+ N E I EFQ  Q G KA+EFA+LIQ +N 
Sbjct: 1682 RFTEDCENGKFPVQVEESVFDHKNYLKWINENIESITEFQKSQGGAKADEFARLIQVANQ 1741

Query: 1781 ELEKAPDSQGAVEEEFPEDAEMVYSEYSGRFWKPLVSVGDVVKAGDGLIVVEAMKTEMMV 1840
            ELE +  ++ AVEEE+PEDAEMVYSEYSGRFWKP+VS GD V  GDGL++VEAMKTEM+V
Sbjct: 1742 ELESSTTNKSAVEEEYPEDAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVIVEAMKTEMVV 1801

Query: 1841 SA 1842
             A
Sbjct: 1802 PA 1803

>KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharomyces
            cerevisiae YBR208c DUR1_2 urea amidolyase, start by
            similarity
          Length = 1829

 Score = 2793 bits (7240), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1330/1800 (73%), Positives = 1515/1800 (84%), Gaps = 1/1800 (0%)

Query: 44   NTLGWSVQDWLGFHXXXXXXXXXXXXXXXIGAQKSAPEDPAWISLVSQEHLEHQWRILQS 103
            +TLGWSVQDWL FH               + +QK APEDPAWISL+  E L HQW ILQS
Sbjct: 3    STLGWSVQDWLSFHSKSTPTKSLELLENLLKSQKPAPEDPAWISLIPVEDLHHQWNILQS 62

Query: 104  KGDKKELPLYGVPIAVKDNIDATGCETTAACPEFAYTPSNDSTVVALLRDAGAIVIGKTN 163
            K +K+ELPLYGVPIAVKDNID  G  TTAACP + Y P+ DS VV LLRDAGA+VIGKTN
Sbjct: 63   KSNKEELPLYGVPIAVKDNIDYKGLPTTAACPSYLYQPTRDSYVVELLRDAGAVVIGKTN 122

Query: 164  LDQFATGLVGTRSPYGKTPCVFSNEHXXXXXXXXXXXXXXXXIVPLALGTDTAGSGRVPA 223
            LDQFATGLVGTRSPYGKTPCVF++++                IVPL+LGTDTAGSGRVPA
Sbjct: 123  LDQFATGLVGTRSPYGKTPCVFNDKYVSGGSSAGSASVVGRGIVPLSLGTDTAGSGRVPA 182

Query: 224  ALNNLIGLKPSKGVFSCSGVVPACKSLDCVSIFALNLGDAERCFKVMAQPDTEKDEYSRA 283
            ALNNLIGLKP+KG FSC GVVPACKSLDCVS+FALNL DAE  FKVM +PD  +DEYSR 
Sbjct: 183  ALNNLIGLKPTKGAFSCRGVVPACKSLDCVSVFALNLSDAEIAFKVMNKPDLLEDEYSRE 242

Query: 284  MPANPLQKYAKDATIAVPTKLPWYDETENFVHYAAAIENLKKTGAKVVEVDFEPLLELAR 343
             P NP+ +Y KD TIA+P ++PW+ ETEN   Y  A+ +LK TGAK+V VDFEPLLELAR
Sbjct: 243  FPKNPISQYPKDLTIAIPKEVPWFGETENPKLYTKAVASLKNTGAKIVVVDFEPLLELAR 302

Query: 344  CLYEGAWVAERYEATRDFFAKNPSESSLDPTVTKIIKGGANYDAADAFRYEYKRQGILQK 403
            CLYEGAWVAERY ATRDF A NP ESSLD TV  IIKG   +DAADAF++EYKRQGILQK
Sbjct: 303  CLYEGAWVAERYCATRDFLATNPPESSLDETVVNIIKGAVKFDAADAFKFEYKRQGILQK 362

Query: 404  VSKLLETIDVLCVPTCPHNPTFAQLEAMPVEMNSRQGTWTNFVNLADLAALAVPCGFRSD 463
            V+ LL+ IDVLCVPTCP NP   ++   PV +NSRQGTWTNFVNLADLAALAVP GFRSD
Sbjct: 363  VNLLLKDIDVLCVPTCPLNPKLEEVAQEPVLVNSRQGTWTNFVNLADLAALAVPSGFRSD 422

Query: 464  GLPTGITLIGKTFTDYALLELANRYFQIAFPNNSRTYGKFLETPITTQDNLQGPPFSTED 523
            GLP GITLIGK F+DYALL+LA R+F +AFPNNSRTYGKF++  IT +D L GP   T +
Sbjct: 423  GLPNGITLIGKKFSDYALLDLAKRFFSVAFPNNSRTYGKFVDRRITVEDELDGPSKDTLN 482

Query: 524  SIKLAVVGAHLKGLPLHWQLEKVNAQYIGSPKTSPNYRLYALPKTGPVLKPGLRRVDSEG 583
             +KLAVVGAHLKGLPLHWQL+K NA Y+ SPKTS NY+LYALPK GPVLKPGLRRV+   
Sbjct: 483  GVKLAVVGAHLKGLPLHWQLQKCNATYLSSPKTSNNYKLYALPKVGPVLKPGLRRVNDGT 542

Query: 584  GAQIQLEVYSVPKDQFGTFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQDGTKDITE 643
            G+QIQLEVYSVP D+FG FI+MVPEPLGIGSVELESGEWVKSFICEEFGYTQ GT DIT+
Sbjct: 543  GSQIQLEVYSVPYDRFGDFIAMVPEPLGIGSVELESGEWVKSFICEEFGYTQQGTVDITK 602

Query: 644  LGSFKTYVDQLAREESEKKKPFETVLVANRGEIAVRXXXXXXXXXXXSVAVYSDPDKYSQ 703
             G FK Y++ +   E++KKKPFETVL+ANRGEIAVR           SVAVYSDPDKYSQ
Sbjct: 603  FGGFKPYIEHIQVTEAQKKKPFETVLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKYSQ 662

Query: 704  HVTDADVAVALKGRTAAETYLDIDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGI 763
            HVTDAD +VAL GRTAAETYLDIDKII AAK+TG +AIIPGYGFLSENADFSDRC+ E I
Sbjct: 663  HVTDADFSVALHGRTAAETYLDIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQENI 722

Query: 764  VFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGSGLVKTPQEAREIAKALEYPVMVKSTA 823
            VFVGP+GDAIRKLGLKHSAREIAE+A VPLVPGSGL+K  +EA+E+AK LEYPVMVKSTA
Sbjct: 723  VFVGPSGDAIRKLGLKHSAREIAERAKVPLVPGSGLIKDAKEAKEVAKKLEYPVMVKSTA 782

Query: 824  GGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKA 883
            GGGGIGLQKVDSE+DIERVFETVQHQGK+YFGD+GVF+ERFV NARHVEIQMMGDG GKA
Sbjct: 783  GGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFGKA 842

Query: 884  IAIGERDCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDER 943
            IAIGERDCSLQRRNQKVIEETPAPNL E TRA+MR ASE LGSLLKY+CAGTVEFIYDE+
Sbjct: 843  IAIGERDCSLQRRNQKVIEETPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYDEQ 902

Query: 944  RDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAGTPPDFDATKITVTGASIEARLY 1003
            RDEFYFLEVNARLQVEHPITEMVTGLDLVEWML IAA   PDFD TKI V+GASIEARLY
Sbjct: 903  RDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAANDSPDFDNTKIEVSGASIEARLY 962

Query: 1004 AENPVKDFRPSPGQLTDVSFPEWARVDTWVSKGTTISAEYDPTLAKIIVHGKDRDEAIQK 1063
            AENPVKDFRPSPGQLT VSFP WARVDTWV KGT +SAEYDPTLAKIIVHGKDR++AI K
Sbjct: 963  AENPVKDFRPSPGQLTSVSFPSWARVDTWVKKGTNVSAEYDPTLAKIIVHGKDRNDAIMK 1022

Query: 1064 LNQALNETSIYGCITNIDYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEITSPGAYTTV 1123
            LNQALNET++YGCITNIDYLRSIASS+MFK AKVATKVLDS+DY+P AFE+ +PGA T+V
Sbjct: 1023 LNQALNETAVYGCITNIDYLRSIASSKMFKEAKVATKVLDSFDYKPCAFEVLAPGANTSV 1082

Query: 1124 QDYPGRVRHWRIGVPPSGPMDSYSFRLANRIVGNHYKAPAIEITLNGPKLLFHTDAVIAI 1183
            QDYPGR  +WRIGVPPSGPMDSYSFRLANR+VGN+ K+PA+EITLNGPKLLFHT+ VIA+
Sbjct: 1083 QDYPGRTGYWRIGVPPSGPMDSYSFRLANRVVGNNSKSPALEITLNGPKLLFHTETVIAV 1142

Query: 1184 TGAKAPCTINGSDVSQNKPLSVKKGDQLTVGKLSDGCRAYLAIRGGIDVPEYLGSRSTFA 1243
            +G    CT+N + ++QN+P+ VK+GD L+VGK++ GCRAYL+IRGGIDVPEYLGSRSTFA
Sbjct: 1143 SGGTVSCTLNDAQIAQNEPIEVKRGDILSVGKVTVGCRAYLSIRGGIDVPEYLGSRSTFA 1202

Query: 1244 LGNMGGYNGRVLKLGDVLFLNQPELPSSGIPAPVYDPSEPPASLLPAISGSKEWKIGVTC 1303
            +GNMGGYNGR+LKLGDVLFLNQPEL  S +PAP ++P   P SLLP +S +K+WKIGVTC
Sbjct: 1203 MGNMGGYNGRILKLGDVLFLNQPELSVSSLPAPDFEPQAAPKSLLPTLSTNKDWKIGVTC 1262

Query: 1304 GPHGSPDFFKPESVEEFFSEQWKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHPSNAHDY 1363
            GPHGS D FK E +E+FF+++WKVHYNSNRFGVRLIGPKPKWAR DGGE GLHPSNAHDY
Sbjct: 1263 GPHGSIDLFKEEYIEQFFNDKWKVHYNSNRFGVRLIGPKPKWARSDGGEAGLHPSNAHDY 1322

Query: 1364 VYSLGAINFTGDEPVIITADGPSLGGFVCQAVVPEGELWKVGQVKPGDLIQFVPVSYETA 1423
            VYSLGAINFTGDEPVIIT DGPSLGGFVCQAVV E ELWKVGQ+ PGD IQFVP+SY  A
Sbjct: 1323 VYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVAEAELWKVGQLTPGDTIQFVPLSYGVA 1382

Query: 1424 RVLKESQDQAIETFENGSLRTLTSELVLPAAENPVLAQLPRYSEFSPKVTYRQAGDRYVL 1483
            R LKESQD++I+ FE GSL  L+ + +LP  ENP+LA LP+ S+ SPKVTYRQAGDRY+L
Sbjct: 1383 RQLKESQDKSIDNFEEGSLLELSDDKILPKYENPILAVLPKKSDLSPKVTYRQAGDRYIL 1442

Query: 1484 VEYGENEMDLNISYRVNRLINLVEKNKTIGIVEMSQGVRSVLVEFDGYKISQKALLETLI 1543
            VEYGE E DLNI YR+NRLI+ VE+++T+GIVEMSQGVRSVL+EFDG KI+QKALL+ LI
Sbjct: 1443 VEYGELEFDLNICYRINRLIHQVERHQTVGIVEMSQGVRSVLIEFDGSKINQKALLKCLI 1502

Query: 1544 AYEGEIKFDRNWSIKSKVFKLPLAFEDSETLECVKRYQETIRSKAPWLPNNVDFIADVNG 1603
            AYE EI+FD+NW++KSK+FKLP+AFEDS+TL+CV RY+ETIRS+APWLPNNVDFIADVN 
Sbjct: 1503 AYESEIQFDKNWNVKSKIFKLPMAFEDSKTLDCVTRYRETIRSEAPWLPNNVDFIADVND 1562

Query: 1604 ISHSDVEDMLYQARXXXXXXXXXXXXAPCAVPLNPTHRFLGSKYNPSRTYTKNGTVGIGG 1663
            I  +DV++MLY A+            +PCAVPL+P HR+LG+KYNPSRTYT  G VGIGG
Sbjct: 1563 IDRNDVKNMLYSAKFMVLGLGDVFLGSPCAVPLDPRHRYLGTKYNPSRTYTARGVVGIGG 1622

Query: 1664 MYMCIY-AMDSPGGYQLVGRTIPIWDKLQLGAHSSQHPWLLTPFDQVEYYQVTEDELNKF 1722
            MYMCIY A  SPGGYQLVGRTI  WDKL +G H   HPWLLTPFDQVE+Y VTE+EL   
Sbjct: 1623 MYMCIYNAEGSPGGYQLVGRTITAWDKLVIGDHPIDHPWLLTPFDQVEFYPVTEEELEVI 1682

Query: 1723 TEECENGQFPVQVEESTFDHGEYLKWIDANSEIIKEFQNKQNGEKAEEFAKLIQESNAEL 1782
             E+ +NG+F + VEES FDH EYL WI+ N + I  FQ  Q GEKA+EFA+LIQ +NAEL
Sbjct: 1683 IEDNDNGKFKIDVEESIFDHKEYLAWINENIDSIVAFQEAQGGEKADEFARLIQVANAEL 1742

Query: 1783 EKAPDSQGAVEEEFPEDAEMVYSEYSGRFWKPLVSVGDVVKAGDGLIVVEAMKTEMMVSA 1842
            +K+ D +    EE+P+DAE++YSEY+GRFWKP+ +VGD V+AGDG+I++EAMKTEM+V A
Sbjct: 1743 KKSGDDKPQDVEEYPDDAELLYSEYTGRFWKPVAAVGDHVEAGDGVIIIEAMKTEMVVGA 1802

>YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea
            amidolyase, contains urea carboxylase and allophanate
            hydrolase activities fused together in a single
            polypeptide [5508 bp, 1835 aa]
          Length = 1835

 Score = 2663 bits (6902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1265/1801 (70%), Positives = 1476/1801 (81%), Gaps = 10/1801 (0%)

Query: 45   TLGWSVQDWLGFHXXXXXXXXXXXXXXXIGAQKSAPEDPAWISLVSQEHLEHQWRILQSK 104
            +LGWS+QDW+ FH               + +Q  AP D AWISL+S+E+L HQ++IL+S+
Sbjct: 12   SLGWSIQDWIDFHKSSSSQASLRLLESLLDSQNVAPVDNAWISLISKENLLHQFQILKSR 71

Query: 105  GDKKELPLYGVPIAVKDNIDATGCETTAACPEFAYTPSNDSTVVALLRDAGAIVIGKTNL 164
             +K+ LPLYGVPIAVKDNID  G  TTAACP FAY PS DS VV LLR+AGAI++GKTNL
Sbjct: 72   ENKETLPLYGVPIAVKDNIDVRGLPTTAACPSFAYEPSKDSKVVELLRNAGAIIVGKTNL 131

Query: 165  DQFATGLVGTRSPYGKTPCVFSNEHXXXXXXXXXXXXXXXXIVPLALGTDTAGSGRVPAA 224
            DQFATGLVGTRSPYGKTPC FS EH                IVP+ALGTDTAGSGRVPAA
Sbjct: 132  DQFATGLVGTRSPYGKTPCAFSKEHVSGGSSAGSASVVARGIVPIALGTDTAGSGRVPAA 191

Query: 225  LNNLIGLKPSKGVFSCSGVVPACKSLDCVSIFALNLGDAERCFKVMAQPDTEKDEYSRAM 284
            LNNLIGLKP+KGVFSC GVVPACKSLDCVSIFALNL DAERCF++M QPD + DEYSR  
Sbjct: 192  LNNLIGLKPTKGVFSCQGVVPACKSLDCVSIFALNLSDAERCFRIMCQPDPDNDEYSRPY 251

Query: 285  PANPLQKYAKDATIAVPTKLPWYDETENFVHYAAAIENLKKTGAKVVEVDFEPLLELARC 344
             +NPL+K++ + TIA+P  +PWY ET+N V ++ A+ENL +TGA V+E+DFEPLLELARC
Sbjct: 252  VSNPLKKFSSNVTIAIPKNIPWYGETKNPVLFSNAVENLSRTGANVIEIDFEPLLELARC 311

Query: 345  LYEGAWVAERYEATRDFFAKNPSESSLDPTVTKIIKGGANYDAADAFRYEYKRQGILQKV 404
            LYEG WVAERY+A + F    P + SLDPTV  II+G   Y A D F +EYKRQGILQKV
Sbjct: 312  LYEGTWVAERYQAIQSFLDSKPPKESLDPTVISIIEGAKKYSAVDCFSFEYKRQGILQKV 371

Query: 405  SKLLETIDVLCVPTCPHNPTFAQLEAMPVEMNSRQGTWTNFVNLADLAALAVPCGFRSDG 464
             +LLE++DVLCVPTCP NPT  Q+   PV +NSRQGTWTNFVNLADLAALAVP GFR DG
Sbjct: 372  RRLLESVDVLCVPTCPLNPTMQQVADEPVLVNSRQGTWTNFVNLADLAALAVPAGFRDDG 431

Query: 465  LPTGITLIGKTFTDYALLELANRYFQIAFPNNSRTYGKFLETPIT-TQDNLQGPPFSTED 523
            LP GITLIGK FTDYALLELANRYFQ  FPN SRTYG F  + +    D L GP +    
Sbjct: 432  LPNGITLIGKKFTDYALLELANRYFQNIFPNGSRTYGTFTSSSVKPANDQLVGPDYDPST 491

Query: 524  SIKLAVVGAHLKGLPLHWQLEKVNAQYIGSPKTSPNYRLYALPKTGPVLKPGLRRVDSEG 583
            SIKLAVVGAHLKGLPLHWQLEKVNA Y+ + KTS  Y+L+ALPK GPVLKPGLRRV    
Sbjct: 492  SIKLAVVGAHLKGLPLHWQLEKVNATYLCTTKTSKAYQLFALPKNGPVLKPGLRRVQDSN 551

Query: 584  GAQIQLEVYSVPKDQFGTFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQDGTKDITE 643
            G+QI+LEVYSVPK+ FG FISMVPEPLGIGSVELESGEW+KSFICEE GY   GT DIT+
Sbjct: 552  GSQIELEVYSVPKELFGAFISMVPEPLGIGSVELESGEWIKSFICEESGYKAKGTVDITK 611

Query: 644  LGSFKTYVDQLAREESEKKKPFETVLVANRGEIAVRXXXXXXXXXXXSVAVYSDPDKYSQ 703
             G F+ Y + L ++ES+KKK F+TVL+ANRGEIAVR           SVAVYSDPDKYSQ
Sbjct: 612  YGGFRAYFEMLKKKESQKKKLFDTVLIANRGEIAVRIIKTLKKLGIRSVAVYSDPDKYSQ 671

Query: 704  HVTDADVAVALKGRTAAETYLDIDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGI 763
            HVTDADV+V L G TAA+TYLD++KII AAK+T  +AIIPGYGFLSENADFSD C S GI
Sbjct: 672  HVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDACTSAGI 731

Query: 764  VFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGSGLVKTPQEAREIAKALEYPVMVKSTA 823
             FVGP+GD IR LGLKHSAR+IA+KAGVPLVPGS L+ + +EA+++A  LEYPVMVKSTA
Sbjct: 732  TFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSLLITSVEEAKKVAAELEYPVMVKSTA 791

Query: 824  GGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKA 883
            GGGGIGLQKVDSEEDIE +FETV+HQG+ +FGD+GVFLERF+ENARHVE+Q+MGDG GKA
Sbjct: 792  GGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQLMGDGFGKA 851

Query: 884  IAIGERDCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDER 943
            IA+GERDCSLQRRNQKVIEETPAPNL EKTR  +R+A+E+LGSLL Y+CAGTVEFIYDE+
Sbjct: 852  IALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVEFIYDEK 911

Query: 944  RDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAGTPPDFDATKITVTGASIEARLY 1003
            +DEFYFLEVN RLQVEHPITEMVTGLDLVEWM+ IAA   PDFD+TK+ V G S+EARLY
Sbjct: 912  KDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDSTKVEVNGVSMEARLY 971

Query: 1004 AENPVKDFRPSPGQLTDVSFPEWARVDTWVSKGTTISAEYDPTLAKIIVHGKDRDEAIQK 1063
            AENP+K+FRPSPG L DV FP+WARVDTWV KGT IS EYDPTLAKIIVHGKDRD+AI K
Sbjct: 972  AENPLKNFRPSPGLLVDVKFPDWARVDTWVKKGTNISPEYDPTLAKIIVHGKDRDDAISK 1031

Query: 1064 LNQALNETSIYGCITNIDYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEITSPGAYTTV 1123
            LNQAL ET +YGCITNIDYL+SI +S+ F  AKV+T +L+SY Y P+A EIT PGA+T++
Sbjct: 1032 LNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILNSYQYEPTAIEITLPGAHTSI 1091

Query: 1124 QDYPGRVRHWRIGVPPSGPMDSYSFRLANRIVGNHYKAPAIEITLNGPKLLFHTDAVIAI 1183
            QDYPGRV +WRIGVPPSGPMD+YSFRLANRIVGN Y+ PAIE+TL GP ++FH + VIAI
Sbjct: 1092 QDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNDYRTPAIEVTLTGPSIVFHCETVIAI 1151

Query: 1184 TGAKAPCTINGSDVSQNKPLSVKKGDQLTVGKLSDGCRAYLAIRGGIDVPEYLGSRSTFA 1243
            TG  A CT++G ++ Q+KP+ VK+G  L++GKL+ GCRAYL IRGGIDVP+YLGS STF 
Sbjct: 1152 TGGTALCTLDGQEIPQHKPVEVKRGSTLSIGKLTSGCRAYLGIRGGIDVPKYLGSYSTFT 1211

Query: 1244 LGNMGGYNGRVLKLGDVLFL--NQPELPSSGIPAPVYDPSEPPASLLPAISGSKEWKIGV 1301
            LGN+GGYNGRVLKLGDVLFL  N+       +P  +      P SL+P IS +KEW+IGV
Sbjct: 1212 LGNVGGYNGRVLKLGDVLFLPSNEENKSVECLPQNI------PQSLIPQISETKEWRIGV 1265

Query: 1302 TCGPHGSPDFFKPESVEEFFSEQWKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHPSNAH 1361
            TCGPHGSPDFFKPES+EEFFSE+WKVHYNSNRFGVRLIGPKPKWAR +GGEGG+HPSN H
Sbjct: 1266 TCGPHGSPDFFKPESIEEFFSEKWKVHYNSNRFGVRLIGPKPKWARSNGGEGGMHPSNTH 1325

Query: 1362 DYVYSLGAINFTGDEPVIITADGPSLGGFVCQAVVPEGELWKVGQVKPGDLIQFVPVSYE 1421
            DYVYSLGAINFTGDEPVIIT DGPSLGGFVCQAVVPE ELWKVGQVKPGD IQFVP+SYE
Sbjct: 1326 DYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVPLSYE 1385

Query: 1422 TARVLKESQDQAIETFENGSLRTLTSELVLPAAENPVLAQLPRYSEFSPKVTYRQAGDRY 1481
            ++R LKESQD AI++ +   LR L S  +LP+ E P+LAQ+ + +E SPKV YRQAGDRY
Sbjct: 1386 SSRSLKESQDVAIKSLDGTKLRRLDSVSILPSFETPILAQMEKVNELSPKVVYRQAGDRY 1445

Query: 1482 VLVEYGENEMDLNISYRVNRLINLVEKNKTIGIVEMSQGVRSVLVEFDGYKISQKALLET 1541
            VLVEYG+NEM+ NISYR+  LI+LV+KNKTIGIVEMSQGVRSVL+EFDGYK++QK LL+ 
Sbjct: 1446 VLVEYGDNEMNFNISYRIECLISLVKKNKTIGIVEMSQGVRSVLIEFDGYKVTQKELLKV 1505

Query: 1542 LIAYEGEIKFDRNWSIKSKVFKLPLAFEDSETLECVKRYQETIRSKAPWLPNNVDFIADV 1601
            L+AYE EI+FD NW I S + +LP+AFEDS+TL CV+RYQETIRS APWLPNNVDFIA+V
Sbjct: 1506 LVAYETEIQFDENWKITSNIIRLPMAFEDSKTLACVQRYQETIRSSAPWLPNNVDFIANV 1565

Query: 1602 NGISHSDVEDMLYQARXXXXXXXXXXXXAPCAVPLNPTHRFLGSKYNPSRTYTKNGTVGI 1661
            NGIS ++V DMLY AR            +PCAVPL+P HRFLGSKYNPSRTYT+ G VGI
Sbjct: 1566 NGISRNEVYDMLYSARFMVLGLGDVFLGSPCAVPLDPRHRFLGSKYNPSRTYTERGAVGI 1625

Query: 1662 GGMYMCIYAMDSPGGYQLVGRTIPIWDKLQLGAHSSQHPWLLTPFDQVEYYQVTEDELNK 1721
            GGMYMCIYA +SPGGYQLVGRTIPIWDKL L A SS+ PWL+ PFDQVE+Y V+E++L+K
Sbjct: 1626 GGMYMCIYAANSPGGYQLVGRTIPIWDKLCLAA-SSEVPWLMNPFDQVEFYPVSEEDLDK 1684

Query: 1722 FTEECENGQFPVQVEESTFDHGEYLKWIDANSEIIKEFQNKQNGEKAEEFAKLIQESNAE 1781
             TE+C+NG + V +E+S FDH EYL+WI+AN + I  FQ  Q GE+AEEFAKLIQ +N+E
Sbjct: 1685 MTEDCDNGVYKVNIEKSVFDHQEYLRWINANKDSITAFQEGQLGERAEEFAKLIQNANSE 1744

Query: 1782 LEKAPDSQGAVEEEFPEDAEMVYSEYSGRFWKPLVSVGDVVKAGDGLIVVEAMKTEMMVS 1841
            L+++   +   EE+FPE AE+VYSEYSGRFWK + SVGDV++AG GL+++EAMK EM++S
Sbjct: 1745 LKESVTVKPDEEEDFPEGAEIVYSEYSGRFWKSIASVGDVIEAGQGLLIIEAMKAEMIIS 1804

Query: 1842 A 1842
            A
Sbjct: 1805 A 1805

>Scas_721.40
          Length = 1834

 Score = 2541 bits (6586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1206/1803 (66%), Positives = 1430/1803 (79%), Gaps = 4/1803 (0%)

Query: 38   NNMSSVNTLGWSVQDWLGFHXXXXXXXXXXXXXXXIGAQKSAPEDPAWISLVSQEHLEHQ 97
            NN++   TLGWS++DW+ FH               +  Q+ AP DPAW+SL S + L+ Q
Sbjct: 3    NNIAK-KTLGWSIKDWIEFHQSVTADESFKQLQYLVECQQIAPTDPAWLSLCSADTLKKQ 61

Query: 98   WRILQSKGDKKELPLYGVPIAVKDNIDATGCETTAACPEFAYTPSNDSTVVALLRDAGAI 157
            W+ILQ +  K+ LPLYGVP+A+KDNIDA G  TTAACP F Y P  DS VV LLR+AGAI
Sbjct: 62   WQILQHRSGKESLPLYGVPVAIKDNIDARGFPTTAACPSFLYEPEKDSKVVKLLRNAGAI 121

Query: 158  VIGKTNLDQFATGLVGTRSPYGKTPCVFSNEHXXXXXXXXXXXXXXXXIVPLALGTDTAG 217
            +IGKTNLDQFATGLVGTRSPYGKTPCVFS++H                IVP+ALGTDTAG
Sbjct: 122  IIGKTNLDQFATGLVGTRSPYGKTPCVFSDKHVSGGSSAGSASVVARGIVPIALGTDTAG 181

Query: 218  SGRVPAALNNLIGLKPSKGVFSCSGVVPACKSLDCVSIFALNLGDAERCFKVMAQPDTEK 277
            SGRVPAALNNLIGLKP+KG FSC GVVPACKSLDCVS+F+LNL DAE CFK++ + D E 
Sbjct: 182  SGRVPAALNNLIGLKPTKGTFSCQGVVPACKSLDCVSVFSLNLSDAECCFKILCESDLEN 241

Query: 278  DEYSRAMPANPLQKYAKDATIAVPTKLPWYDETENFVHYAAAIENLKKTGAKVVEVDFEP 337
            DEYSR  P +PL+K++   TI +P  L WY E EN V Y  AI+ L+K+GA + ++DFEP
Sbjct: 242  DEYSRTYPRSPLRKFSDSVTIGIPKDLLWYGEEENPVLYDNAIKQLEKSGANITKIDFEP 301

Query: 338  LLELARCLYEGAWVAERYEATRDFFAKNPSESSLDPTVTKIIKGGANYDAADAFRYEYKR 397
            LLELARCLYEG WVAERY A +DF  KNPS    D  V  II     + A DAF++EYKR
Sbjct: 302  LLELARCLYEGPWVAERYSAVKDFLQKNPSSKGFDHVVKSIIDSAKKFSAVDAFQFEYKR 361

Query: 398  QGILQKVSKLLETIDVLCVPTCPHNPTFAQLEAMPVEMNSRQGTWTNFVNLADLAALAVP 457
            QG+LQK+ KLLE ID LCVPTCP NPTF  +   P+ +NSRQGTWTNFVNLAD+AALA+P
Sbjct: 362  QGLLQKIDKLLENIDALCVPTCPLNPTFEDVSNEPILVNSRQGTWTNFVNLADMAALAIP 421

Query: 458  CGFRSDGLPTGITLIGKTFTDYALLELANRYFQIAFPNNSRTYGKFLETPITTQDNLQGP 517
             GFRSDGLPTGITLIGK FTD+ALL+LA  YFQIA+PNNSRT+G F E      D + GP
Sbjct: 422  SGFRSDGLPTGITLIGKKFTDFALLDLAQMYFQIAYPNNSRTFGIFTEGVEINDDKVSGP 481

Query: 518  PFSTEDSIKLAVVGAHLKGLPLHWQLEKVNAQYIGSPKTSPNYRLYALPKTGPVLKPGLR 577
              S+ DSIKLAVVGAHLKGLPLHWQLEKVNA +I S KTS NY LYALP+TGP+LKPGLR
Sbjct: 482  VISSSDSIKLAVVGAHLKGLPLHWQLEKVNATFISSTKTSKNYELYALPRTGPILKPGLR 541

Query: 578  RVDSEGGAQIQLEVYSVPKDQFGTFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQDG 637
            RV+ EG A IQ+E YS+P + FGTFISMVPEPLGIGSVELE+GEWVKSFICEE GYT  G
Sbjct: 542  RVNEEGFA-IQVETYSIPVENFGTFISMVPEPLGIGSVELENGEWVKSFICEESGYTAKG 600

Query: 638  TKDITELGSFKTYVDQLAREESEKKKPFETVLVANRGEIAVRXXXXXXXXXXXSVAVYSD 697
            + +IT+ G FKTY+ +     ++ KKPF TVLVANRGEIAVR           SVA++S 
Sbjct: 601  SVNITKYGGFKTYL-KFLETNTKTKKPFTTVLVANRGEIAVRIIKTLKKMEIQSVAIFST 659

Query: 698  PDKYSQHVTDADVAVALKGRTAAETYLDIDKIIAAAKETGTEAIIPGYGFLSENADFSDR 757
            PD+YSQHV DAD+ V LKG +AA+TYL+I+KII AAK+TG +AIIPGYGFLSENADFS+R
Sbjct: 660  PDRYSQHVIDADLTVDLKGVSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFSER 719

Query: 758  CASEGIVFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGSGLVKTPQEAREIAKALEYPV 817
            C +EGI FVGP+GD +R LGLKHSAREIA+KA VPLVPGS L+ T  EA+EIA  LEYP+
Sbjct: 720  CDAEGITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPGSSLITTAHEAKEIAAKLEYPI 779

Query: 818  MVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMG 877
            MVKSTAGGGGIGLQKV+SE+DIER+FETV+HQG AYFGDSGVF+ERF+ENARHVE+Q+MG
Sbjct: 780  MVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFIENARHVEVQIMG 839

Query: 878  DGKGKAIAIGERDCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGSLLKYRCAGTVE 937
            DG G A+AIGERDCSLQRRNQK+IEETPAPNL E TR ++REA++ LGSLLKY+CAGTVE
Sbjct: 840  DGLGNALAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVE 899

Query: 938  FIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAGTPPDFDATKITVTGAS 997
            FIYDE RDEFYFLEVN RLQVEHPITEMVTG+DLVEWML+IAA   PDF+  KI V G +
Sbjct: 900  FIYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAADMAPDFNQLKIDVNGVA 959

Query: 998  IEARLYAENPVKDFRPSPGQLTDVSFPEWARVDTWVSKGTTISAEYDPTLAKIIVHGKDR 1057
            +EARLYAENPV DF+PSPGQL +V FP+WAR+DTWVSKGT ++ EYDPTLAKIIVHGKDR
Sbjct: 960  MEARLYAENPVHDFKPSPGQLVEVEFPKWARIDTWVSKGTIVTPEYDPTLAKIIVHGKDR 1019

Query: 1058 DEAIQKLNQALNETSIYGCITNIDYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEITSP 1117
             +A++KLN+AL ET + GCITNIDYLRSI+SSEMF+ AKV+T +L+SYDY+PSA EI  P
Sbjct: 1020 HDALEKLNKALVETKVSGCITNIDYLRSISSSEMFRDAKVSTNILNSYDYKPSAMEIILP 1079

Query: 1118 GAYTTVQDYPGRVRHWRIGVPPSGPMDSYSFRLANRIVGNHYKAPAIEITLNGPKLLFHT 1177
            G++T++QDYPGR   WRIGVPPSGPMD++SFRLAN+IVGN++KAPA EITLNGP +LFH 
Sbjct: 1080 GSHTSIQDYPGRKGCWRIGVPPSGPMDAFSFRLANKIVGNNHKAPAFEITLNGPTILFHI 1139

Query: 1178 DAVIAITGAKAPCTINGSDVSQNKPLSVKKGDQLTVGKLSDGCRAYLAIRGGIDVPEYLG 1237
            DA+I ITG    C +N + + Q KP+ V  GD+L++GKL  GCRAYLAIRGG+DVPEYLG
Sbjct: 1140 DAIIGITGGACVCQLNNTQIEQFKPIHVTSGDKLSIGKLLTGCRAYLAIRGGVDVPEYLG 1199

Query: 1238 SRSTFALGNMGGYNGRVLKLGDVLFLNQPELPSSGIPAPVYDPSEPPASLLPAISGSKEW 1297
            S+STF LGN GGY+GR LK+GD LF++Q +L    +P   Y       SLLP +   K+W
Sbjct: 1200 SKSTFTLGNFGGYSGRCLKMGDTLFIDQNKLNKYVLPGHNYSDQPLSYSLLPDMPTDKQW 1259

Query: 1298 KIGVTCGPHGSPDFFKPESVEEFFSEQWKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHP 1357
            KIGV CGPHGSPDFFKPE V+ FFSE+WKVHYNSNRFGVRL GPKP WARKDGGEGGLHP
Sbjct: 1260 KIGVLCGPHGSPDFFKPEYVDSFFSEKWKVHYNSNRFGVRLSGPKPVWARKDGGEGGLHP 1319

Query: 1358 SNAHDYVYSLGAINFTGDEPVIITADGPSLGGFVCQAVVPEGELWKVGQVKPGDLIQFVP 1417
            SNAHDYVYSLGAINFTGDEPVI+T DGPSLGGFVC AVV E ELWKVGQVKPGD IQFVP
Sbjct: 1320 SNAHDYVYSLGAINFTGDEPVIVTCDGPSLGGFVCHAVVAESELWKVGQVKPGDYIQFVP 1379

Query: 1418 VSYETARVLKESQDQAIETFENGSLRTLTSELVLPAAENPVLAQLPRYSEFSPKVTYRQA 1477
            +S+E+AR L +SQD AI T E  SL+TL   + LP  E+PVL  LP     SP++TYRQA
Sbjct: 1380 ISFESARELMKSQDVAINTLEPKSLKTLDDIITLPTPEDPVLRLLPERPGISPRITYRQA 1439

Query: 1478 GDRYVLVEYGENEMDLNISYRVNRLINLVEKNKTIGIVEMSQGVRSVLVEFDGYKISQKA 1537
            GDRY+LVEYGEN MDLNI YR++ LI LV+   T GIVEMSQGVRSVL+EFD Y ISQ  
Sbjct: 1440 GDRYILVEYGENIMDLNICYRIHSLIGLVDDYNTAGIVEMSQGVRSVLIEFDPYVISQTQ 1499

Query: 1538 LLETLIAYEGEIKFDRNWSIKSKVFKLPLAFEDSETLECVKRYQETIRSKAPWLPNNVDF 1597
            LL  L+AYE E+ +  NW++ SKV +LP+AFEDS+T+ CV RYQETIRS APWLPNN DF
Sbjct: 1500 LLTLLLAYEEELPYTENWTVNSKVIRLPMAFEDSKTMACVARYQETIRSSAPWLPNNADF 1559

Query: 1598 IADVNGISHSDVEDMLYQARXXXXXXXXXXXXAPCAVPLNPTHRFLGSKYNPSRTYTKNG 1657
            +A++NGI+H DV D++Y AR            +PCAVPL+P HR LGSKYNPSRT+T+ G
Sbjct: 1560 VANINGITHKDVYDLVYSARFMVLGLGDVFLGSPCAVPLDPRHRLLGSKYNPSRTFTERG 1619

Query: 1658 TVGIGGMYMCIYAMDSPGGYQLVGRTIPIWDKLQLGAHSSQHPWLLTPFDQVEYYQVTED 1717
             VG+GGM+MCIYA  SPGGYQL+GRTIPIWDKL L   SS+ PWLL PFDQ+E+Y V+E 
Sbjct: 1620 AVGLGGMFMCIYAASSPGGYQLMGRTIPIWDKLLL-LSSSEQPWLLNPFDQIEFYPVSEK 1678

Query: 1718 ELNKFTEECENGQFPVQVEESTFDHGEYLKWIDANSEIIKEFQNKQNGEKAEEFAKLIQE 1777
            EL++ T++ + G++ V   +  F+H +YLKW+D NS+ I EFQ  Q GE AE+FAKLI+ 
Sbjct: 1679 ELDRLTDDFDYGKYIVDSRKEKFNHMDYLKWVDENSKSITEFQLLQEGENAEKFAKLIEL 1738

Query: 1778 SNAELEKAPDSQGAVEEEFPEDAEMVYSEYSGRFWKPLVSVGDVVKAGDGLIVVEAMKTE 1837
            SNAEL++  + +     ++PE++ M+YSEYSGRFWKPLV+ G+ VK+G GLI++EAMKTE
Sbjct: 1739 SNAELDENDEIEKDQVNDYPENSVMIYSEYSGRFWKPLVTEGEFVKSGQGLIIIEAMKTE 1798

Query: 1838 MMV 1840
            M+V
Sbjct: 1799 MLV 1801

>CAGL0M05533g complement(588667..594171) similar to sp|P32528
            Saccharomyces cerevisiae YBR208c DUR1 urea amidolyase,
            hypothetical start
          Length = 1834

 Score = 2379 bits (6166), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1124/1808 (62%), Positives = 1398/1808 (77%), Gaps = 8/1808 (0%)

Query: 40   MSSVN---TLGWSVQDWLGFHXXXXXXXXXXXXXXXIGAQKSAPEDPAWISLVSQEHLEH 96
            M++ N   ++GWS+QDW+ FH               +  Q+ APEDPAWIS+ ++  LE 
Sbjct: 1    MTATNICPSIGWSIQDWIDFHFKSTPKDSYESLLELVKNQRIAPEDPAWISVATESLLEQ 60

Query: 97   QWRILQSKGDKKELPLYGVPIAVKDNIDATGCETTAACPEFAYTPSNDSTVVALLRDAGA 156
            QW++LQS+ +K++LPLYGVPIAVKDNIDA G  TTAACP F+Y P+ DSTVV LL+ AGA
Sbjct: 61   QWQLLQSRHEKEKLPLYGVPIAVKDNIDAKGFPTTAACPSFSYMPTRDSTVVELLKQAGA 120

Query: 157  IVIGKTNLDQFATGLVGTRSPYGKTPCVFSNEHXXXXXXXXXXXXXXXXIVPLALGTDTA 216
            I+IGKTNLDQFATGLVGTRSPYG+TPCVFS++H                IVP+ALGTDTA
Sbjct: 121  IIIGKTNLDQFATGLVGTRSPYGRTPCVFSDKHVSGGSSAGSASVVARGIVPIALGTDTA 180

Query: 217  GSGRVPAALNNLIGLKPSKGVFSCSGVVPACKSLDCVSIFALNLGDAERCFKVMAQPDTE 276
            GSGRVPAALNN+IGLKP++G+FSCSGVVPACKSLDCVS+F++NL DAE+C K+M + D E
Sbjct: 181  GSGRVPAALNNIIGLKPTRGIFSCSGVVPACKSLDCVSVFSMNLSDAEKCLKIMTKLDIE 240

Query: 277  KDEYSRAMPANPLQKYAKDATIAVPTKLPWYDETENFVHYAAAIENLKKTGAKVVEVDFE 336
             DEYSR+ PANPLQ + K+ T+A+P  + WY E EN + Y  AI+N K+ GA++  +DFE
Sbjct: 241  NDEYSRSFPANPLQSFNKNLTVAIPKNVMWYGEKENPLLYDRAIDNFKQLGAQIKIIDFE 300

Query: 337  PLLELARCLYEGAWVAERYEATRDFFAKNPSESSLDPTVTKIIKGGANYDAADAFRYEYK 396
            PLLELARCLYEG WVAERY ATR F   +P +S+LDP V  IIK    +DAADAF YEYK
Sbjct: 301  PLLELARCLYEGTWVAERYAATRKFLETSPQQSTLDPVVYGIIKSATKFDAADAFEYEYK 360

Query: 397  RQGILQKVSKLLETIDVLCVPTCPHNPTFAQLEAMPVEMNSRQGTWTNFVNLADLAALAV 456
            RQGIL+KV  LL+ IDVLCVPTCP NP+F +++  P+ +NSRQGTWTNFVNLADL+ALA+
Sbjct: 361  RQGILRKVEVLLQDIDVLCVPTCPLNPSFEEVDKEPILVNSRQGTWTNFVNLADLSALAI 420

Query: 457  PCGFRSDGLPTGITLIGKTFTDYALLELANRYFQIAFPNNSRTYGKFLETPITTQDN-LQ 515
            P GFRSDGLP G+TLI K F DYALL+LA R+    +P+ +R YG FL+  +  +D+ L+
Sbjct: 421  PVGFRSDGLPNGVTLIAKKFEDYALLQLAKRFLAQLYPSGTRPYGMFLDRYVGLKDDSLE 480

Query: 516  GPPFSTEDSIKLAVVGAHLKGLPLHWQLEKVNAQYIGSPKTSPNYRLYALPKTGPVLKPG 575
            GP  S++DSI LAVVGAHL+GLPLHWQLEKVNA +I S KT+  Y LYALPK GPVLKPG
Sbjct: 481  GPIVSSDDSIVLAVVGAHLRGLPLHWQLEKVNATFICSTKTAKKYELYALPKNGPVLKPG 540

Query: 576  LRRVDSEGGAQIQLEVYSVPKDQFGTFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQ 635
            LRR+ S  G+QI+LE+YSVPK++FG FIS VPEPLGIGSVELE+G+WVKSFICEE GY  
Sbjct: 541  LRRITSGTGSQIELELYSVPKEKFGEFISFVPEPLGIGSVELENGKWVKSFICEESGYNS 600

Query: 636  DGTKDITELGSFKTYVDQLAREESEKKKPFETVLVANRGEIAVRXXXXXXXXXXXSVAVY 695
             G+ DI+  G F+ Y++ +      KK  F+TVLVANRGEIAVR           S+A+Y
Sbjct: 601  TGSIDISHYGGFRAYIESIIPSNESKKGHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIY 660

Query: 696  SDPDKYSQHVTDADVAVALKGRTAAETYLDIDKIIAAAKETGTEAIIPGYGFLSENADFS 755
            S  DKYSQHV D D+A AL G T  ETYL ++KII+ AK+   +AIIPGYGFLSENA F+
Sbjct: 661  SATDKYSQHVLDVDMAQALDGHTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFA 720

Query: 756  DRCASEGIVFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGSGLVKTPQEAREIAKALEY 815
            DRC  EGI F+GP G+ IRKLGLKHSARE+A+ AGVPLVPGS LVK   EA  IAK + Y
Sbjct: 721  DRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPLVPGSPLVKNADEAFTIAKNIGY 780

Query: 816  PVMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQM 875
            PVMVKSTAGGGGIGLQKVD+E+D+ + FETV+HQG +YFGDSGVF+E+F++NARHVE+Q+
Sbjct: 781  PVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQI 840

Query: 876  MGDGKGKAIAIGERDCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGSLLKYRCAGT 935
            MGDGKGK +A+GERDCSLQRRNQKVIEETPAPNL  +TR +M  A+E LG+ L YR AGT
Sbjct: 841  MGDGKGKTLALGERDCSLQRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGT 900

Query: 936  VEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAGTPPDFDATKITVTG 995
            VEFIYDE+RD+FYFLEVN RLQVEHPITEMVTGLDLVEWM+ I+AG  P  D   I+  G
Sbjct: 901  VEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVEWMIKISAGVMPSLDEFNISQNG 960

Query: 996  ASIEARLYAENPVKDFRPSPGQLTDVSFPEWARVDTWVSKGTTISAEYDPTLAKIIVHGK 1055
            ASIE R+YAENP+KDFRPSPG+L DV FP   RVDTWV KGT IS E+DPTLAKIIVHGK
Sbjct: 961  ASIEVRVYAENPLKDFRPSPGELVDVQFPNDCRVDTWVKKGTKISPEFDPTLAKIIVHGK 1020

Query: 1056 DRDEAIQKLNQALNETSIYGCITNIDYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEIT 1115
            DR+EAI K+ +ALNET IYGC+TN+DYL+S+ SSEMF+ A+++T  L++Y+Y PSA EI 
Sbjct: 1021 DRNEAILKMKKALNETKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLNTYEYSPSAVEII 1080

Query: 1116 SPGAYTTVQDYPGRVRHWRIGVPPSGPMDSYSFRLANRIVGNHYKAPAIEITLNGPKLLF 1175
             PGA TT+QDYPGRV +WRIGVPP GPMD+YSFRLANRIVGN  + P IEITL GP + F
Sbjct: 1081 EPGALTTIQDYPGRVNYWRIGVPPCGPMDNYSFRLANRIVGNDERTPGIEITLTGPTIKF 1140

Query: 1176 HTDAVIAITGAKAPCTINGSDVSQNKPLSVKKGDQLTVGKLSDGCRAYLAIRGGIDVPEY 1235
            ++D++++I G +  C ++   +   +P+SVK G  L++GK+  G RAYLAIRGGIDVP+Y
Sbjct: 1141 YSDSLVSIAGGEVCCKLDEKKIPMFEPISVKTGSVLSIGKIVKGSRAYLAIRGGIDVPKY 1200

Query: 1236 LGSRSTFALGNMGGYNGRVLKLGDVLFLNQPELPSSGIPAPVYDPSEPPASLLPAISGSK 1295
            +GS STF +GN+GG+NGR LK GDVL L Q      GIP+P + P + P  + P I    
Sbjct: 1201 MGSFSTFTMGNLGGFNGRALKRGDVLSLPQQFDSEHGIPSPCFSPEKAPIYVRPDIPNDG 1260

Query: 1296 EWKIGVTCGPHGSPDFFKPESVEEFFSEQWKVHYNSNRFGVRLIGPKPKWARKDGGEGGL 1355
             W IGV  GPHG+PD F+ E + EFF  +WKVHYNSNRFGVRLIGPKPKW+R DGGEGGL
Sbjct: 1261 VWTIGVLAGPHGAPDIFESEGMMEFFKSEWKVHYNSNRFGVRLIGPKPKWSRTDGGEGGL 1320

Query: 1356 HPSNAHDYVYSLGAINFTGDEPVIITADGPSLGGFVCQAVVPEGELWKVGQVKPGDLIQF 1415
            HPSN HDYVYSLGAINFTGDEPVIIT DGPSLGGFVCQAVV E E+WKVGQ+KPGD I F
Sbjct: 1321 HPSNTHDYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVSEAEMWKVGQLKPGDTINF 1380

Query: 1416 VPVSYETARVLKESQDQAIETFENGSLRTLTSELVLPAAENPVLAQLPRYSEFSPKVTYR 1475
             P+ +++AR LKE+QD  I    + +L+ L+ + +L + E+P+L Q       SPKV YR
Sbjct: 1381 TPIDWQSARNLKENQDVIINDMSSCALQKLSDQPLLKSPEDPILFQKDGQELQSPKVVYR 1440

Query: 1476 QAGDRYVLVEYGENEMDLNISYRVNRLINLVEKNKTIGIVEMSQGVRSVLVEFDGYKISQ 1535
            QAGDRY+L+EYG++  +LN+ YR+  LI+++ +  T GI EMSQGVRSVLVE+DGY+ISQ
Sbjct: 1441 QAGDRYILIEYGDDIFELNLCYRIKSLIDIISQRNTKGIKEMSQGVRSVLVEYDGYEISQ 1500

Query: 1536 KALLETLIAYEGEIKFDRNWSIKSKVFKLPLAFEDSETLECVKRYQETIRSKAPWLPNNV 1595
            K LL+TLIAYE ++  ++NWS+KS++F+LP+AFED ETL CVKRYQETIRSKAPWLPNNV
Sbjct: 1501 KELLKTLIAYEEQLPQEKNWSVKSRIFRLPMAFEDKETLACVKRYQETIRSKAPWLPNNV 1560

Query: 1596 DFIADVNGISHSDVEDMLYQARXXXXXXXXXXXXAPCAVPLNPTHRFLGSKYNPSRTYTK 1655
            DF+A+VN ++H D+  ++Y  R            +PCA+PL+P +R LGSKYNPSRT+TK
Sbjct: 1561 DFVAEVNNLTHDDIRQLIYTTRYMVLGVGDVFLGSPCAIPLDPRNRLLGSKYNPSRTFTK 1620

Query: 1656 NGTVGIGGMYMCIYAMDSPGGYQLVGRTIPIWDKLQLGAHSSQHPWLLTPFDQVEYYQVT 1715
             G VGIGG YMCIYA DSPGGYQLVGRTIPIWD+L L +   + PWLL+PFDQ+E+Y V+
Sbjct: 1621 RGVVGIGGSYMCIYAADSPGGYQLVGRTIPIWDRLMLQSKKDE-PWLLSPFDQIEFYPVS 1679

Query: 1716 EDELNKFTEECENGQFPVQVEESTFDHGEYLKWIDANSEIIKEFQNKQNGEKAEEFAKLI 1775
            E++++++T+E +NG + + V++  FDHG YLKW+  N E I+E Q  Q G+   +FA+ I
Sbjct: 1680 EEQIDEYTDEWDNGNYKIDVDDVVFDHGSYLKWVQDNIEAIEEHQRAQRGDNYSKFAQKI 1739

Query: 1776 QESNAELEKAPDSQGAVEEEFPE-DAEMVYSEYSGRFWKPLVSVGDVVKAGDGLIVVEAM 1834
            QE+NA+L++   +   +E+   E D E ++SEY+GRFWKP+V +G  ++   G+ V+EAM
Sbjct: 1740 QEANADLKQT--TTEVIEQNILEDDCEYIFSEYAGRFWKPIVEIGASIEKDQGVAVIEAM 1797

Query: 1835 KTEMMVSA 1842
            KTEM+VS+
Sbjct: 1798 KTEMIVSS 1805

>ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH]
            (796213..801672) [5460 bp, 1819 aa]
          Length = 1819

 Score = 2315 bits (5999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1108/1799 (61%), Positives = 1371/1799 (76%), Gaps = 14/1799 (0%)

Query: 44   NTLGWSVQDWLGFHXXXXXXXXXXXXXXXIGAQKSAPEDPAWISLVSQEHLEHQWRILQS 103
            +T+GW+ Q W  FH                 A++ A    AWIS+ S EH+EHQWR+LQS
Sbjct: 6    STVGWTSQQWREFHRRASADASLARLLALAHAERDA--GAAWISVASDEHIEHQWRVLQS 63

Query: 104  KGDKKELPLYGVPIAVKDNIDATGCETTAACPEFAYTPSNDSTVVALLRDAGAIVIGKTN 163
            +GD++ LPLYGVP+AVKDNID  G  TTAACP FAYT + D+T V LLRDAGA+++GKTN
Sbjct: 64   RGDRQRLPLYGVPVAVKDNIDVRGLATTAACPSFAYTAAQDATAVRLLRDAGAVILGKTN 123

Query: 164  LDQFATGLVGTRSPYGKTPCVFSNEHXXXXXXXXXXXXXXXXIVPLALGTDTAGSGRVPA 223
            +DQFATGLVGTRSPYG     FS+ H                 VPL LGTDTAGSGRVPA
Sbjct: 124  MDQFATGLVGTRSPYGSVASAFSSAHAAGGSSSGSAVVVARGAVPLTLGTDTAGSGRVPA 183

Query: 224  ALNNLIGLKPSKGVFSCSGVVPACKSLDCVSIFALNLGDAERCFKVMAQPDTEKDEYSRA 283
            ALNNL+G+KP++G  SC+GVVPAC+SLDCVS+FA ++ DA RC +++A+PD   D YSR 
Sbjct: 184  ALNNLVGVKPTRGTVSCTGVVPACRSLDCVSVFARDVADAHRCLRILARPDG-SDPYSRP 242

Query: 284  MPANPLQKYAKDATIAVPTKLPWYDETENFVHYAAAIENLKKTGAKVVEVDFEPLLELAR 343
             PA+  ++ +    + VP +  W+ E++N   +A A + ++ TGA+VV+VD +PLL+L R
Sbjct: 243  SPADAPRRLSTCPVVGVPREPEWFGESQNAKLFATACQRMRATGARVVKVDPQPLLDLGR 302

Query: 344  CLYEGAWVAERYEATRDFFAKNPSESSLDPTVTKIIKGGANYDAADAFRYEYKRQGILQK 403
             LYEG WVAERY A R F++  P   +LDPTVT II     Y AAD F +  +RQ ++  
Sbjct: 303  SLYEGPWVAERYAAMRAFYSGQPPRDTLDPTVTGIITSAGGYSAADVFDHGLRRQKLVAA 362

Query: 404  VSKLLETIDVLCVPTCPHNPTFAQLEAMPVEMNSRQGTWTNFVNLADLAALAVPCGFRSD 463
            +   L  +D L VPTCP NPT A + A P+ +N+RQG WTNFVNLADLAA+A+P GFR D
Sbjct: 363  IEAELAGVDALLVPTCPLNPTLAAIAAEPLLVNARQGMWTNFVNLADLAAVAIPAGFRRD 422

Query: 464  GLPTGITLIGKTFTDYALLELANRYFQIAFPNNSRTYGKFLETPITTQDNLQGPPFSTED 523
            GLP G+TL+G+ F+D ALLEL +R  ++      R  G         +D +       + 
Sbjct: 423  GLPQGVTLVGRKFSDLALLELGSRLLRVE-DAEPRRCGALPAGQALCEDEVVSGSEERDS 481

Query: 524  SIKLAVVGAHLKGLPLHWQLEKVNAQYIGSPKTSPNYRLYALPKTGPVLKPGLRRVDSEG 583
            ++ LAVVGAHL+GL LHWQL++V A+++   +T+P+YRLYALPKTGPVLKP LRRV +  
Sbjct: 482  TVLLAVVGAHLRGLALHWQLDEVQAEFVREARTAPSYRLYALPKTGPVLKPALRRVCAGK 541

Query: 584  GAQIQLEVYSVPKDQFGTFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQDGTKDITE 643
            GA I+LE YSVP+  FG F++MVP PL IGSVELESGE++KSF+CEE GY QDGT DIT 
Sbjct: 542  GAAIELEAYSVPEATFGRFVAMVPAPLAIGSVELESGEYIKSFVCEEDGYIQDGTVDITH 601

Query: 644  LGSFKTYVDQLAREESEKKKPFETVLVANRGEIAVRXXXXXXXXXXXSVAVYSDPDKYSQ 703
            LG F+ YV+ L R + +  KPF+TVLVANRGEIAVR           SVAVYSDPD++SQ
Sbjct: 602  LGGFRRYVEHL-RRQRDVDKPFDTVLVANRGEIAVRIIRTLKRLGIRSVAVYSDPDRHSQ 660

Query: 704  HVTDADVAVALKGRTAAETYLDIDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGI 763
            HV DADVAVAL G +AAETYLDIDKI+AAAK+T T+AIIPGYGFLSENA F++RC +EGI
Sbjct: 661  HVRDADVAVALGGSSAAETYLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAEGI 720

Query: 764  VFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGSGLVKTPQEAREIAKALEYPVMVKSTA 823
            VFVGP+GD+IRKLGLKH ARE+A  AGVPL  G+GL+++   A E  + + YP+MVKSTA
Sbjct: 721  VFVGPSGDSIRKLGLKHWARELAASAGVPLTKGTGLLQSASAALEAGEEIGYPLMVKSTA 780

Query: 824  GGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKA 883
            GGGGIGLQ+VDS  ++   FE VQ QG+ YF DSGVFLE F+  ARHVE+Q+MGDG G+ 
Sbjct: 781  GGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRT 840

Query: 884  IAIGERDCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDER 943
            +A+GERDCSLQRRNQK+IEETPAPNL   TR +MR+A++ L S +KY+CAGTVEF+YDE+
Sbjct: 841  VALGERDCSLQRRNQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQ 900

Query: 944  RDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAGTPPDFDATKITVTGASIEARLY 1003
            +DEFYFLEVN RLQVEHPITEMVTGLDLVEWML IAA TPPDFDA  + + G S+EAR+Y
Sbjct: 901  KDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRIAANTPPDFDA-GVEIEGVSMEARVY 959

Query: 1004 AENPVKDFRPSPGQLTDVSFPEWARVDTWVSKGTTISAEYDPTLAKIIVHGKDRDEAIQK 1063
             ENPVK F PSPG LT+V FP WARVDTW+ KGT ++AEYDPTLAKIIVHGKDR++A+ K
Sbjct: 960  VENPVKGFTPSPGLLTEVVFPSWARVDTWILKGTRVAAEYDPTLAKIIVHGKDREDAVSK 1019

Query: 1064 LNQALNETSIYGCITNIDYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEITSPGAYTTV 1123
            L  AL+ET I GC+TN+DYL+SIASSE F+ A V T++L+ ++Y P+AFE+  PGAYTT+
Sbjct: 1020 LLLALSETRIAGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEVKIPGAYTTI 1079

Query: 1124 QDYPGRVRHWRIGVPPSGPMDSYSFRLANRIVGNHYKAPAIEITLNGPKLLFHTDAVIAI 1183
            QDYPGRV +WRIGVPPSGPMDSYSFRLANR+VGN  KA A+EITLNGP+L FH+DAVIA+
Sbjct: 1080 QDYPGRVGYWRIGVPPSGPMDSYSFRLANRVVGNDSKAAALEITLNGPELKFHSDAVIAV 1139

Query: 1184 TGAKAPCTINGSDVSQNKPLSVKKGDQLTVGKLSDGCRAYLAIRGGIDVPEYLGSRSTFA 1243
            TG   P T+NG  V Q  PL+++KGD L +GKL  G RAYLA+RGGIDVPE+LGSRSTFA
Sbjct: 1140 TGGAVPVTLNGKPVLQYVPLTLEKGDVLKIGKLESGSRAYLAVRGGIDVPEFLGSRSTFA 1199

Query: 1244 LGNMGGYNGRVLKLGDVLFLNQPELPSSGIPAPVYDPSEPPASLLPAISGSKEWKIGVTC 1303
            +G +GG+NGRVL  GDVLF+N+    + G      D    P+ L P I   + WKIG+ C
Sbjct: 1200 MGGIGGHNGRVLAPGDVLFINKDSSVAVG------DTVTIPSGLQPVIP-RESWKIGLVC 1252

Query: 1304 GPHGSPDFFKPESVEEFFSEQWKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHPSNAHDY 1363
            GPHGSPDFFK E++EEFFS  WKVHYNSNRFG+RLIGPKPKWAR DGGE GLHPSN HDY
Sbjct: 1253 GPHGSPDFFKREALEEFFSSPWKVHYNSNRFGIRLIGPKPKWARSDGGEAGLHPSNTHDY 1312

Query: 1364 VYSLGAINFTGDEPVIITADGPSLGGFVCQAVVPEGELWKVGQVKPGDLIQFVPVSYETA 1423
            VYS+GAINFTGDEPVII A+GPSLGGFVC AVVPE ELWKVGQ+KPGD I+FVP+S +TA
Sbjct: 1313 VYSVGAINFTGDEPVIIAAEGPSLGGFVCAAVVPEAELWKVGQLKPGDTIKFVPISVDTA 1372

Query: 1424 RVLKESQDQAIETFENGSLRTLTSELVLPAAENPVLAQLPRYSEFSPKVTYRQAGDRYVL 1483
            R LK SQD A++  +  S   L   +VLP+ ++PVL +L + S   PKVT+RQ+GDRY+L
Sbjct: 1373 RALKRSQDAAVDALDILSSIKLDDSMVLPSYQDPVLLRLAKRSGLCPKVTFRQSGDRYIL 1432

Query: 1484 VEYGENEMDLNISYRVNRLINLVEKNKTIGIVEMSQGVRSVLVEFDGYKISQKALLETLI 1543
            +EYGENEMD+NISYR+ +L  +V KNK  GIVEMSQG+RS+LVE++GY ISQ+ LL  L 
Sbjct: 1433 IEYGENEMDINISYRIKQLQEMVTKNKVTGIVEMSQGIRSLLVEYNGYTISQEDLLSVLS 1492

Query: 1544 AYEGEIKFDRNWSIKSKVFKLPLAFEDSETLECVKRYQETIRSKAPWLPNNVDFIADVNG 1603
            AYE EI FD +W +K+K+F+LP+AFEDS+TLE V+RYQETIRS APWLP+N DF+A+VNG
Sbjct: 1493 AYELEINFDVDWKVKAKLFRLPMAFEDSKTLEAVRRYQETIRSDAPWLPSNADFVANVNG 1552

Query: 1604 ISHSDVEDMLYQARXXXXXXXXXXXXAPCAVPLNPTHRFLGSKYNPSRTYTKNGTVGIGG 1663
            I+ +DV D+LY A             APCAVPL+P  R LG+KYNPSRTYT NG VGIGG
Sbjct: 1553 ITRADVRDLLYSATFMVLGLGDVFLGAPCAVPLDPRQRLLGTKYNPSRTYTPNGVVGIGG 1612

Query: 1664 MYMCIYAMDSPGGYQLVGRTIPIWDKLQLGAHSSQHPWLLTPFDQVEYYQVTEDELNKFT 1723
            MYMCIY  DSPGGYQL+GRTIPIW++LQLG     HPWLLTPFDQVE+Y V+E+ +N+ T
Sbjct: 1613 MYMCIYCTDSPGGYQLMGRTIPIWNRLQLGEAWKDHPWLLTPFDQVEFYPVSEERINELT 1672

Query: 1724 EECENGQFPVQVEESTFDHGEYLKWIDANSEIIKEFQNKQNGEKAEEFAKLIQESNAELE 1783
            EE ENG F ++V+E+ FD+G Y +W++ N E I+ F+  Q+GE+A EFA+LI+ +N++LE
Sbjct: 1673 EEVENGTFELEVKETVFDNGAYNRWLEDNRESIQAFKEGQSGERAAEFARLIKVANSDLE 1732

Query: 1784 KAPDSQGAVEEEFPEDAEMVYSEYSGRFWKPLVSVGDVVKAGDGLIVVEAMKTEMMVSA 1842
             A   + A   E+PEDA MVYSEY+GRFWK +VSVGD VK GD L+++EAMKTEM+VSA
Sbjct: 1733 TAVRKE-AEPVEYPEDAHMVYSEYAGRFWKQVVSVGDKVKEGDKLVIIEAMKTEMVVSA 1790

>YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate
            carboxylase 2 [3543 bp, 1180 aa]
          Length = 1180

 Score =  275 bits (703), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 171/459 (37%), Positives = 258/459 (56%), Gaps = 14/459 (3%)

Query: 668  VLVANRGEIAVRXXXXXXXXXXXSVAVYSDPDKYSQHVTDADVAVAL--KGR-TAAETYL 724
            +LVANRGEI +R           ++A+YS  D+ S H   AD A  +  +G+ T    YL
Sbjct: 23   ILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHRLKADEAYVIGEEGQYTPVGAYL 82

Query: 725  DIDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGIVFVGPAGDAIRKLGLKHSARE 784
             +D+II  AK+   + I PGYGFLSEN++F+D+    GI ++GP  + I  +G K SAR 
Sbjct: 83   AMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSARH 142

Query: 785  IAEKAGVPLVPGS-GLVKTPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVF 843
            +A +A VP VPG+ G ++T QEA +      YPV++K+  GGGG G++ V   +D+   F
Sbjct: 143  LAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAFGGGGRGMRVVREGDDVADAF 202

Query: 844  ETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKAIAIGERDCSLQRRNQKVIEE 903
            +    + +  FG+   F+ERF++  +H+E+Q++ D  G  + + ERDCS+QRR+QKV+E 
Sbjct: 203  QRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEV 262

Query: 904  TPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPIT 963
             PA  L  + R  +   +  L  +  YR AGT EF+ D  ++  YF+E+N R+QVEH IT
Sbjct: 263  APAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTIT 321

Query: 964  EMVTGLDLVEWMLLIAAG---TPPDFDATKITVTGASIEARLYAENPVKDFRPSPGQLT- 1019
            E +TG+D+V   + IAAG   T       KIT  G SI+ R+  E+P K+F+P  G+L  
Sbjct: 322  EEITGIDIVSAQIQIAAGATLTQLGLLQDKITTRGFSIQCRITTEDPSKNFQPDTGRLEV 381

Query: 1020 -DVSFPEWARVDTWVS-KGTTISAEYDPTLAKIIVHGKDRDEAIQKLNQALNETSIYGCI 1077
               +     R+D   +  G TIS  YD  L K    G   +   +K+ +AL E  I G  
Sbjct: 382  YRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRGVK 441

Query: 1078 TNIDYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEITS 1116
            TNI +L ++ ++ +F      T  +D     P  F++ S
Sbjct: 442  TNIPFLLTLLTNPVFIEGTYWTTFIDD---TPQLFQMVS 477

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 42/89 (47%), Gaps = 12/89 (13%)

Query: 1761 NKQNGEKAEEFAKLIQESNAELEK---APDSQGAVEEEFPE----DAEMVYSEYSGRFWK 1813
            NK+ G++   F     E N EL K   A  SQ       P+    D   + +  +G   +
Sbjct: 1060 NKKTGQREVYF-----ELNGELRKIRVADKSQNIQSVAKPKADVHDTHQIGAPMAGVIIE 1114

Query: 1814 PLVSVGDVVKAGDGLIVVEAMKTEMMVSA 1842
              V  G +VK G+ + V+ AMK EM+VS+
Sbjct: 1115 VKVHKGSLVKKGESIAVLSAMKMEMVVSS 1143

>CAGL0K06787g complement(659290..662817) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 Pyruvate
            carboxylase 2, start by similarity
          Length = 1175

 Score =  274 bits (700), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 172/459 (37%), Positives = 254/459 (55%), Gaps = 14/459 (3%)

Query: 668  VLVANRGEIAVRXXXXXXXXXXXSVAVYSDPDKYSQHVTDADVAVALKGR---TAAETYL 724
            +LVANRGEI +R           +VA+YS  D+ S H   AD A  +      T    YL
Sbjct: 23   ILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGKEGEYTPVGAYL 82

Query: 725  DIDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGIVFVGPAGDAIRKLGLKHSARE 784
             ID+II  AK+ G + I PGYGFLSENA+F+D+    GI ++GP  + I  +G K SAR 
Sbjct: 83   AIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITWIGPPPEVIESVGDKVSARN 142

Query: 785  IAEKAGVPLVPGS-GLVKTPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVF 843
            +A KA VP VPG+ G ++T +EA++      YPV++K+  GGGG G++ V   +D+   F
Sbjct: 143  LAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYGGGGRGMRVVREGDDVADAF 202

Query: 844  ETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKAIAIGERDCSLQRRNQKVIEE 903
            +  + +    FG+   F+ERF++  +H+E+Q++ D  G  + + ERDCS+QRR+QKV+E 
Sbjct: 203  QRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEV 262

Query: 904  TPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPIT 963
             PA  L  + R  +   +  L     YR AGT EF+ D  ++  YF+E+N R+QVEH IT
Sbjct: 263  APAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTIT 321

Query: 964  EMVTGLDLVEWMLLIAAGTP-PDFD--ATKITVTGASIEARLYAENPVKDFRPSPGQLT- 1019
            E +TG+DLV   + IAAG   P       +IT  G +I+ R+  E+P K+F+P  G+L  
Sbjct: 322  EEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRLEV 381

Query: 1020 -DVSFPEWARVDTWVS-KGTTISAEYDPTLAKIIVHGKDRDEAIQKLNQALNETSIYGCI 1077
               +     R+D   +  G  IS  YD  L K    G   +   +K+ +AL E  I G  
Sbjct: 382  YRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVK 441

Query: 1078 TNIDYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEITS 1116
            TNI +L ++ +  +F +    T  +D     P  F + S
Sbjct: 442  TNIPFLLTLLTHPVFISGDYWTTFIDD---TPQLFHMVS 477

>KLLA0C05764g complement(512470..515991) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 pyruvate
            carboxylase 2, start by similarity
          Length = 1173

 Score =  271 bits (694), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 182/477 (38%), Positives = 270/477 (56%), Gaps = 18/477 (3%)

Query: 653  QLA--REESEKKKPFETVLVANRGEIAVRXXXXXXXXXXXSVAVYSDPDKYSQHVTDADV 710
            QLA  R+ S        +LVANRGEI +R           +VA+YS  D+ S H   AD 
Sbjct: 4    QLAGLRDNSNLMGEKNKLLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLKADE 63

Query: 711  AVAL--KGR-TAAETYLDIDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGIVFVG 767
            A  +  +G+ T    YL ID+II  AK  G   I PGYGFLSEN++F+++ A+ GI +VG
Sbjct: 64   AYVIGEQGKYTPVGAYLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGITWVG 123

Query: 768  PAGDAIRKLGLKHSAREIAEKAGVPLVPGS-GLVKTPQEAREIAKALEYPVMVKSTAGGG 826
            P    I  +G K SAR +AEKA VP+VPG+ G ++T +EA+       +PV++K+  GGG
Sbjct: 124  PPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAFGGG 183

Query: 827  GIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKAIAI 886
            G G++ V   +DI   F+  + +    FG+   F+ERF++  +H+E+Q++ D  G  + +
Sbjct: 184  GRGMRVVREGDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNVVHL 243

Query: 887  GERDCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDERRDE 946
             ERDCS+QRR+QKV+E  PA  L E+ R  +   +  L     YR AGT EF+ D  ++ 
Sbjct: 244  FERDCSVQRRHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDN-QNR 302

Query: 947  FYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAGTPPD---FDATKITVTGASIEARLY 1003
             YF+E+N R+QVEH ITE +TG+D+V   + IAAG   +       KIT  G +I+ R+ 
Sbjct: 303  HYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGATLEQLGLMQDKITTRGFAIQCRIT 362

Query: 1004 AENPVKDFRPSPGQLTDV---SFPEWARVDTWVS-KGTTISAEYDPTLAKIIVHGKDRDE 1059
             E+P K+F+P  G++ DV   +     R+D   +  G+ IS  YD  L K    G   + 
Sbjct: 363  TEDPSKNFQPDTGRI-DVYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYEI 421

Query: 1060 AIQKLNQALNETSIYGCITNIDYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEITS 1116
              +K+ +AL E  I G  TNI +L ++ +  +FK+ +  T  +D     P  FE+ S
Sbjct: 422  VRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWTTFIDD---TPQLFEMVS 475

>Scas_686.17
          Length = 1176

 Score =  267 bits (682), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 172/463 (37%), Positives = 257/463 (55%), Gaps = 22/463 (4%)

Query: 668  VLVANRGEIAVRXXXXXXXXXXXSVAVYSDPDKYSQHVTDADVAVAL--KGR-TAAETYL 724
            +LVANRGEI +R           +VA+YS  D+ S H   AD +  +  +G+ T    YL
Sbjct: 22   ILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADESYVIGEEGQFTPVGAYL 81

Query: 725  DIDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGIVFVGPAGDAIRKLGLKHSARE 784
             ID+II  AK+   + I PGYGFLSEN++F+D+ A  GI ++GP  + I  +G K SAR 
Sbjct: 82   AIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGITWIGPPAEVIDSVGDKVSARY 141

Query: 785  IAEKAGVPLVPGS-GLVKTPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVF 843
            +A +A VP VPG+ G +K+ +EA +      YPV++K+  GGGG G++ V   EDI   F
Sbjct: 142  LAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAFGGGGRGMRVVREGEDINDAF 201

Query: 844  ETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKAIAIGERDCSLQRRNQKVIEE 903
            +    +    FGD   F+ERF+++ +H+E+Q++GD  G  + + ERDCS+QRR+QKV+E 
Sbjct: 202  QRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVHLFERDCSVQRRHQKVVEV 261

Query: 904  TPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPIT 963
             PA N+  + R  +   +  L     YR AGT EF+ D  ++  YF+E+N R+QVEH IT
Sbjct: 262  APAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTIT 320

Query: 964  EMVTGLDLVEWML-------LIAAGTPPDFDATKITVTGASIEARLYAENPVKDFRPSPG 1016
            E +TG+DLV   +       L   G   D    +IT  G +I+ R+  E+P K+F+P  G
Sbjct: 321  EEITGIDLVAAQIQIAAGASLAQLGLLQD----RITTRGFAIQCRITTEDPAKNFQPDTG 376

Query: 1017 QLT--DVSFPEWARVDTWVS-KGTTISAEYDPTLAKIIVHGKDRDEAIQKLNQALNETSI 1073
            +L     +     R+D   +  G  IS  YD  L K    G   +   +K+ +AL E  I
Sbjct: 377  RLEVYRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRI 436

Query: 1074 YGCITNIDYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEITS 1116
             G  TNI +L ++ +  +F +    T  +D     P  F++ S
Sbjct: 437  RGVKTNIPFLLTLLTHPVFISGDYWTTFIDD---TPQLFKMVS 476

>CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharomyces
            cerevisiae YGL062w PYC1 pyruvate carboxylase or sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2, hypothetical start
          Length = 1180

 Score =  265 bits (676), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 175/461 (37%), Positives = 256/461 (55%), Gaps = 14/461 (3%)

Query: 666  ETVLVANRGEIAVRXXXXXXXXXXXSVAVYSDPDKYSQHVTDADVAVAL--KGR-TAAET 722
            + +LVANRGEI +R           +VA+YS  D+ S H   AD A  +  +G+ T    
Sbjct: 24   DKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGEEGQYTPVGA 83

Query: 723  YLDIDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGIVFVGPAGDAIRKLGLKHSA 782
            YL ID+II  AK+ G + I PGYGFLSEN++F+D+    GI ++GP  + I  +G K SA
Sbjct: 84   YLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGITWIGPPPEVIESVGDKVSA 143

Query: 783  REIAEKAGVPLVPGS-GLVKTPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIER 841
            R +A KA VP VPG+ G +KT +EA        YPV++K+  GGGG G++ V   EDI  
Sbjct: 144  RNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAAYGGGGRGMRVVREGEDIGD 203

Query: 842  VFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKAIAIGERDCSLQRRNQKVI 901
             F+    + K  FG+   F+ERF++  +H+E+Q++ D  G  I + ERDCS+QRR+QKV+
Sbjct: 204  AFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVIHLFERDCSVQRRHQKVV 263

Query: 902  EETPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHP 961
            E  PA  L    R  +   +  L     YR AGT EF+ D  ++  YF+E+N R+QVEH 
Sbjct: 264  EVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVD-NQNRHYFIEINPRIQVEHT 322

Query: 962  ITEMVTGLDLVEWMLLIAAG---TPPDFDATKITVTGASIEARLYAENPVKDFRPSPGQL 1018
            ITE +TG+D+V   + IAAG   T       +IT  G +I+ R+  E+P K+F+P  G++
Sbjct: 323  ITEEITGIDIVAAQIQIAAGASLTELGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRI 382

Query: 1019 T--DVSFPEWARVDTWVS-KGTTISAEYDPTLAKIIVHGKDRDEAIQKLNQALNETSIYG 1075
                 +     R+D   +  G  IS  YD  L K    G   +   +K+ +AL E  I G
Sbjct: 383  EVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKIIRALIEFRIRG 442

Query: 1076 CITNIDYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEITS 1116
              TNI +L ++ +  +F + +  T  +D     P  F + S
Sbjct: 443  VKTNIPFLLTLLTHPVFISGQYWTTFIDD---TPQLFHMVS 480

>Kwal_14.1803
          Length = 1174

 Score =  263 bits (673), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 168/463 (36%), Positives = 258/463 (55%), Gaps = 22/463 (4%)

Query: 668  VLVANRGEIAVRXXXXXXXXXXXSVAVYSDPDKYSQHVTDADVA--VALKGR-TAAETYL 724
            +LVANRGEI +R           +VA+YS  D+ S H   AD A  +  +G+ T    YL
Sbjct: 20   ILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKADEAYMIGKQGKYTPVGAYL 79

Query: 725  DIDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGIVFVGPAGDAIRKLGLKHSARE 784
             ID+I+  AKE   + I PGYGFLSEN++F+ +    GI ++GP+ + I  +G K SAR 
Sbjct: 80   AIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITWIGPSAEVIDSVGDKVSARN 139

Query: 785  IAEKAGVPLVPGS-GLVKTPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVF 843
            +A KA VP+VPG+ G + + +EA+       YPV++K+  GGGG G++ V   +DI   F
Sbjct: 140  LAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFGGGGRGMRVVREGDDIADAF 199

Query: 844  ETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKAIAIGERDCSLQRRNQKVIEE 903
            +    + K  FG+   F+ERF+   +H+E+Q++ DG G  + + ERDCS+QRR+QKV+E 
Sbjct: 200  QRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQKVVEV 259

Query: 904  TPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPIT 963
             PA  L +  R  +   +  L S+  Y+ AGT EF+ D+ ++  YF+E+N R+QVEH IT
Sbjct: 260  APAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDD-QNRHYFIEINPRIQVEHTIT 318

Query: 964  EMVTGLDLVEWML-------LIAAGTPPDFDATKITVTGASIEARLYAENPVKDFRPSPG 1016
            E +TG+D+V   +       L   G   D    +IT  G +I+ R+  E+P K+F+P  G
Sbjct: 319  EEITGIDIVAAQIQIAAGASLQQLGLLQD----RITTRGFAIQCRITTEDPAKNFQPDTG 374

Query: 1017 QLT--DVSFPEWARVDTWVS-KGTTISAEYDPTLAKIIVHGKDRDEAIQKLNQALNETSI 1073
            ++     +     R+D   +  G+ IS  YD  L K    G   +   +K+ +AL E  I
Sbjct: 375  RIEVYRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRI 434

Query: 1074 YGCITNIDYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEITS 1116
             G  TNI +L ++ ++ +F      T  +D     P  F++ S
Sbjct: 435  RGVKTNIPFLLTLLTNPVFIDGTYWTTFIDD---TPELFKMVS 474

>YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase 1,
            catalyzes conversion of pyruvate to oxaloacetate in the
            gluconeogenesis pathway [3537 bp, 1178 aa]
          Length = 1178

 Score =  260 bits (665), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 170/484 (35%), Positives = 263/484 (54%), Gaps = 20/484 (4%)

Query: 668  VLVANRGEIAVRXXXXXXXXXXXSVAVYSDPDKYSQHVTDADVAVALK---GRTAAETYL 724
            +LVANRGEI +R           +VA+YS  D+ S H   AD A  +      T    YL
Sbjct: 22   ILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQKADEAYVIGEVGQYTPVGAYL 81

Query: 725  DIDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGIVFVGPAGDAIRKLGLKHSARE 784
             ID+II+ A++   + I PGYGFLSEN++F+D+    GI ++GP  + I  +G K SAR 
Sbjct: 82   AIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSARN 141

Query: 785  IAEKAGVPLVPGS-GLVKTPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVF 843
            +A KA VP VPG+ G ++T +EA +      YPV++K+  GGGG G++ V   +D+   F
Sbjct: 142  LAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAAFGGGGRGMRVVREGDDVADAF 201

Query: 844  ETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKAIAIGERDCSLQRRNQKVIEE 903
            +    + +  FG+   F+ERF++  +H+E+Q++ D  G  + + ERDCS+QRR+QKV+E 
Sbjct: 202  QRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEV 261

Query: 904  TPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPIT 963
             PA  L  + R  +   +  L     YR AGT EF+ D  ++  YF+E+N R+QVEH IT
Sbjct: 262  APAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTIT 320

Query: 964  EMVTGLDLV-EWMLLIAAGTPPDFD--ATKITVTGASIEARLYAENPVKDFRPSPGQLT- 1019
            E +TG+D+V   + + A  + P       KIT  G +I+ R+  E+P K+F+P  G++  
Sbjct: 321  EEITGIDIVAAQIQIAAGASLPQLGLFQDKITTRGFAIQCRITTEDPAKNFQPDTGRIEV 380

Query: 1020 -DVSFPEWARVDTWVS-KGTTISAEYDPTLAKIIVHGKDRDEAIQKLNQALNETSIYGCI 1077
               +     R+D   +  GT IS  YD  L K    G   +   +K+ +AL E  I G  
Sbjct: 381  YRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRGVK 440

Query: 1078 TNIDYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEITSPGAYTTVQDYPGRVRHWRIGV 1137
            TNI +L ++ ++ +F      T  +D     P  F++ S       Q+   ++ H+   V
Sbjct: 441  TNIPFLLTLLTNPVFIEGTYWTTFIDD---TPQLFQMVSS------QNRAQKLLHYLADV 491

Query: 1138 PPSG 1141
              +G
Sbjct: 492  AVNG 495

>AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (PYC2)
            - SH] (634067..637582) [3516 bp, 1171 aa]
          Length = 1171

 Score =  260 bits (664), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 179/487 (36%), Positives = 269/487 (55%), Gaps = 26/487 (5%)

Query: 642  TELGSFKTYVDQLAREESEKKKPFETVLVANRGEIAVRXXXXXXXXXXXSVAVYSDPDKY 701
            ++L  F+ + + L     EK K    VLVANRGEI +R           +VAVYS  D+ 
Sbjct: 3    SQLAGFRRHSNLLG----EKNK----VLVANRGEIPIRIFRTAHELSMATVAVYSYEDRL 54

Query: 702  SQHVTDADVAVALKGR----TAAETYLDIDKIIAAAKETGTEAIIPGYGFLSENADFSDR 757
            S H   AD A  + GR    T    YL ID+I+  A++   + I PGYGFLSENA+F+ +
Sbjct: 55   SMHRQKADEAYMI-GREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAK 113

Query: 758  CASEGIVFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGS-GLVKTPQEAREIAKALEYP 816
                GI ++GP    I  +G K SAR +A  A VP VPG+ G + + +EA E  +   YP
Sbjct: 114  VEGAGITWIGPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYP 173

Query: 817  VMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMM 876
            V++K+  GGGG G++ V   +DI   F+  + + +  FG+   F+ERF++  +H+E+Q++
Sbjct: 174  VIIKAAFGGGGRGMRVVREGDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLL 233

Query: 877  GDGKGKAIAIGERDCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGSLLKYRCAGTV 936
             D  G  + + ERDCS+QRR+QKV+E  PA  LS++ R  +   +  L     YR AGT 
Sbjct: 234  ADNYGNVVHLFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTA 293

Query: 937  EFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAGTPPD---FDATKITV 993
            EF+ D +++  YF+E+N R+QVEH ITE +TG+D+V   + IAAG   +       +IT 
Sbjct: 294  EFLVD-KQNRHYFIEINPRIQVEHTITEEITGVDIVAAQIQIAAGASLEQLGLMQDRITT 352

Query: 994  TGASIEARLYAENPVKDFRPSPGQLTDV---SFPEWARVDTWVS-KGTTISAEYDPTLAK 1049
             G +I+ R+  E+P K+F+P  G+L DV   +     R+D   +  G  IS  YD  L K
Sbjct: 353  RGFAIQCRITTEDPSKNFQPDTGRL-DVYRSAGGNGVRLDGGNAFAGAVISPHYDSMLVK 411

Query: 1050 IIVHGKDRDEAIQKLNQALNETSIYGCITNIDYLRSIASSEMFKTAKVATKVLDSYDYRP 1109
                G   +   +K+ +AL E  I G  TNI +L ++ +  +F +    T  +D     P
Sbjct: 412  CSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDD---TP 468

Query: 1110 SAFEITS 1116
              FE+ +
Sbjct: 469  QLFEMVA 475

>Scas_563.12
          Length = 1216

 Score =  256 bits (654), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 163/436 (37%), Positives = 243/436 (55%), Gaps = 14/436 (3%)

Query: 691  SVAVYSDPDKYSQHVTDADVAVAL---KGRTAAETYLDIDKIIAAAKETGTEAIIPGYGF 747
            +VA+YS  D+ S H   AD +  +      T    YL ID+II  AK  G + I PGYGF
Sbjct: 86   TVAIYSHEDRLSTHRLKADESYVIGEPHQFTPVGAYLAIDEIINIAKRHGVDYIHPGYGF 145

Query: 748  LSENADFSDRCASEGIVFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGS-GLVKTPQEA 806
            LSEN++F+D+ A  GI ++GP    I  +G K SAR +A KA VP VPG+ G ++T Q+A
Sbjct: 146  LSENSEFADKVAKAGITWIGPPASVIDSVGDKVSARNLATKANVPTVPGTPGPIRTVQDA 205

Query: 807  REIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVE 866
            ++      YPV++K+  GGGG G++ V+  +D+   F+    +    FGD   F+ERF+ 
Sbjct: 206  QDFVNEYGYPVIIKAAFGGGGRGMRVVNEGDDLADAFQRASSEALTAFGDGTCFVERFLN 265

Query: 867  NARHVEIQMMGDGKGKAIAIGERDCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGS 926
              +H+E+Q++ D  G  I + ERDCS+QRR+QKV+E  PA  L  + R  +   +  L  
Sbjct: 266  KPKHIEVQLLADTHGNVIHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAK 325

Query: 927  LLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAGTPPD- 985
               Y+ AGT EF+ D+ ++  YF+E+N R+QVEH ITE +TG+D+V   + IAAG   + 
Sbjct: 326  ECGYQNAGTAEFLVDD-QNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLEQ 384

Query: 986  --FDATKITVTGASIEARLYAENPVKDFRPSPGQLT--DVSFPEWARVDTWVS-KGTTIS 1040
                  KIT  G +I+ R+  E+P K+F+P  G+L   D +     R+D   +  G  IS
Sbjct: 385  LGLLQDKITTRGFAIQCRITTEDPAKNFQPDTGRLEVYDSAGGNGVRLDGGNAYAGAIIS 444

Query: 1041 AEYDPTLAKIIVHGKDRDEAIQKLNQALNETSIYGCITNIDYLRSIASSEMFKTAKVATK 1100
              YD  L K    G   +   +K+ +AL E  I G  TNI +L ++ +  +F      T 
Sbjct: 445  PHYDSMLVKCSCSGSTYEVVRRKMIRALIEFRIRGVKTNIPFLLTLLTHPVFIAGDYWTT 504

Query: 1101 VLDSYDYRPSAFEITS 1116
             +D     P  F++ S
Sbjct: 505  FIDD---TPQLFKMVS 517

>Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement
          Length = 1132

 Score =  253 bits (647), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 166/440 (37%), Positives = 247/440 (56%), Gaps = 22/440 (5%)

Query: 691  SVAVYSDPDKYSQHVTDADVAVALK--GR-TAAETYLDIDKIIAAAKETGTEAIIPGYGF 747
            +VA+YS+ D+ S H   AD A  +   G+ T    YL ID+II+ AKE G   I PGYGF
Sbjct: 3    TVAIYSNEDRLSMHRLKADEAYMIGEGGKYTPVGAYLAIDEIISIAKEHGVSFIHPGYGF 62

Query: 748  LSENADFSDRCASEGIVFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGS-GLVKTPQEA 806
            LSENA+F+ +    GI ++GP  + I  +G K SAR++A KA VP VPG+ G +++ +EA
Sbjct: 63   LSENAEFAAKVIDAGITWIGPPPEVINSVGDKVSARDLAAKANVPTVPGTPGPIESVEEA 122

Query: 807  REIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVE 866
                    YPV++K+  GGGG G++ V   +DI   F+    + K  FG+   F+ERF++
Sbjct: 123  EAFVAEYGYPVIIKAAFGGGGRGMRVVREGDDIGDAFQRATSEAKTAFGNGTCFVERFLD 182

Query: 867  NARHVEIQMMGDGKGKAIAIGERDCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGS 926
              +H+E+Q++ D  G  I + ERDCS+QRR+QKV+E  PA  L ++ R  +   +  L  
Sbjct: 183  KPKHIEVQLLADNYGNVIHLFERDCSVQRRHQKVVEVAPAKTLPKEVRDSILTDAVKLAK 242

Query: 927  LLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWML-------LIA 979
              KYR AGT EF+ D  ++  YF+E+N R+QVEH ITE +TG+D+V   +       L  
Sbjct: 243  EAKYRNAGTAEFLVDA-QNRHYFIEINPRIQVEHTITEEITGVDVVAAQIQIAAGASLQQ 301

Query: 980  AGTPPDFDATKITVTGASIEARLYAENPVKDFRPSPGQLT--DVSFPEWARVDTWVS-KG 1036
             G   D    KIT  G +I+ R+  E+P K+F+P  G++     +     R+D   +  G
Sbjct: 302  LGLLQD----KITTRGFAIQCRITTEDPSKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAG 357

Query: 1037 TTISAEYDPTLAKIIVHGKDRDEAIQKLNQALNETSIYGCITNIDYLRSIASSEMFKTAK 1096
              IS  YD  L K    G   +   +K+ +AL E  I G  TNI +L ++ +  +FK+ +
Sbjct: 358  AVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHSVFKSGE 417

Query: 1097 VATKVLDSYDYRPSAFEITS 1116
              T  +D     P  FE+ S
Sbjct: 418  YWTTFIDD---TPQLFEMVS 434

>YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein with
            similarity to acetyl-CoA carboxylase [6372 bp, 2123 aa]
          Length = 2123

 Score =  241 bits (616), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 159/465 (34%), Positives = 242/465 (52%), Gaps = 58/465 (12%)

Query: 693  AVYSDPDKY---SQHVTDADVAVALKGRTAAETYLDIDKIIAAAKETGTEAIIPGYGFLS 749
             V + PD     S+++  AD  V + G T    Y +ID I+  A++T  +A+  G+G  S
Sbjct: 21   VVMATPDDLHANSEYIRMADQYVQVPGGTNNNNYANIDLILDVAEQTDVDAVWAGWGHAS 80

Query: 750  ENADFSDRCAS--EGIVFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGSG--------- 798
            EN    +  AS    I+F+GP G A+R LG K S+  +A+ A +P +P SG         
Sbjct: 81   ENPCLPELLASSQRKILFIGPPGRAMRSLGDKISSTIVAQSAKIPCIPWSGSHIDTIHID 140

Query: 799  ----------------LVKTPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIERV 842
                               +P++A E AK + +PVM+K++ GGGG G+++VD+E+D    
Sbjct: 141  NKTNFVSVPDDVYVRGCCSSPEDALEKAKLIGFPVMIKASEGGGGKGIRRVDNEDD---- 196

Query: 843  FETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKAIAIGERDCSLQRRNQKVIE 902
            F  +  Q       S +F+ + V +ARH+E+Q++ D  G  I +  RDCS+QRR+QK+IE
Sbjct: 197  FIALYRQAVNETPGSPMFVMKVVTDARHLEVQLLADQYGTNITLFGRDCSIQRRHQKIIE 256

Query: 903  ETPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPI 962
            E P      +T  RM  A+  LG L+ Y  AGTVE++Y  + D+FYFLE+N RLQVEHP 
Sbjct: 257  EAPVTITKPETFQRMERAAIRLGELVGYVSAGTVEYLYSPKDDKFYFLELNPRLQVEHPT 316

Query: 963  TEMVTGLDLVEWMLLIAAGTPP--------------------DFDATKI-TVTGASIEAR 1001
            TEM++G++L    L IA G P                     DF   K  +  G  I  R
Sbjct: 317  TEMISGVNLPATQLQIAMGIPMHMISDIRKLYGLDPTGTSYIDFKNLKRPSPKGHCISCR 376

Query: 1002 LYAENPVKDFRPSPGQLTDVSFPEWARVDTWVSKGTT--ISAEYDPTLAKIIVHGKDRDE 1059
            + +E+P + F+PS G++ +++F   + V  + S G    I +  D     I   G DR +
Sbjct: 377  ITSEDPNEGFKPSTGKIHELNFRSSSNVWGYFSVGNNGAIHSFSDSQFGHIFAVGNDRQD 436

Query: 1060 AIQKLNQALNETSIYGCI-TNIDYLRSIASSEMFKTAKVATKVLD 1103
            A Q +  AL + SI G   T I+YL  +  +  F++  ++T  LD
Sbjct: 437  AKQNMVLALKDFSIRGEFKTPIEYLIELLETRDFESNNISTGWLD 481

>Scas_720.74
          Length = 2231

 Score =  233 bits (594), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 154/472 (32%), Positives = 241/472 (51%), Gaps = 63/472 (13%)

Query: 691  SVAVYSDPDKYSQHVTDADVAVALKGRTAAETYLDIDKIIAAAKETGTEAIIPGYGFLSE 750
            ++A   D +  ++++  AD  V + G T  + Y ++D I+  A+    +A+  G+G  SE
Sbjct: 96   AMATPEDLEANAEYIRMADQYVEVPGGTNNKNYANVDLIVDIAERADVDAVWAGWGHASE 155

Query: 751  NADFSDRCA--SEGIVFVGPAGDAIRKLGLKHSAREIAEKAGVPLVP--GSGLVK----- 801
            N    ++ A     +VF+GP G A+R LG K S+  +A+ A VP +P  G+G+ K     
Sbjct: 156  NPHLPEKLAMSKRKVVFIGPPGSAMRSLGDKISSTIVAQSAHVPCIPWSGTGIDKVQVDK 215

Query: 802  ------------------TPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVF 843
                              +P++  E AK + +PVM+K++ GGGG G+++V+ EED    F
Sbjct: 216  DTGLVSVADEVYAQGCCSSPEDGLEKAKKIGFPVMIKASEGGGGKGIRQVEREED----F 271

Query: 844  ETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKAIAIGERDCSLQRRNQKVIEE 903
              + HQ       S +F+ +    ARH+E+Q++ D  G  I++  RDCS+QRR+QK+IEE
Sbjct: 272  IALYHQAANEIPGSPIFIMKLAGKARHLEVQLLADQYGNNISLFGRDCSVQRRHQKIIEE 331

Query: 904  TPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPIT 963
             P    + +T A M +++  LG L+ Y  AGTVE++Y     +FYFLE+N RLQVEHP T
Sbjct: 332  APVTIAAPETFAMMEKSAVRLGKLVGYVSAGTVEYLYSHEDKKFYFLELNPRLQVEHPTT 391

Query: 964  EMVTGLDLVEWMLLIAAGTPP--------------------DFDAT---------KITVT 994
            EMVTG++L    L IA G P                     DFD +         K    
Sbjct: 392  EMVTGVNLPATQLQIAMGIPMHRISDIRVFYGMNPHTASEIDFDFSTEESLKTQRKPVPK 451

Query: 995  GASIEARLYAENPVKDFRPSPGQLTDVSFPEWARVDTWVSKGTT--ISAEYDPTLAKIIV 1052
            G     R+ +E+P + F+PS G L +++F   + V  + S G    I +  D     I  
Sbjct: 452  GHCTACRITSEDPDEGFKPSGGSLHELNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFA 511

Query: 1053 HGKDRDEAIQKLNQALNETSIYGCI-TNIDYLRSIASSEMFKTAKVATKVLD 1103
             G++R  + + +  AL E SI G   T ++YL  +  +E F+   + T  LD
Sbjct: 512  FGENRQASRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLD 563

>KLLA0F06072g 583276..589971 highly similar to sp|Q00955 Saccharomyces
            cerevisiae YNR016c ACC1 acetyl-CoA carboxylase, start by
            similarity
          Length = 2231

 Score =  231 bits (588), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 158/506 (31%), Positives = 248/506 (49%), Gaps = 74/506 (14%)

Query: 668  VLVANRGEIAVRXXXXXX-----------XXXXXSVAVYSDPDKYSQHVTDADVAVALKG 716
            VL+AN G  AV+                      ++A   D +  ++++  AD  + + G
Sbjct: 63   VLIANNGIAAVKEIRSVRKWAYETFGDERTVQFVAMATPEDLEANAEYIRMADQYIEVPG 122

Query: 717  RTAAETYLDIDKIIAAAKETGTEAIIPGYGFLSENADFSDRCAS--EGIVFVGPAGDAIR 774
             T    Y ++D I+  A+    +A+  G+G  SEN    +R A+    I+F+GP G+A+R
Sbjct: 123  GTNNNNYANVDLIVEVAERADVDAVWAGWGHASENPLLPERLAASHRKIIFIGPPGNAMR 182

Query: 775  KLGLKHSAREIAEKAGVPLVPGSG-------------------------LVKTPQEAREI 809
             LG K S+  +A+ A VP +P SG                            +P++  + 
Sbjct: 183  SLGDKISSTIVAQHAKVPCIPWSGTGVDEVHVDKETNLVSVEDKVYQEGCCSSPEDGLKK 242

Query: 810  AKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENAR 869
            AK + +P+MVK++ GGGG G++KV++E++    F ++  Q       S +F+ +    AR
Sbjct: 243  AKEIGFPIMVKASEGGGGKGIRKVENEDE----FLSLYQQAANEIPGSPIFIMKLAGKAR 298

Query: 870  HVEIQMMGDGKGKAIAIGERDCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGSLLK 929
            H+E+Q++ D  G  I++  RDCS+QRR+QK+IEE P       T   M +A+  LG L+ 
Sbjct: 299  HLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMEKAAVRLGQLVG 358

Query: 930  YRCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAGTPP----- 984
            Y  AGTVE++Y    D+FYFLE+N RLQVEHP TEMVTG++L    L IA G P      
Sbjct: 359  YVSAGTVEYLYSHDEDKFYFLELNPRLQVEHPTTEMVTGVNLPSAQLQIAMGIPMHRIRD 418

Query: 985  ---------------DFDAT---------KITVTGASIEARLYAENPVKDFRPSPGQLTD 1020
                           DF+ +         K T  G     R+ +E+P + F+PS G L +
Sbjct: 419  IRLLYGVDPKSASEIDFNFSTPESAKTQRKPTPKGHCTACRITSEDPNEGFKPSGGALHE 478

Query: 1021 VSFPEWARVDTWVSKGTT--ISAEYDPTLAKIIVHGKDRDEAIQKLNQALNETSIYGCI- 1077
            ++F   + V  + S G    I +  D     I   G++R  + + +  AL E SI G   
Sbjct: 479  LNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFR 538

Query: 1078 TNIDYLRSIASSEMFKTAKVATKVLD 1103
            T ++YL  +  +E F+   + T  LD
Sbjct: 539  TTVEYLIKLLETEDFEDNTITTGWLD 564

>Kwal_23.6157
          Length = 2230

 Score =  230 bits (587), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 163/508 (32%), Positives = 247/508 (48%), Gaps = 78/508 (15%)

Query: 668  VLVANRGEIAVRXXXXXX-----------XXXXXSVAVYSDPDKYSQHVTDADVAVALKG 716
            VL+AN G  AV+                      ++A   D +  ++++  AD  V + G
Sbjct: 63   VLIANNGIAAVKEIRSVRKWAYETFGNERAVQFVAMATPEDLEANAEYLRMADQYVEVPG 122

Query: 717  RTAAETYLDIDKIIAAAKETGTEAIIPGYGFLSENADFSDRCAS--EGIVFVGPAGDAIR 774
             T    Y ++D I+  A+    +A+  G+G  SEN    +R A+    ++F+GP G+A+R
Sbjct: 123  GTNNNNYANVDLIVELAERADVDAVWAGWGHASENPLLPERLAASPRKVIFIGPPGNAMR 182

Query: 775  KLGLKHSAREIAEKAGVPLVPGSG-------------------------LVKTPQEAREI 809
             LG K S+  +A+ A VP +P SG                            +P++    
Sbjct: 183  SLGDKISSTIVAQHAKVPCIPWSGTGVDQVHLDEENGLVSVTDDIYQKGCCDSPEDGLAK 242

Query: 810  AKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENAR 869
            AK + +PVMVK++ GGGG G++KV+ E+D    F  +  Q       S +F+ +   NAR
Sbjct: 243  AKKIGFPVMVKASEGGGGKGIRKVEREQD----FIPLYKQAANEIPGSPIFIMKLAGNAR 298

Query: 870  HVEIQMMGDGKGKAIAIGERDCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGSLLK 929
            H+E+Q++ D  G  I++  RDCS+QRR+QK+IEE P       T   M  ++  LG L+ 
Sbjct: 299  HLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMERSAVRLGKLVG 358

Query: 930  YRCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAGTPP----- 984
            Y  AGTVE++Y    D+FYFLE+N RLQVEHP TEMV+G++L    L IA G P      
Sbjct: 359  YVSAGTVEYLYSHDDDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPMHRIKD 418

Query: 985  ---------------DF-----DATKI----TVTGASIEARLYAENPVKDFRPSPGQLTD 1020
                           DF     D+TKI    T  G     R+ +E+P + F+PS G L +
Sbjct: 419  IRLMYGVDPHTATEIDFDFSSKDSTKIQRRPTPKGHCTACRITSEDPNEGFKPSGGSLHE 478

Query: 1021 VSFPEWARVDTW----VSKGTTISAEYDPTLAKIIVHGKDRDEAIQKLNQALNETSIYGC 1076
            ++F   + V  W    VS    I +  D     I   G++R  + + +  AL E SI G 
Sbjct: 479  LNFRSSSNV--WGYFSVSSSGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGD 536

Query: 1077 I-TNIDYLRSIASSEMFKTAKVATKVLD 1103
              T ++YL  +  +E F+   + T  LD
Sbjct: 537  FRTTVEYLIKLLETEDFEGNSITTGWLD 564

>AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C (HFA1)
            - SH] complement(466791..473486) [6696 bp, 2231 aa]
          Length = 2231

 Score =  229 bits (583), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 157/471 (33%), Positives = 236/471 (50%), Gaps = 63/471 (13%)

Query: 692  VAVYSDPDKYSQHVTDADVAVALKGRTAAETYLDIDKIIAAAKETGTEAIIPGYGFLSEN 751
            +A   D +  ++++  AD  V + G T    Y ++D I+  A+    +A+  G+G  SEN
Sbjct: 97   MATPEDLEANTEYIRMADQYVEVPGGTNNNNYANVDLIVDVAERADVDAVWAGWGHASEN 156

Query: 752  ADFSDRCA--SEGIVFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGSG----------- 798
                ++ A     +VF+GP G A+R LG K S+  +A+ A VP +P SG           
Sbjct: 157  PLLPEKLARSKRKVVFIGPPGSAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDQVEIDPH 216

Query: 799  --LVK------------TPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVFE 844
              LV             +P++    AK + +PVMVK++ GGGG G++KV  EED    F 
Sbjct: 217  TKLVSVADDIYQKGCCLSPEDGLNKAKQIGFPVMVKASEGGGGKGIRKVVREED----FI 272

Query: 845  TVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKAIAIGERDCSLQRRNQKVIEET 904
            ++  Q       S +F+ +    ARH+E+Q++ D  G  I++  RDCS+QRR+QK+IEE 
Sbjct: 273  SLYQQAANEIPGSPIFIMKLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEA 332

Query: 905  PAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPITE 964
            P       T A M  A+  LG L+ Y  AGTVE++Y    D+FYFLE+N RLQVEHP TE
Sbjct: 333  PVTIAKPDTFAEMERAAVRLGKLVGYVSAGTVEYLYSHEEDKFYFLELNPRLQVEHPTTE 392

Query: 965  MVTGLDLVEWMLLIAAGTPPD-------------FDATKITVTGASIEA----------- 1000
            MVTG++L    L IA G P                 AT+I    +S +A           
Sbjct: 393  MVTGVNLPAAQLQIAMGIPLHRIRDIRLFYGLDPHTATEIDFEFSSADALQTQRRPIPKG 452

Query: 1001 -----RLYAENPVKDFRPSPGQLTDVSFPEWARVDTWVSKGTT--ISAEYDPTLAKIIVH 1053
                 R+ +E+P + F+PS G L +++F   + V  + S G    I +  D     I   
Sbjct: 453  HCTACRITSEDPNEGFKPSGGSLHELNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAF 512

Query: 1054 GKDRDEAIQKLNQALNETSIYGCI-TNIDYLRSIASSEMFKTAKVATKVLD 1103
            G++R  + + +  AL E SI G   T ++YL  +  +E F+   + T  LD
Sbjct: 513  GENRQASRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLD 563

>CAGL0L10780g complement(1149588..1156289) highly similar to sp|Q00955
            Saccharomyces cerevisiae YNR016c ACC1 or sp|P32874
            Saccharomyces cerevisiae YMR207c HFA1, start by
            similarity
          Length = 2233

 Score =  228 bits (581), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 159/506 (31%), Positives = 243/506 (48%), Gaps = 74/506 (14%)

Query: 668  VLVANRGEIAVRXXXXXXX-----------XXXXSVAVYSDPDKYSQHVTDADVAVALKG 716
            VL+AN G  AV+                      ++A   D +  ++++  AD  V + G
Sbjct: 62   VLIANNGIAAVKEIRSVRKWAYETFGDEKIVQFVAMATPEDLEANAEYIRMADQYVEVPG 121

Query: 717  RTAAETYLDIDKIIAAAKETGTEAIIPGYGFLSENADFSDRCA--SEGIVFVGPAGDAIR 774
             T    Y ++D I+  A+    +A+  G+G  SEN    ++ A     I+F+GP G+A+R
Sbjct: 122  GTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLARSKRKILFIGPPGNAMR 181

Query: 775  KLGLKHSAREIAEKAGVPLVPGSG-------------------------LVKTPQEAREI 809
             LG K S+  +A+ A VP +P SG                            +P++  E 
Sbjct: 182  SLGDKISSTIVAQHAKVPCIPWSGTGVDTVHIDEKNGLVSVDDDIYQKGCCSSPEDGLEK 241

Query: 810  AKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENAR 869
            AK + +PVM+K++ GGGG G+++V  EED    F  + HQ       S +F+ +    AR
Sbjct: 242  AKKIGFPVMIKASEGGGGKGIRQVTREED----FINLYHQAANEIPGSPIFIMKLAGKAR 297

Query: 870  HVEIQMMGDGKGKAIAIGERDCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGSLLK 929
            H+E+Q++ D  G  I++  RDCS+QRR+QK+IEE P      +T   M +A+  LG L+ 
Sbjct: 298  HLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAGPETFGEMEKAAVRLGKLVG 357

Query: 930  YRCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAGTPP----- 984
            Y  AGTVE++Y    ++FYFLE+N RLQVEHP TEMVTG++L    L IA G P      
Sbjct: 358  YVSAGTVEYLYSHDDNKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPMHRISD 417

Query: 985  ---------------DFD---------ATKITVTGASIEARLYAENPVKDFRPSPGQLTD 1020
                           DF+           K    G     R+ +E+P   F+PS G L +
Sbjct: 418  IRIFYGLNPRGSSEIDFEFKSEDSLKTQRKPIPKGHCTACRITSEDPNDGFKPSGGTLNE 477

Query: 1021 VSFPEWARVDTWVSKGTT--ISAEYDPTLAKIIVHGKDRDEAIQKLNQALNETSIYGCI- 1077
            ++F   + V  + S G    I +  D     I   G++R  + + +  AL E SI G   
Sbjct: 478  LNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFR 537

Query: 1078 TNIDYLRSIASSEMFKTAKVATKVLD 1103
            T ++YL  +  +E F+   + T  LD
Sbjct: 538  TTVEYLIKLLETEDFEENTITTGWLD 563

>YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-CoA
            carboxylase, first and rate-limiting step in fatty acid
            biosynthesis pathway [6702 bp, 2233 aa]
          Length = 2233

 Score =  225 bits (573), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 150/472 (31%), Positives = 236/472 (50%), Gaps = 63/472 (13%)

Query: 691  SVAVYSDPDKYSQHVTDADVAVALKGRTAAETYLDIDKIIAAAKETGTEAIIPGYGFLSE 750
            ++A   D +  ++++  AD  + + G T    Y ++D I+  A+    +A+  G+G  SE
Sbjct: 96   AMATPEDLEANAEYIRMADQYIEVPGGTNNNNYANVDLIVDIAERADVDAVWAGWGHASE 155

Query: 751  NADFSDRCAS--EGIVFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGSG---------- 798
            N    ++ +     ++F+GP G+A+R LG K S+  +A+ A VP +P SG          
Sbjct: 156  NPLLPEKLSQSKRKVIFIGPPGNAMRSLGDKISSTIVAQSAKVPCIPWSGTGVDTVHVDE 215

Query: 799  ---------------LVKTPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVF 843
                              +P++  + AK + +PVM+K++ GGGG G+++V+ EED    F
Sbjct: 216  KTGLVSVDDDIYQKGCCTSPEDGLQKAKRIGFPVMIKASEGGGGKGIRQVEREED----F 271

Query: 844  ETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKAIAIGERDCSLQRRNQKVIEE 903
              + HQ       S +F+ +    ARH+E+Q++ D  G  I++  RDCS+QRR+QK+IEE
Sbjct: 272  IALYHQAANEIPGSPIFIMKLAGRARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEE 331

Query: 904  TPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPIT 963
             P      +T   M +A+  LG L+ Y  AGTVE++Y     +FYFLE+N RLQVEHP T
Sbjct: 332  APVTIAKAETFHEMEKAAVRLGKLVGYVSAGTVEYLYSHDDGKFYFLELNPRLQVEHPTT 391

Query: 964  EMVTGLDLVEWMLLIAAGTPP--------------------DF-----DATKITV----T 994
            EMV+G++L    L IA G P                     DF     DATK        
Sbjct: 392  EMVSGVNLPAAQLQIAMGIPMHRISDIRTLYGMNPHSASEIDFEFKTQDATKKQRRPIPK 451

Query: 995  GASIEARLYAENPVKDFRPSPGQLTDVSFPEWARVDTWVSKGT--TISAEYDPTLAKIIV 1052
            G     R+ +E+P   F+PS G L +++F   + V  + S G    I +  D     I  
Sbjct: 452  GHCTACRITSEDPNDGFKPSGGTLHELNFRSSSNVWGYFSVGNNGNIHSFSDSQFGHIFA 511

Query: 1053 HGKDRDEAIQKLNQALNETSIYGCI-TNIDYLRSIASSEMFKTAKVATKVLD 1103
             G++R  + + +  AL E SI G   T ++YL  +  +E F+   + T  LD
Sbjct: 512  FGENRQASRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLD 563

>Scas_684.25
          Length = 482

 Score =  103 bits (258), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 123/443 (27%), Positives = 186/443 (41%), Gaps = 66/443 (14%)

Query: 104 KGDKKELPLYGVPIAVKDNIDATGCETTAACPEFA-YTPSNDSTVVALLRDAGAIVIGKT 162
           KG     PL     AVKDNI      TT +    + Y    D+TVV LLR++G  ++GKT
Sbjct: 41  KGSTVNNPLSNTLCAVKDNIATNDMPTTCSSSMLSNYQSPFDATVVKLLRESGTTIVGKT 100

Query: 163 NLDQFATGLVGTRSPYGK--TPCVFSNEHXXXXXXXXXXXXXXXXIVPLALGTDTAGSGR 220
           N+D+FA G +G  S YG    P     +                 +V  ALGTDT GS R
Sbjct: 101 NMDEFAMGSLGIHSHYGPALNPLFHDVDTVSGGSSSGSAGSVTSGVVHFALGTDTGGSVR 160

Query: 221 VPAALNNLIGLKPSKGVFSCSGVVPACKSLDCVSIFALNLGDAERCFKVMAQPDTEKDEY 280
           +PA   +++G K S G  S  GVV   +SLD V I A NL   +  F  + + D +KD  
Sbjct: 161 LPACYCSVLGFKGSYGRISRFGVVSFAQSLDTVGIMADNLQRVKDVFNTLDKFD-KKDPT 219

Query: 281 SRA----MPANPLQKY-AKDATIAVPTKLPWYDETENFVH------YAAAIENLKKTGAK 329
           S +       N + K   K         +P ++ ++N V+      +   ++ L K G +
Sbjct: 220 SLSEDLRNEINSISKLREKRGRAKFRIGIPKFNLSKNSVNETIRTCFIGFLDTLMKQGHE 279

Query: 330 VVEVDFEPLLELARCLY------EGAWVAERYE----ATRDFFAKNPSESSLDPTVTK-- 377
           +  V+  P ++ A  +Y      E      RY+     TRD      +ES    T +K  
Sbjct: 280 IFPVEL-PSMKYALPVYYTIAPSEAVSNLARYDGIRYGTRDEKEDISNESFFSSTRSKFG 338

Query: 378 ------IIKGGANYDAADAFRYEYKRQGILQKVSKLLETIDVLCVP---TCPHNPTFAQL 428
                 +I G  N   +++F+  + +   L +VS + E  ++   P   T   N     L
Sbjct: 339 KEVQRRLILGNYNL-ISESFKNNFLKAQTL-RVSLINEFDNIFSFPNVLTRNQNDDINGL 396

Query: 429 EAM--PVEMNSRQGT----------------------WTNFVNLADLAALAVPCGFRSDG 464
           + +  P  +N  +G                       +T  V+LA L AL +P   R+  
Sbjct: 397 DFLLSPTSVNLPKGIDEIAKEKGYDGTSSTNEYMNDLFTIPVSLAGLPALTIPAKKRA-- 454

Query: 465 LPTGITLIGKTFTDYALLELANR 487
            P GI LIG+   D  +L  A +
Sbjct: 455 -PIGIQLIGQYGDDQNVLNFAEK 476

>ABR140C [732] [Homologous to ScYMR293C - SH] (662185..663576) [1392
           bp, 463 aa]
          Length = 463

 Score = 94.4 bits (233), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 99/204 (48%), Gaps = 10/204 (4%)

Query: 109 ELPLYGVPIAVKDNIDATGCETTAACPEFA-YTPSNDSTVVALLRDAGAIVIGKTNLDQF 167
           E PL  + + +KDNI      TT +    A Y    D+TVV LL +AGA+  GKTN+D+F
Sbjct: 36  EKPLGNLVVGIKDNIVTKKLPTTCSSGVLAGYMSPYDATVVELLDEAGAVTAGKTNMDEF 95

Query: 168 ATGLVGTRSPYGKT--PCVFSNEHXXXXXXXXXXXXXXXXIVPLALGTDTAGSGRVPAAL 225
             G  G  S +G T  P                       +V  ALGTDT GS R+PAA 
Sbjct: 96  GMGSGGIHSFFGPTLNPAFPERPTVAGGSSSGSAAAVAAGVVDFALGTDTGGSVRMPAAY 155

Query: 226 NNLIGLKPSKGVFSCSGVVPACKSLDCVSIFALNLGDAERCFKVMAQ-----PDTEKDEY 280
            + +G KPS G  S  GV+   +SLD V I A ++G   R F+V+ +     P +  DE 
Sbjct: 156 TSTVGFKPSYGRVSRHGVIAYAQSLDTVGIGARDVGLVRRVFEVLDRHDPKDPTSLPDEL 215

Query: 281 SRAMPANPLQKYAKDATIAVPTKL 304
            +   A  L++  K   I +P +L
Sbjct: 216 RQQAAA--LRREKKHLKIGIPAEL 237

>Kwal_23.4249
          Length = 465

 Score = 94.4 bits (233), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 68/191 (35%), Positives = 94/191 (49%), Gaps = 7/191 (3%)

Query: 99  RILQSKGDKKELPLYGVPIAVKDNIDATGCETTAACPEFA-YTPSNDSTVVALLRDAGAI 157
           R+ Q      E PL  +   +KDNI      T+        +    ++TVV LL  AGA+
Sbjct: 33  RLSQGSSADDEKPLKNILCGIKDNIATKELPTSCGSKILKDFQSPFNATVVDLLEGAGAV 92

Query: 158 VIGKTNLDQFATGLVGTRSPYGKT--PCVFSNEHXXXXXXXXXXXXXXXXIVPLALGTDT 215
            +GKTN+D+F  G  GT S +G T  P   S+                  +V  A+GTDT
Sbjct: 93  TVGKTNMDEFGMGSGGTHSHFGPTRNPQFPSDNVIAGGSSSGSAAAVAADVVDFAIGTDT 152

Query: 216 AGSGRVPAALNNLIGLKPSKGVFSCSGVVPACKSLDCVSIFALNLGDAERCFKVMAQPD- 274
            GS R+PAA  +++G KPS G  S  GVV   +SLD V I A ++   ++ FKV+ + D 
Sbjct: 153 GGSVRLPAAYTSVMGFKPSYGRISRHGVVAYAQSLDTVGILAKDIDIVQQVFKVLDKYDW 212

Query: 275 ---TEKDEYSR 282
              T  DE SR
Sbjct: 213 KDPTSLDETSR 223

>KLLA0A09845g complement(862467..863876) similar to sp|Q03557
           Saccharomyces cerevisiae YMR293c, start by similarity
          Length = 469

 Score = 93.2 bits (230), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 112/423 (26%), Positives = 168/423 (39%), Gaps = 46/423 (10%)

Query: 104 KGDKKELPLYGVPIAVKDNIDATGCETTAACPEF-AYTPSNDSTVVALLRDAGAIVIGKT 162
           K    + PL     A+KDNI      +T A      Y    D+TVV+LL +AG ++ GK 
Sbjct: 39  KNTTADKPLNYTLAAIKDNIATKNMPSTCASKILDGYMSPFDATVVSLLLEAGTVIAGKA 98

Query: 163 NLDQFATGLVGTRSPYGKT-PCVFSNEHXXXXXXXXXXXXXXXXIVP--LALGTDTAGSG 219
           N+D+F  G  G  S +G T   +F ++                       ALGTDT GS 
Sbjct: 99  NMDEFGMGSAGIHSHFGPTFNPLFDHKDRVIAGGSSSGSAAAVASGVVDFALGTDTGGSV 158

Query: 220 RVPAALNNLIGLKPSKGVFSCSGVVPACKSLDCVSIFALNLGDAERCFKVMAQPDTEKDE 279
           R+PA+  +  G KPS G  S  GV+   +SLD V +FA +L   +R F ++ + D +KD 
Sbjct: 159 RLPASYTSTFGFKPSYGRLSRHGVISYAQSLDTVGVFANDLSMIDRVFSLLDKHD-KKDP 217

Query: 280 YSRA----MPANPLQKYAKDATIAVPTKLPWYDETENF-VHYAAAIENLKKTGAKVVEVD 334
            S +         L    K   I +P +         F     A I+ L K G +V  V 
Sbjct: 218 TSLSEELRHKFTSLTTKRKTLRIGIPEEFSQESVPAEFRAAMTAIIKRLMKKGHEVYPVS 277

Query: 335 FEPLLELARCLYEGAWVAE------RYEATR----------DFFAKNPSESSLDPTV-TK 377
             P ++ A  +Y     AE      RY+  R          D     P+ S+  P V  +
Sbjct: 278 I-PSVKNALSIYYTLSPAEAVSNLSRYDGVRYGYRAESDVEDGTLFTPTRSAFGPEVQNR 336

Query: 378 IIKGG---------ANYDAADAFRYE--------YKRQGILQKVSKLLETIDVLCVPTCP 420
           II G           NY  A   R +        ++   +L   S   + +D++   T  
Sbjct: 337 IILGNYNLCSESFKNNYIKAQKLRVQLINDFDRAFRFPNVLSGNSVNKDGVDIMLSLTST 396

Query: 421 HNPTFAQLEAMPVEMNSRQGTWTNFVNLADLAALAVPCGFRSDGLPTGITLIGKTFTDYA 480
             PT    E +  E  +   T+ N +    ++   +P      G   GI +  +   DY 
Sbjct: 397 SFPTTYD-EVVSEENKNPLNTYINDIFTMPMSLCGLPTMTVPAGHAFGIQVFSQHGNDYE 455

Query: 481 LLE 483
           LL+
Sbjct: 456 LLD 458

>YMR293C (YMR293C) [4247] chr13 complement(855398..856792) Protein
           with similarity to amidases, may be involved in
           mitochondrial function [1395 bp, 464 aa]
          Length = 464

 Score = 89.0 bits (219), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 115/443 (25%), Positives = 178/443 (40%), Gaps = 69/443 (15%)

Query: 98  WRILQSKGDKKELPLYGVPIAVKDNIDATGCETTAACPEFA-YTPSNDSTVVALLRDAGA 156
           + I   KG K+ L   G   ++KDNI      TT A      +    D+TVV LL+ AG 
Sbjct: 32  YSITNKKGTKETLT--GCVASIKDNIVTKDFPTTCASHILENFKSPFDATVVKLLKQAGV 89

Query: 157 IVIGKTNLDQFATGLVGTRSPYGKTPCV-----FSNEHXXXXXXXXXXXXXXXXIVPLAL 211
            ++GKTNLD+F  G  G  S  G  P +       ++                 +V  AL
Sbjct: 90  HILGKTNLDEFGMGSGGVHSIRG--PVINPLYPHEDKKIMGGSSSGAAASVACDLVDFAL 147

Query: 212 GTDTAGSGRVPAALNNLIGLKPSKGVFSCSGVVPACKSLDCVSIFALNLGDAERCFKVMA 271
           GTDT GS R+PA   +++G KPS G  S  GV+   +SLD V I +  +    + F  + 
Sbjct: 148 GTDTGGSVRLPACYGSVLGFKPSYGRLSRFGVIAYSQSLDTVGILSKKINVLRKVFHTLD 207

Query: 272 QPDTEKDEYSRAMPANPLQKYAKDATIAVPTKLPWYDETENFVH----------YAAAIE 321
           + D  KD  S ++    L +  K   +  P K+    E   F H          Y + +E
Sbjct: 208 KYDM-KDPTSLSVELRELIEGNKK--VRRPLKVGIVKE---FSHESMPIGFHRLYLSLLE 261

Query: 322 NLKKTGAKVVEVDFEPLLELARCLY-----EGAWVAERYEATR-----------DFFAKN 365
            L   G ++  V    +       Y     E A    RY+  R           D     
Sbjct: 262 KLINLGLEIYPVSIPSVKNCLPIYYTLSPAEAASNLSRYDGIRYGYRDSELDIKDGILFA 321

Query: 366 PSESSLDPTV-TKIIKGGANYDAADAFRYEYKR------------QGILQKVSKLLET-- 410
           P+ S     V  +II G  N   +DAF+  + +             GI +  + L  +  
Sbjct: 322 PTRSKFGTEVKNRIILGNYNL-CSDAFKNNFIKAEKLRVNLIDEFDGIFRFPNVLTNSKG 380

Query: 411 ----IDVLCVPTCPHNP----TFAQLEAMPVEMNSRQGTWTNFVNLADLAALAVPCGFRS 462
               +D+L VPT    P     F + EA     +     +T  ++LA L +L++P   ++
Sbjct: 381 NPDGLDLLIVPTSSKLPGSIRDFEEEEAKSPANSYINDVFTVPMSLAGLPSLSMPLKEKT 440

Query: 463 DGLPTGITLIGKTFTDYALLELA 485
              P G+ ++G+   D  +L+  
Sbjct: 441 ---PIGLQVVGQYGDDSTVLDFV 460

>CAGL0M13585g complement(1335488..1336891) similar to sp|Q03557
           Saccharomyces cerevisiae YMR293c, hypothetical start
          Length = 467

 Score = 86.3 bits (212), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 60/173 (34%), Positives = 83/173 (47%), Gaps = 9/173 (5%)

Query: 112 LYGVPIAVKDNIDATGCETTAACPEF-AYTPSNDSTVVALLRDAGAIVIGKTNLDQFATG 170
           L G+   +KDNI      TT        Y    D+TVV LL+  G+IV+GKTNLD+F  G
Sbjct: 39  LSGLLCGIKDNIVTKDMPTTCGSEILRGYQSPYDATVVKLLKQEGSIVLGKTNLDEFGMG 98

Query: 171 LVGTRSPYGKT-----PCVFSNEHXXXXXXXXXXXXXXXXIVPLALGTDTAGSGRVPAAL 225
             G  S +G T     P   +++                  V  +LGTDT GS R+PA  
Sbjct: 99  SRGIHSCFGPTFNPLYPA--ADKVIMGGSSSGSAAAVVSEAVDFSLGTDTGGSVRLPATY 156

Query: 226 NNLIGLKPSKGVFSCSGVVPACKSLDCVSIFALNLGDAERCFKVMAQPDTEKD 278
            ++ G KPS G  S  GV+   +SLD V I   N+    + + V+ + D +KD
Sbjct: 157 GSIYGFKPSYGRISRYGVIAYAQSLDTVGILTKNISTLRKVYHVLDKYD-DKD 208

>Kwal_56.22295
          Length = 583

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 67/211 (31%), Positives = 97/211 (45%), Gaps = 17/211 (8%)

Query: 111 PLYGVPIAVKDNIDATGCETTAACPEFAYTPS---NDSTVVALLRDAGAIVIGKTNLDQF 167
           PL+G+P  VKDN  AT  +    C  +A   S    D+ VVA LRDAGA++ G   L ++
Sbjct: 131 PLHGIPFVVKDNY-ATKDKMDTTCGSWALLGSVVPRDAHVVAKLRDAGAVLFGHATLSEW 189

Query: 168 A-----TGLVGTRSPYGKTPCVFSNEHXXXXXXXXXXXXXXXXIVPLALGTDTAGSGRVP 222
           A     +   G  +  G+  C F+                   ++P +LGT+T GS   P
Sbjct: 190 ADMRSSSYSEGYSARGGQARCPFNLSVNPGGSSSGSAAAVAANMIPFSLGTETDGSIIDP 249

Query: 223 AALNNLIGLKPSKGVFSCSGVVPACKSLDCVSIFALNLGDAERCFKVMAQPDTEKDEYSR 282
           A  N ++G KP+ G+ S +GVVP  +  D     A ++ DA   F+ M   D E+D Y+ 
Sbjct: 250 AMRNGIVGFKPTVGLTSRAGVVPESEHQDSTGPMARSVRDAVYAFQYMWGVD-ERDVYTL 308

Query: 283 AMPANPLQ-----KYA--KDATIAVPTKLPW 306
               +  +     KY   KDA       LPW
Sbjct: 309 NQTGHVPEDGDYLKYLSNKDALKGAKFGLPW 339

>Scas_721.66
          Length = 573

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/149 (32%), Positives = 71/149 (47%), Gaps = 4/149 (2%)

Query: 92  EHLEHQWRILQSKGDKKELP-LYGVPIAVKDNIDATGCETTAACPEFAYTPS---NDSTV 147
           E LEH   + Q+K +   LP LYG+PI++KD  +  G +TT      A+ P    ++S +
Sbjct: 121 EALEHSKILDQNKYEYSTLPPLYGIPISLKDQCNVEGVDTTLGYLSRAFKPKKKEDESLI 180

Query: 148 VALLRDAGAIVIGKTNLDQFATGLVGTRSPYGKTPCVFSNEHXXXXXXXXXXXXXXXXIV 207
           V+ LRD GAI+  KT +         T + +G T   F+                     
Sbjct: 181 VSFLRDLGAIIYVKTTVPPSMMATETTSNTFGYTYNSFNQHFSAGGSSGGEGSLIGCYGS 240

Query: 208 PLALGTDTAGSGRVPAALNNLIGLKPSKG 236
            L LGTD  GS R+PA+ + + G KPS G
Sbjct: 241 VLGLGTDIGGSIRIPASYHGIFGFKPSTG 269

>Sklu_2417.11 , Contig c2417 20071-21846
          Length = 591

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 83/179 (46%), Gaps = 10/179 (5%)

Query: 111 PLYGVPIAVKDNIDATGCETTAACPEFAYTPS---NDSTVVALLRDAGAIVIGKTNLDQF 167
           PL+G+P  VKDN  AT  +       ++   S    D+ VV  LRDAGA++ G   + ++
Sbjct: 140 PLHGIPFVVKDNY-ATKDKMDTTAGSWSLMGSVVPRDAYVVEKLRDAGAVLFGHATMSEW 198

Query: 168 A-----TGLVGTRSPYGKTPCVFSNEHXXXXXXXXXXXXXXXXIVPLALGTDTAGSGRVP 222
           A     +   G  +  G+  C F+                   ++  +LGT+T GS   P
Sbjct: 199 ADMRSNSYSEGYSARGGQARCPFNLTVNPGGSSSGSAGSVAANMIMFSLGTETDGSIIDP 258

Query: 223 AALNNLIGLKPSKGVFSCSGVVPACKSLDCVSIFALNLGDAERCFKVMAQPDTEKDEYS 281
           A  N ++G KP+ G+ S +GV+P  +  D     A  + DA   F+ M   D E+D Y+
Sbjct: 259 AMRNGIVGFKPTVGLTSRAGVIPESEHQDSTGPMARTVKDAVYVFQSMWGVD-ERDAYT 316

>Sklu_2417.10 , Contig c2417 20071-21846
          Length = 591

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 83/179 (46%), Gaps = 10/179 (5%)

Query: 111 PLYGVPIAVKDNIDATGCETTAACPEFAYTPS---NDSTVVALLRDAGAIVIGKTNLDQF 167
           PL+G+P  VKDN  AT  +       ++   S    D+ VV  LRDAGA++ G   + ++
Sbjct: 140 PLHGIPFVVKDNY-ATKDKMDTTAGSWSLMGSVVPRDAYVVEKLRDAGAVLFGHATMSEW 198

Query: 168 A-----TGLVGTRSPYGKTPCVFSNEHXXXXXXXXXXXXXXXXIVPLALGTDTAGSGRVP 222
           A     +   G  +  G+  C F+                   ++  +LGT+T GS   P
Sbjct: 199 ADMRSNSYSEGYSARGGQARCPFNLTVNPGGSSSGSAGSVAANMIMFSLGTETDGSIIDP 258

Query: 223 AALNNLIGLKPSKGVFSCSGVVPACKSLDCVSIFALNLGDAERCFKVMAQPDTEKDEYS 281
           A  N ++G KP+ G+ S +GV+P  +  D     A  + DA   F+ M   D E+D Y+
Sbjct: 259 AMRNGIVGFKPTVGLTSRAGVIPESEHQDSTGPMARTVKDAVYVFQSMWGVD-ERDAYT 316

>Sklu_1884.2 YDR242W, Contig c1884 1484-3124 reverse complement
          Length = 546

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 64/141 (45%), Gaps = 3/141 (2%)

Query: 99  RILQSKGDKKELPLYGVPIAVKDNIDATGCETTAACPEFAYTP---SNDSTVVALLRDAG 155
           ++L  +   K LPLYG+PI++KD  +  G +TT      A+ P   + +S +V  L+D G
Sbjct: 107 KLLDERKPDKLLPLYGIPISLKDQCNVAGYDTTLGYLGRAFKPKTAAEESLLVKFLKDLG 166

Query: 156 AIVIGKTNLDQFATGLVGTRSPYGKTPCVFSNEHXXXXXXXXXXXXXXXXIVPLALGTDT 215
           A++  KT +           + +G T    +                      L +GTD 
Sbjct: 167 AVLYVKTTVPSSMMASETVSNTFGYTLNSVNTNFSSGGSSGGEGSLIGCYGSILGIGTDI 226

Query: 216 AGSGRVPAALNNLIGLKPSKG 236
            GS R+P++   L GL+P+ G
Sbjct: 227 GGSIRIPSSFQGLFGLRPTHG 247

>YDR242W (AMD2) [1076] chr4 (946799..948448) Protein with similarity
           to amidases [1650 bp, 549 aa]
          Length = 549

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 59/129 (45%), Gaps = 3/129 (2%)

Query: 111 PLYGVPIAVKDNIDATGCETTAA--CPEFA-YTPSNDSTVVALLRDAGAIVIGKTNLDQF 167
           PLYG+PI++KD  +  G +T+    C  F   T + +S +V+ LRD GAI+  KT +   
Sbjct: 123 PLYGIPISLKDQCNVEGVDTSLGYLCRTFKPKTKNEESLIVSFLRDLGAIIFVKTTVPSS 182

Query: 168 ATGLVGTRSPYGKTPCVFSNEHXXXXXXXXXXXXXXXXIVPLALGTDTAGSGRVPAALNN 227
                   + +G T    +                      L LGTD  GS R+P++   
Sbjct: 183 MMATDTQSNTFGYTYNSINLSFSSGGSSGGEGSLIGAHGSLLGLGTDIGGSIRIPSSYQG 242

Query: 228 LIGLKPSKG 236
           L GLKP+ G
Sbjct: 243 LFGLKPTFG 251

>Kwal_34.15724
          Length = 556

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 58/126 (46%), Gaps = 1/126 (0%)

Query: 112 LYGVPIAVKDNIDATGCETTAACPEFAYTPSNDSTVVA-LLRDAGAIVIGKTNLDQFATG 170
           L+GVPI++KD ++  G ETT        + S   +++A +L+D GAI   KT +      
Sbjct: 124 LHGVPISLKDQVNLPGIETTIGYISKVGSKSEKVSLLARVLQDQGAIFYVKTAVPTAMLA 183

Query: 171 LVGTRSPYGKTPCVFSNEHXXXXXXXXXXXXXXXXIVPLALGTDTAGSGRVPAALNNLIG 230
                S +G+T    +                     PL +GTD  GS R+PAA   L G
Sbjct: 184 SETVSSLHGRTLNAVNIAFSSGGSSGGEGSLIGARGSPLGVGTDIGGSIRIPAAFQGLYG 243

Query: 231 LKPSKG 236
           L+PS G
Sbjct: 244 LRPSHG 249

>KLLA0E15444g 1370741..1377427 highly similar to sp|P07259
            Saccharomyces cerevisiae YJL130c URA2 multifunctional
            pyrimidine biosynthesis protein, start by similarity
          Length = 2228

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 82/182 (45%), Gaps = 11/182 (6%)

Query: 805  EAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERF 864
            EA + A+ + YPV+V+ +    G  +  V S++D+E          + Y     V + ++
Sbjct: 1118 EAEDFAEKVSYPVLVRPSYVLSGAAMNTVYSKDDLESYLNQAVEVSREY----PVVITKY 1173

Query: 865  VENARHVEIQMMG-DGKGKAIAIGER--DCSLQRRNQKVIEETPAPNLSEKTRARMREAS 921
            +ENA+ +E+  +  DG+     + E   +  +   +  +I   P  +L  +T  R+ EA+
Sbjct: 1174 IENAKEIEMDAVALDGELIMHVVSEHVENAGVHSGDATLI--VPPQDLDPETVRRIVEAT 1231

Query: 922  ENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAG 981
              +G  L+      ++FI   + +E   +E N R     P    V G++L+E       G
Sbjct: 1232 AKIGRALQITGPYNIQFI--AKNNEIKVIECNVRASRSFPFISKVVGVNLIEMATKAIMG 1289

Query: 982  TP 983
             P
Sbjct: 1290 IP 1291

 Score = 39.7 bits (91), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 55/264 (20%), Positives = 102/264 (38%), Gaps = 41/264 (15%)

Query: 811  KALEYPVMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENARH 870
            K + +PV+V++    GG+G     +E+      E V     A+     V +ER ++  + 
Sbjct: 587  KDIGFPVIVRAAYALGGLGSGFASNEK------ELVDLCNVAFASSPQVLVERSMKGWKE 640

Query: 871  VEIQMMGDGKGKAIAIGERDCSLQRRNQKVIEE------TPAPNLSEKTRARMREASENL 924
            +E +++ D     I +    C+++  +   I         P+  LS++    +R  + N+
Sbjct: 641  IEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVIAPSQTLSDEDYNMLRTTAVNV 696

Query: 925  GSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAGTPP 984
               L       +++  +    E+  +EVNARL     +    TG  L      +    P 
Sbjct: 697  IRHLGVVGECNIQYALNPTSKEYCIIEVNARLSRSSALASKATGYPLAYTAAKLGLNIP- 755

Query: 985  DFDATKITVTGASIEARLYAENPVKDFRPSPGQLTDVSFPEW-----ARVDTWVSKGTTI 1039
                 K +VT ++             F PS      V  P W      RV T +S     
Sbjct: 756  -LYEVKNSVTRSTCAC----------FEPSLDYCV-VKMPRWDLKKFTRVSTLLSSSMK- 802

Query: 1040 SAEYDPTLAKIIVHGKDRDEAIQK 1063
                  ++ +++  G+  +EAIQK
Sbjct: 803  ------SVGEVMSIGRTFEEAIQK 820

>ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH] (827830..834552)
            [6723 bp, 2240 aa]
          Length = 2240

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 82/183 (44%), Gaps = 11/183 (6%)

Query: 804  QEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLER 863
            +EA + A  + YPV+V+ +    G  +  V S++D+E          + Y     V + +
Sbjct: 1135 EEAEDFANKVGYPVLVRPSYVLSGAAMNTVYSKDDLESYLNQAVEVSREY----PVVITK 1190

Query: 864  FVENARHVEIQMMG-DGKGKAIAIGER--DCSLQRRNQKVIEETPAPNLSEKTRARMREA 920
            ++ENA+ +E+  +  DG+     + E   +  +   +  +I   P  +L  +T  R+ +A
Sbjct: 1191 YIENAKEIEMDAVAKDGEMIMHVVSEHVENAGVHSGDATLI--VPPQDLDPETVRRIVDA 1248

Query: 921  SENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAA 980
            +  +G  LK      ++FI   + +E   +E N R     P    V G++L+E       
Sbjct: 1249 TAKIGRALKITGPYNIQFI--AKNNEIKVIECNVRASRSFPFISKVIGVNLIEMATKAIM 1306

Query: 981  GTP 983
            G P
Sbjct: 1307 GIP 1309

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 81/371 (21%), Positives = 139/371 (37%), Gaps = 59/371 (15%)

Query: 726  IDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGIVFVGPAGDAI-----RKLGLKH 780
            + K+I   +         G   LS   +  D   + G+  +G + D I     R+L   +
Sbjct: 521  VRKVILHERPDAIYVTFGGQTALSVGIEMKDEFEALGVKVLGTSIDTIITTEDREL-FAN 579

Query: 781  SAREIAEKAGVPLVPGSGLVKTPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIE 840
            +  EI EK        S    T  EA E  K + +PV+V++    GG+G     +E+   
Sbjct: 580  AMDEINEKCA-----KSKAASTVDEALEAVKDIGFPVIVRAAYALGGLGSGFASNEQ--- 631

Query: 841  RVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKAIAIGERDCSLQR----- 895
               E V     A+     V +ER ++  + VE +++ D     I +    C+++      
Sbjct: 632  ---ELVDLCNVAFASSPQVLVERSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLG 684

Query: 896  -RNQKVIEETPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNA 954
                  I   P+  LS++    +R  + N+   L       +++  +    E+  +EVNA
Sbjct: 685  IHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNA 744

Query: 955  RLQVEHPITEMVTGLDLVEWMLLIAAGTPPDFDATKITVTGASIEARLYAENPVKDFRPS 1014
            RL     +    TG  L      +    P   +  K +VT ++             F PS
Sbjct: 745  RLSRSSALASKATGYPLAYTAAKLGLNIP--LNEVKNSVTQSTCAC----------FEPS 792

Query: 1015 PGQLTDVSFPEW-----ARVDTWVSKGTTISAEYDPTLAKIIVHGKDRDEAIQKL----- 1064
                  V  P W      RV T +S           ++ +++  G+  +EAIQK      
Sbjct: 793  LDYCV-VKMPRWDLKKFTRVSTLLSSSMK-------SVGEVMSVGRTFEEAIQKAIRSTD 844

Query: 1065 --NQALNETSI 1073
              N   NET +
Sbjct: 845  YSNLGFNETDM 855

>CAGL0L05676g 619734..626369 highly similar to sp|P07259 Saccharomyces
            cerevisiae YJL130c URA2, start by similarity
          Length = 2211

 Score = 54.7 bits (130), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 59/296 (19%), Positives = 128/296 (43%), Gaps = 21/296 (7%)

Query: 691  SVAVYSDPDKYSQHVTDADVAVALKGRTAAETYLDIDKIIAAAKETGTEAIIPGYGFLSE 750
            ++ +  +P+  S    +AD       R   ET +++++++   +   +  ++   G  + 
Sbjct: 1014 TIMINYNPETVSTDYDEAD-------RLYFET-INLERVLDIYEAEASNGVVVSMGGQTS 1065

Query: 751  NADFSDRCASEGIVFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGSGLVKTPQEAREIA 810
            N + +     E +  +G + D I     ++    + ++ GV   P    + +  EA + A
Sbjct: 1066 N-NIAMSLHRENVKILGTSPDMIDSAENRYKFSRMLDQIGVDQ-PAWKELTSMDEAEDFA 1123

Query: 811  KALEYPVMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENARH 870
            + + YPV+V+ +    G  +  V S+ D+E       +Q      D  V + +++ENA+ 
Sbjct: 1124 EKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYL----NQAVEVSRDYPVVITKYIENAKE 1179

Query: 871  VEIQMMG-DGKGKAIAIGER--DCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGSL 927
            +E+  +  +G+     + E   +  +   +  +I   P  +L+ +T  R+  A+  +G  
Sbjct: 1180 IEMDAVARNGELVMHVVSEHVENAGVHSGDATLI--VPPQDLAPETVDRIVVATAKIGKA 1237

Query: 928  LKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAGTP 983
            LK      ++FI   + +E   +E N R     P    V G++L+E       G P
Sbjct: 1238 LKITGPYNIQFI--AKDNEIKVIECNVRASRSFPFISKVVGVNLIELATKAIMGLP 1291

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 75/352 (21%), Positives = 135/352 (38%), Gaps = 48/352 (13%)

Query: 726  IDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGIVFVGPAGDAI-----RKLGLKH 780
            + K+I   +         G   LS   +  D   S G+  +G   D I     R+L   +
Sbjct: 503  VRKVILHERPDAIYVTFGGQTALSVGIEMKDEFESLGVKVLGTPIDTIITTEDREL-FAN 561

Query: 781  SAREIAEKAGVPLVPGSGLVKTPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIE 840
            +  EI EK        S    + +EA    K + +PV+V++    GG+G    ++E+   
Sbjct: 562  AIDEIDEKCA-----KSQAANSVEEALAAVKDIGFPVIVRAAYALGGLGSGFANNEQ--- 613

Query: 841  RVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKAIAIGERDCSLQR----- 895
               E +     A+     V +ER ++  + VE +++ D     I +    C+++      
Sbjct: 614  ---ELIDLCNVAFASSPQVLVERSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLG 666

Query: 896  -RNQKVIEETPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNA 954
                  I   P+  LS++    +R  + N+   L       +++  +    E+  +EVNA
Sbjct: 667  IHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNA 726

Query: 955  RLQVEHPITEMVTGLDLVEWMLLIAAGTPPDFDATKITVTGASIEARLYAENPVKDFRPS 1014
            RL     +    TG  L      +    P   +  K +VT ++             F PS
Sbjct: 727  RLSRSSALASKATGYPLAYTAAKLGLNIP--LNEVKNSVTKSTCAC----------FEPS 774

Query: 1015 PGQLTDVSFPEWARVDTWVSKGTTISAEYDPTL---AKIIVHGKDRDEAIQK 1063
                  V  P W      + K T +S E   ++    +++  G+  +EAIQK
Sbjct: 775  LDYCV-VKMPRWD-----LKKFTRVSTELSSSMKSVGEVMSIGRTFEEAIQK 820

>YJL130C (URA2) [2788] chr10 complement(165641..172285)
            Multifunctional protein of pyrimidine biosynthesis
            pathway, contains glutamine amidotransferase,
            glutamine-dependent carbamylphosphate synthetase
            (CPSase), dihydroorotase-like (DHOase) domain, and
            aspartate carbamyltransferase (ATCase) [6645 bp, 2214 aa]
          Length = 2214

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 68/297 (22%), Positives = 125/297 (42%), Gaps = 23/297 (7%)

Query: 691  SVAVYSDPDKYSQHVTDADVAVALKGRTA-AETYLDIDKIIAAAKETGTEAIIPGYGFLS 749
            ++ V  +P+  S   TD D A  L   T   E  LDI +I     E  +  ++   G  S
Sbjct: 1016 TIMVNYNPETVS---TDYDEADRLYFETINLERVLDIYEI-----ENSSGVVVSMGGQTS 1067

Query: 750  ENADFSDRCASEGIVFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGSGLVKTPQEAREI 809
             N   +     E +  +G + D I     ++    + ++ GV   P    + +  EA   
Sbjct: 1068 NNIAMT--LHRENVKILGTSPDMIDSAENRYKFSRMLDQIGVDQ-PAWKELTSMDEAESF 1124

Query: 810  AKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENAR 869
            A+ + YPV+V+ +    G  +  V S+ D+E       +Q      D  V + +++ENA+
Sbjct: 1125 AEKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYL----NQAVEVSRDYPVVITKYIENAK 1180

Query: 870  HVEIQMMG-DGKGKAIAIGER--DCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGS 926
             +E+  +  +G+     + E   +  +   +  +I   P  +L+ +T  R+  A+  +G 
Sbjct: 1181 EIEMDAVARNGELVMHVVSEHVENAGVHSGDATLI--VPPQDLAPETVDRIVVATAKIGK 1238

Query: 927  LLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAGTP 983
             LK      ++FI   + +E   +E N R     P    V G++L+E       G P
Sbjct: 1239 ALKITGPYNIQFI--AKDNEIKVIECNVRASRSFPFISKVVGVNLIELATKAIMGLP 1293

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 80/378 (21%), Positives = 142/378 (37%), Gaps = 58/378 (15%)

Query: 726  IDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGIVFVGPAGDAI-----RKLGLKH 780
            + K+I   +         G   LS      D   + G+  +G   D I     R+L   +
Sbjct: 505  VRKVILHERPDAIYVTFGGQTALSVGIAMKDEFEALGVKVLGTPIDTIITTEDREL-FSN 563

Query: 781  SAREIAEKAGVPLVPGSGLVKTPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIE 840
            +  EI EK        S    +  EA    K + +PV+V++    GG+G    ++E+   
Sbjct: 564  AIDEINEKCA-----KSQAANSVDEALAAVKEIGFPVIVRAAYALGGLGSGFANNEK--- 615

Query: 841  RVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKAIAIGERDCSLQR----- 895
               E V     A+     V +E+ ++  + VE +++ D     I +    C+++      
Sbjct: 616  ---ELVDLCNVAFSSSPQVLVEKSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLG 668

Query: 896  -RNQKVIEETPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNA 954
                  I   P+  LS++    +R  + N+   L       +++  +    ++  +EVNA
Sbjct: 669  IHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPVSKDYCIIEVNA 728

Query: 955  RLQVEHPITEMVTGLDLVEWMLLIAAGTPPDFDATKITVTGASIEARLYAENPVKDFRPS 1014
            RL     +    TG  L      +    P   +  K +VT ++             F PS
Sbjct: 729  RLSRSSALASKATGYPLAYTAAKLGLNIP--LNEVKNSVTKSTCAC----------FEPS 776

Query: 1015 PGQLTDVSFPEWARVDTWVSKGTTISAEYDPTL---AKIIVHGKDRDEAIQK-------L 1064
                  V  P W      + K T +S E   ++    +++  G+  +EAIQK        
Sbjct: 777  LDYCV-VKMPRWD-----LKKFTRVSTELSSSMKSVGEVMSIGRTFEEAIQKAIRSTEYA 830

Query: 1065 NQALNETSIYGCITNIDY 1082
            N   NET +     +IDY
Sbjct: 831  NLGFNETDLD---IDIDY 845

>Kwal_33.14061
          Length = 2221

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 67/297 (22%), Positives = 124/297 (41%), Gaps = 23/297 (7%)

Query: 691  SVAVYSDPDKYSQHVTDADVAVALKGRTAA-ETYLDIDKIIAAAKETGTEAIIPGYGFLS 749
            S+ V  +P+  S   TD D A  L   T   E  LDI +I     E+    ++   G  S
Sbjct: 1016 SIMVNYNPETVS---TDYDEADRLYFETICLERILDIYEI-----ESSAGVVVSMGGQTS 1067

Query: 750  ENADFSDRCASEGIVFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGSGLVKTPQEAREI 809
             N   S     E +  +G   + I     ++    + ++ GV   P    + + +EA + 
Sbjct: 1068 NNIAMS--LHRENVKILGTTPEMIDSAENRYKFSRMLDQIGVDQ-PAWKELTSIEEAEQF 1124

Query: 810  AKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENAR 869
            A A+ +PV+V+ +    G  +  V S++D+        +Q      D  V + +++ENA+
Sbjct: 1125 ADAVSFPVLVRPSYVLSGAAMNTVYSKDDLASYL----NQAVEVSRDYPVVITKYIENAK 1180

Query: 870  HVEIQMMG-DGKGKAIAIGER--DCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGS 926
             +E+  +  DG+     + E   +  +   +  +I   P  +L  +T  R+  A+  +G 
Sbjct: 1181 EIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLI--VPPQDLDPETVERIVVATAKIGK 1238

Query: 927  LLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAGTP 983
             LK      ++FI   + ++   +E N R     P    V  ++L+E       G P
Sbjct: 1239 ALKITGPFNIQFI--AKNNDIKVIECNVRASRSFPFISKVVNVNLIEMATKAIMGLP 1293

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 86/399 (21%), Positives = 153/399 (38%), Gaps = 63/399 (15%)

Query: 726  IDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGIVFVGPAGDAI-----RKLGLKH 780
            + K+I   +         G   LS   +  D   + G+  +G   D +     R+L   +
Sbjct: 505  VRKVILHERPDAIYVTFGGQTALSVGIEMKDEFEALGVKVLGTPIDTVITTEDREL-FSN 563

Query: 781  SAREIAEKAGVPLVPGSGLVKTPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIE 840
            +  EI EK        S    T +EA E  K + +PV+ ++    GG+G    ++E+   
Sbjct: 564  AMDEINEKCA-----KSKAAATVEEALEAVKEIGFPVICRAAYALGGLGSGFANNEK--- 615

Query: 841  RVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKAIAIGERDCSLQR----- 895
               E V     A+     V +ER ++  + VE +++ D     I +    C+++      
Sbjct: 616  ---ELVDLCNIAFASSPQVLVERSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLG 668

Query: 896  -RNQKVIEETPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNA 954
                  I   P+  LS++    +R  + N+   L       +++  +    E+  +EVNA
Sbjct: 669  IHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNA 728

Query: 955  RLQVEHPITEMVTGLDLVEWMLLIAAGTPPDFDATKITVTGASIEARLYAENPVKDFRPS 1014
            RL     +    TG  L      +    P   +  + +VT ++             F PS
Sbjct: 729  RLSRSSALASKATGYPLAYTAAKLGLNIP--LNEVRNSVTQSTCAC----------FEPS 776

Query: 1015 PGQLTDVSFPEW-----ARVDTWVSKGTTISAEYDPTLAKIIVHGKDRDEAIQK------ 1063
                  V  P W     +RV T +S           ++ +++  G+  +EAIQK      
Sbjct: 777  LDYCV-VKMPRWDLKKFSRVSTALSSSMK-------SVGEVMSIGRTFEEAIQKAIRSTE 828

Query: 1064 -LNQALNETSIYGCITNIDYLRSIASSE-MFKTAKVATK 1100
             +N   NET +     +IDY  S  + E +F  A   +K
Sbjct: 829  YVNLGFNETDLD---VDIDYELSHPTDERIFAIANAFSK 864

>Sklu_2413.4 YJR109C, Contig c2413 10886-14254
          Length = 1122

 Score = 51.6 bits (122), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 48/218 (22%), Positives = 95/218 (43%), Gaps = 12/218 (5%)

Query: 761 EGIVFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGSGLVKTPQEAREIAKALEYPVMVK 820
           EG   +G + + I K   +H    I +  GV   P    + +  EA+  A  + YPV+++
Sbjct: 679 EGAKILGTSPEDIDKAENRHKFSSILDSIGVDQ-PEWKELTSVNEAKIFASKVGYPVLIR 737

Query: 821 STAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMG-DG 879
            +    G  +  V+SE+++E               D  V + +F+E A+ +++  +  DG
Sbjct: 738 PSYVLSGAAMSVVNSEDELEVKLTNASDVSP----DHPVVISKFIEGAQEIDVDAVAYDG 793

Query: 880 KGKAIAIGER--DCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGSLLKYRCAGTVE 937
           K    AI E   +  +   +  +I   P  +LSE+T+ R+++ ++ +           ++
Sbjct: 794 KVLVHAISEHVENAGVHSGDASLI--LPPQHLSEETKQRLKDIADKVAKAWNICGPFNMQ 851

Query: 938 FIYDERRD--EFYFLEVNARLQVEHPITEMVTGLDLVE 973
            I D+R        +E N R     P    V G++ ++
Sbjct: 852 IIKDDRDHGTSLKVIECNIRASRSFPFVSKVLGINFID 889

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 89/209 (42%), Gaps = 17/209 (8%)

Query: 801  KTPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVF 860
            +T  +A E A  ++YPV+V+S    GG+G    + E++++ +        ++      + 
Sbjct: 174  ETIDQALEAAAKVKYPVIVRSAYALGGLGSGFANDEQEMKEL------ASQSLSLAPQIL 227

Query: 861  LERFVENARHVEIQMMGDGKGKAIAIGERDCSLQRRNQKVIEE------TPAPNLSEKTR 914
            +E+ ++  + +E +++ D  G  I +    C+++  +   I         P+  LS++  
Sbjct: 228  VEKSLKGWKEIEYEVVRDRVGNCITV----CNMENFDPLGIHTGDSIVFAPSQTLSDEEF 283

Query: 915  ARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEW 974
              +R A+  +   L       V++       ++  +EVNARL     +    TG  L   
Sbjct: 284  HMLRSAAIKIIRHLGVVGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPLAYT 343

Query: 975  MLLIAAG-TPPDFDATKITVTGASIEARL 1002
               IA G T P+        T A+ E  L
Sbjct: 344  AAKIALGYTLPELPNPVTKTTVANFEPSL 372

>Scas_582.4*
          Length = 2193

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 66/297 (22%), Positives = 125/297 (42%), Gaps = 23/297 (7%)

Query: 691  SVAVYSDPDKYSQHVTDADVAVALKGRTA-AETYLDIDKIIAAAKETGTEAIIPGYGFLS 749
            ++ +  +P+  S   TD D A  L   T   E  LDI +I     E  +  ++   G  S
Sbjct: 991  TIMINYNPETVS---TDYDEADRLYFETINLERILDIYEI-----ENSSGVVVSMGGQTS 1042

Query: 750  ENADFSDRCASEGIVFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGSGLVKTPQEAREI 809
             N   S     E +  +G + + I     ++    + ++ GV   P    + +  EA   
Sbjct: 1043 NNIAMS--LHRENVKILGTSPEMIDSAENRYKFSRMLDQIGVDQ-PAWKELTSMDEAESF 1099

Query: 810  AKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENAR 869
            A+ + YPV+V+ +    G  +  V S+ D+        +Q      D  V + +++ENA+
Sbjct: 1100 AEKVGYPVLVRPSYVLSGAAMNTVYSKNDLASYL----NQAVEVSRDYPVVITKYIENAK 1155

Query: 870  HVEIQMMG-DGKGKAIAIGER--DCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGS 926
             +E+  +  +G+     + E   +  +   +  +I   P  +L+++T  R+  A+  +G 
Sbjct: 1156 EIEMDAVARNGELVMHVVSEHVENAGVHSGDATLI--VPPQDLAKETVDRIVVATAKIGK 1213

Query: 927  LLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAGTP 983
             LK      ++FI   + +E   +E N R     P    V G++L+E       G P
Sbjct: 1214 ALKITGPYNIQFI--AKDNEIKVIECNVRASRSFPFISKVVGVNLIELATKAVMGLP 1268

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 78/378 (20%), Positives = 142/378 (37%), Gaps = 58/378 (15%)

Query: 726  IDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGIVFVGPAGDAI-----RKLGLKH 780
            + K+I   +         G   LS   +  D   S G+  +G   D I     R+L   +
Sbjct: 500  VRKVILHERPDAIYVTFGGQTALSVGIEMKDEFESLGVKVLGTQIDTIITTEDREL-FAN 558

Query: 781  SAREIAEKAGVPLVPGSGLVKTPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIE 840
            +  EI EK        S    + +EA    K + +PV+V++    GG+G    ++E+   
Sbjct: 559  AIDEINEKCA-----KSHAANSVEEALTAVKDIGFPVIVRAAYALGGLGSGFANNEQ--- 610

Query: 841  RVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKAIAIGERDCSLQR----- 895
               E +     A+     V +ER ++  + +E +++ D     + +    C+++      
Sbjct: 611  ---ELIDLCNVAFASSPQVLVERSMKGWKEIEYEVVRDAFDNCVTV----CNMENFDPLG 663

Query: 896  -RNQKVIEETPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNA 954
                  I   P+  LS++    +R  + N+   L       +++  +    E+  +EVNA
Sbjct: 664  IHTGDSIVVAPSQTLSDEEYNMLRNTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNA 723

Query: 955  RLQVEHPITEMVTGLDLVEWMLLIAAGTPPDFDATKITVTGASIEARLYAENPVKDFRPS 1014
            RL     +    TG  L      +    P +     +T +  +             F PS
Sbjct: 724  RLSRSSALASKATGYPLAYTAAKLGLNIPLNEVINSVTKSTCAC------------FEPS 771

Query: 1015 PGQLTDVSFPEWARVDTWVSKGTTISAEYDPTL---AKIIVHGKDRDEAIQK-------L 1064
                  V  P W      + K T +S E   ++    +++  G+  +EAIQK        
Sbjct: 772  LDYCV-VKMPRWD-----LKKFTRVSTELSSSMKSVGEVMSIGRTFEEAIQKAIRSTEYA 825

Query: 1065 NQALNETSIYGCITNIDY 1082
            N   NET +     +IDY
Sbjct: 826  NLGFNETDLE---IDIDY 840

>Sklu_2331.1 YJL130C, Contig c2331 2029-8691
          Length = 2220

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/296 (19%), Positives = 126/296 (42%), Gaps = 21/296 (7%)

Query: 691  SVAVYSDPDKYSQHVTDADVAVALKGRTAAETYLDIDKIIAAAKETGTEAIIPGYGFLSE 750
            ++ V  +P+  S    +AD       R   ET +++++I+   +   +  ++   G  + 
Sbjct: 1016 TIMVNYNPETVSTDYDEAD-------RLYFET-INLERILDIYEAEASAGVVISMGGQTS 1067

Query: 751  NADFSDRCASEGIVFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGSGLVKTPQEAREIA 810
            N + +     E +  +G + + I     ++    + ++ GV   P    + +  EA   A
Sbjct: 1068 N-NIAMSLHREKVKILGTSPEMIDSAENRYKFSRMLDQIGVDQ-PAWKELTSIDEAEGFA 1125

Query: 811  KALEYPVMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENARH 870
            + + YPV+V+ +    G  +  V S++D+        +Q      D  V + +++ENA+ 
Sbjct: 1126 ENVGYPVLVRPSYVLSGAAMNTVYSKDDLASYL----NQAVEVSRDYPVVITKYIENAKE 1181

Query: 871  VEIQMMG-DGKGKAIAIGER--DCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGSL 927
            +E+  +  DG+     + E   +  +   +  +I   P  +L  +T  R+  A+  +G  
Sbjct: 1182 IEMDAVAKDGELVMHVVSEHVENAGVHSGDATLI--VPPQDLDPETVNRIVVATAKIGKA 1239

Query: 928  LKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAGTP 983
            LK      ++FI   + ++   +E N R     P    V G++L+E       G P
Sbjct: 1240 LKITGPYNIQFI--AKNNDIKVIECNVRASRSFPFISKVVGVNLIEMATKAVMGLP 1293

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 87/399 (21%), Positives = 147/399 (36%), Gaps = 69/399 (17%)

Query: 726  IDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGIVFVGPAGDAI-----RKLGLKH 780
            + K+I   +         G   LS   +  D   + G+  +G   D +     R+L   +
Sbjct: 505  VRKVILHERPDAIYVTFGGQTALSVGIEMKDEFETLGVKVLGTPIDTVITTEDREL-FSN 563

Query: 781  SAREIAEKAGVPLVPGSGLVKTPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIE 840
            +  EI EK        S    T +EA E  K + +PV+V++    GG+G     +E    
Sbjct: 564  AMDEINEKCA-----KSKAASTVKEALEAVKEIGFPVIVRAAYALGGLGSGFASNET--- 615

Query: 841  RVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKAIAIGERDCSLQR----- 895
               E V     A+     V +ER ++  + VE +++ D     I +    C+++      
Sbjct: 616  ---ELVDLCNVAFASSPQVLVERSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLG 668

Query: 896  -RNQKVIEETPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNA 954
                  I   P+  LS++    +R  + N+   L       +++  +    E+  +EVNA
Sbjct: 669  IHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNA 728

Query: 955  RLQVEHPITEMVTGLDLVEWMLLIAAGTPPDFDATKITVTGASIEARLYAENPVKDFRPS 1014
            RL     +    TG  L      +    P   +  K +VT ++             F PS
Sbjct: 729  RLSRSSALASKATGYPLAFIAAKLGLNIP--LNEVKNSVTKSTCAC----------FEPS 776

Query: 1015 PGQLTDVSFPEW-----ARVDTWVSKGTTISAEYDPTLAKIIVHGKDRDEAIQK------ 1063
                  V  P W      RV T +S           ++ +++  G+  +EAIQK      
Sbjct: 777  LDYCV-VKMPRWDLKKFTRVSTQLSSSMK-------SVGEVMSVGRTFEEAIQKAIRSTE 828

Query: 1064 -LNQALNETSIYGCITNIDY-------LRSIASSEMFKT 1094
              N   NE  +     +IDY       LR  A +  F T
Sbjct: 829  YANLGFNENDVE---LDIDYELTHPSDLRVFAIANAFAT 864

>Sklu_2072.3 , Contig c2072 3010-4362 reverse complement
          Length = 450

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 81/386 (20%), Positives = 142/386 (36%), Gaps = 60/386 (15%)

Query: 111 PLYGVPIAVKDNIDATGCETTAACPEFAYTPSN----DSTVVALLRDAGAIVIGKTNLDQ 166
           P++G+P+++K++    G  T A    F+    N    D+    + R AGA+   +T   Q
Sbjct: 28  PMHGLPLSLKEHYAYKGKTTNAG---FSSMIDNLTEEDALTTEIFRKAGAVFYIRTTQPQ 84

Query: 167 FATGLVGTRSPYGKTPCVFSNEHXXXXXXXXXXXXXXXXIVPLALGTDTAGSGRVPAALN 226
               L    +  G+     +                     PL  G+D  GS R PAA  
Sbjct: 85  SLMHLDSFNNITGRCRNPLNTLLSPGGSTSGEGALISLRGSPLGTGSDIGGSIRAPAAFC 144

Query: 227 NLIGLKPSKGVFSCSGVVPACKSLDCVSIFALNLGDAERC-FKVMAQPDTEKDEYSRAMP 285
           N+ G KP+    S  G   + + +           D   C    MA    + + Y +   
Sbjct: 145 NIWGFKPTNKRVSLQGAWASYRDMS---------NDMVLCSVGPMANTPEDLELYMKTFL 195

Query: 286 ANPLQKYAKDATIAVPTKLPWYDETENFVHYAAAI---ENLKKTGAKVVEVDFEPLLELA 342
            +  + + +D  +    +LPW +   +      AI   + + K    V+       LELA
Sbjct: 196 DS--EPWLRDNYV---IRLPWREVDLSLDKLKIAIVMDDGIVKPSPPVLRA-----LELA 245

Query: 343 RCLYEGAWVAE------------------RYEATRDFFAKNPSESSLDPTV------TKI 378
           +   E A VA+                   Y    +F  ++  E S +P         + 
Sbjct: 246 KKSLEKAGVAKCVEWVPFNTSEGLDICYTAYNCDGNFNHRSRYEESGEPLAPLSEHHMRF 305

Query: 379 IKGGANYDAADAFRYEYKRQGILQKVSKLLETIDVLCVPTCPHNPTFAQLEAMPVEMNSR 438
             G    D+ +  +Y +KR    Q+ + ++  IDV  V T    P +    A+P ++  +
Sbjct: 306 GCGDRGLDSLEMLQYLHKRDSYRQRFADMMNEIDVDYVLT----PAYFAPAAIPDKI--K 359

Query: 439 QGTWTNFVNLADLAALAVPCGFRSDG 464
              +T   N+ DL  ++ P G  +D 
Sbjct: 360 YWGYTALYNILDLPGVSFPTGVVTDA 385

>Kwal_55.19783
          Length = 1121

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 50/239 (20%), Positives = 104/239 (43%), Gaps = 14/239 (5%)

Query: 740 AIIPGYGFLSENADFSDRCASEGIVFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGSGL 799
           A+I   G L +N     +    G   +G + + I +   +H    I +  GV   P    
Sbjct: 660 AVISVGGQLPQNIAL--KMLENGANILGTSPEDIDRAENRHKFSSILDTIGVDQ-PEWSE 716

Query: 800 VKTPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGV 859
           + +  EA++ +K++ YPV+++ +    G  +  V+SE+++    ET          D  V
Sbjct: 717 LSSVSEAKDFSKSVGYPVLIRPSYVLSGAAMSVVNSEDEL----ETKLTNASDVSPDHPV 772

Query: 860 FLERFVENARHVEIQMMG-DGKGKAIAIGER--DCSLQRRNQKVIEETPAPNLSEKTRAR 916
            + +F+E A+ +++  +  +G+    AI E   +  +   +  +I   P  +LSE  + R
Sbjct: 773 VISKFIEGAQEIDVDAVAYNGEVLVHAISEHVENAGVHSGDATLI--LPPQSLSESIKER 830

Query: 917 MREASENLGSLLKYRCAGTVEFIYDERRD--EFYFLEVNARLQVEHPITEMVTGLDLVE 973
           + + ++ +    K      ++ I D+R +      +E N R     P    V G + ++
Sbjct: 831 LYDIAKKVAHAWKITGPFNMQIIKDDRHEGTSLKVIECNIRASRSFPFVSKVLGCNFID 889

 Score = 36.6 bits (83), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 46/209 (22%), Positives = 85/209 (40%), Gaps = 17/209 (8%)

Query: 801  KTPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVF 860
            +T  EA   A  + YPV+V+S    GG+G    ++E +++ +        +A      + 
Sbjct: 174  ETVDEALSAASRVGYPVIVRSAYALGGLGSGFAENEAEMKEL------AAQALSLSPQIL 227

Query: 861  LERFVENARHVEIQMMGDGKGKAIAIGERDCSLQR------RNQKVIEETPAPNLSEKTR 914
            +E+ ++  + VE +++ D     I +    C+++            I   P+  LS++  
Sbjct: 228  VEKSLKGWKEVEYEVVRDRVDNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEF 283

Query: 915  ARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEW 974
              +R A+  +   L       V++       ++  +EVNARL     +    TG  L   
Sbjct: 284  HMLRTAAIKIIRHLGVVGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPLAYT 343

Query: 975  MLLIAAG-TPPDFDATKITVTGASIEARL 1002
               IA G T P+        T A+ E  L
Sbjct: 344  AAKIALGYTLPELPNPVTKTTVANFEPSL 372

>KLLA0F03190g complement(296883..300236) highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2 arginine-specific
           carbamoylphosphate synthase, large chain, start by
           similarity
          Length = 1117

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/215 (20%), Positives = 88/215 (40%), Gaps = 8/215 (3%)

Query: 762 GIVFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGSGLVKTPQEAREIAKALEYPVMVKS 821
           G   +G + + I K   +H    I +  GV   P    + + +EA+  A  + YPV+++ 
Sbjct: 677 GAHILGTSPEDIDKAENRHKFSTILDSIGVNQ-PEWSELSSVEEAKVFANQVGYPVLIRP 735

Query: 822 TAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMG-DGK 880
           +    G  +  V  E ++E    T          D  V + +F+E A+ +++  +  +G 
Sbjct: 736 SYVLSGAAMSVVTGEHELEVKLTTASDVSP----DHPVVMSKFIEGAQEIDVDAVAHNGM 791

Query: 881 GKAIAIGERDCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIY 940
               AI E   +    +       P  NLS+  + R++E ++ +           ++ I 
Sbjct: 792 VLVHAISEHVENAGIHSGDATLVLPPQNLSQNIKDRLKEIADKVAKAWNITGPFNMQIIK 851

Query: 941 DERRD--EFYFLEVNARLQVEHPITEMVTGLDLVE 973
           D+R +      +E N R     P    V G++ +E
Sbjct: 852 DDRDEGVSLKVIECNIRASRSFPFVSKVLGVNFIE 886

 Score = 36.2 bits (82), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 87/209 (41%), Gaps = 17/209 (8%)

Query: 801  KTPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVF 860
            +T   A E A  + +PV+V+S    GG+G    ++ ++++      Q   ++      + 
Sbjct: 172  ETVDAALEAADIVGFPVIVRSAYALGGLGSGFANNAQEMK------QLASQSLSLAPQIL 225

Query: 861  LERFVENARHVEIQMMGDGKGKAIAIGERDCSLQRRNQKVIEE------TPAPNLSEKTR 914
            +E+ ++  + VE +++ D  G  I +    C+++  +   I         P+  LS++  
Sbjct: 226  VEKSLKGWKEVEYEVVRDRVGNCITV----CNMENFDPLGIHTGDSIVFAPSQTLSDEEF 281

Query: 915  ARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEW 974
              +R A+  +   L       V++       ++  +EVNARL     +    TG  L   
Sbjct: 282  HMLRSAAIKIIRHLGVIGECNVQYALSPDSLDYRVIEVNARLSRSSALASKATGYPLAYT 341

Query: 975  MLLIAAG-TPPDFDATKITVTGASIEARL 1002
               IA G T P+        T A+ E  L
Sbjct: 342  AAKIALGYTLPELPNPITKTTVANFEPSL 370

>Sklu_2136.3 , Contig c2136 3336-5189 reverse complement
          Length = 617

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 63/137 (45%), Gaps = 6/137 (4%)

Query: 111 PLYGVPIAVKDNIDATGCETTAACPEF-AYTPSNDSTVVALLRDAGAIVIGKTNLDQFAT 169
           PL+GVP+++K+ ++  G  T A+   +    P N +  + +L   GAI   +T+  Q   
Sbjct: 188 PLHGVPVSLKEQMNFKGKPTHASYVSYITNIPKNSAVSIDILDKLGAIFHTRTSQPQAIM 247

Query: 170 GLVGTRSPYGKT--PCVFSNEHXXXXXXXXXXXXXXXXIVPLALGTDTAGSGRVPAALNN 227
            L    +  G+T  PC                      ++    G+D  GS RVPAA  +
Sbjct: 248 HLDTWNNITGRTRNPCSTRLSPGGSSGGESAMVGMHGSVI--GHGSDIGGSIRVPAAFVD 305

Query: 228 LIGLKP-SKGVFSCSGV 243
           L G++P ++ + S +G+
Sbjct: 306 LFGIRPTTRRISSLNGL 322

>KLLA0B08800g complement(772732..774444) similar to
           ca|CA4426|CaAMD21 Candida albicans amidase (by
           homology), start by similarity
          Length = 570

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 54/125 (43%), Gaps = 1/125 (0%)

Query: 111 PLYGVPIAVKDNIDATGCETTAACPEFA-YTPSNDSTVVALLRDAGAIVIGKTNLDQFAT 169
           PL+GVP+++K+ +   G  T A+   +  + P   +  V +L   GA+   +T+  Q   
Sbjct: 141 PLHGVPVSIKEQMCYKGKVTNASYVSYVDFVPEQSAVSVDILIKLGAVCHVRTSQPQTIM 200

Query: 170 GLVGTRSPYGKTPCVFSNEHXXXXXXXXXXXXXXXXIVPLALGTDTAGSGRVPAALNNLI 229
            L    +  G+T    S +                    +  G+D  GS R PAA  NL 
Sbjct: 201 HLDTWNNYIGRTRNPRSTKLSPGGSSGGESACVGMHGSVIGHGSDIGGSIRAPAAFANLF 260

Query: 230 GLKPS 234
           GL+P+
Sbjct: 261 GLRPT 265

>Scas_691.19
          Length = 1117

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 57/270 (21%), Positives = 112/270 (41%), Gaps = 35/270 (12%)

Query: 802  TPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFL 861
            T  EA   A +++YPV+++S    GG+G    +++++++++                + +
Sbjct: 172  TVDEALAAANSIKYPVIIRSAYALGGLGSGFANNDQELKQLSSQSLSLSPQ------ILV 225

Query: 862  ERFVENARHVEIQMMGDGKGKAIAIGERDCSLQR------RNQKVIEETPAPNLSEKTRA 915
            ER ++  + VE +++ D  G  I +    C+++            I   P+  LS++   
Sbjct: 226  ERSMKGWKEVEYEVVRDRVGNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEYH 281

Query: 916  RMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWM 975
             +R A+  +   L       V++       ++  +EVNARL     +    TG  L    
Sbjct: 282  MLRSAAIKIIRHLGVIGECNVQYALQPDGLDYCVIEVNARLSRSSALASKATGYPLAYTA 341

Query: 976  LLIAAG-TPPDFDATKITVTGASIEARLYAENPVKDFRPSPGQLTDVSFPEWARVD-TWV 1033
              IA G T P+     IT T             V +F PS   +     P+W      +V
Sbjct: 342  AKIALGYTLPEL-PNPITKT------------TVANFEPSLDYIV-AKIPKWDLSKFQYV 387

Query: 1034 SKGTTISAEYDPTLAKIIVHGKDRDEAIQK 1063
             +    S +   ++ +++  G++ +EA QK
Sbjct: 388  DRSIGSSMK---SVGEVMAIGRNYEEAFQK 414

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 74/173 (42%), Gaps = 12/173 (6%)

Query: 805 EAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERF 864
           EA+  A  + YPV+++ +    G  +  V++E++++               D  V + +F
Sbjct: 719 EAKVFADKVGYPVLIRPSYVLSGAAMSVVNNEDELKLKLTLASDVSP----DHPVVMSKF 774

Query: 865 VENARHVEIQMMG-DGKGKAIAIGER--DCSLQRRNQKVIEETPAPNLSEKTRARMREAS 921
           +E A+ +++  +  +GK    AI E   +  +   +  +I   P  NLS+K +A ++E +
Sbjct: 775 IEGAQEIDVDAVAYNGKVLIHAISEHVENAGVHSGDASLI--LPPQNLSDKVKANLKEIA 832

Query: 922 ENLGSLLKYRCAGTVEF-IYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVE 973
           + +     +   G     I  E       +E N R     P    V G + +E
Sbjct: 833 DKVAD--AWHITGPFNMQIIKEGDKPLKVIECNIRASRSFPFVSKVLGKNFIE 883

>ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH]
           complement(695747..699088) [3342 bp, 1113 aa]
          Length = 1113

 Score = 39.7 bits (91), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 49/233 (21%), Positives = 92/233 (39%), Gaps = 11/233 (4%)

Query: 761 EGIVFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGSGLVKTPQEAREIAKALEYPVMVK 820
           +G   +G + + I K   +H    I +  G+   P    +K+  E +     + YPV+V+
Sbjct: 671 QGANILGTSPEDIDKAEDRHKFSTILDTLGLDQ-PRWSELKSLSEVKHFLDDVGYPVLVR 729

Query: 821 STAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMG-DG 879
            +    G  +  V + ED+E VFE+      A   +  V + +F+E A+ ++I  +   G
Sbjct: 730 PSYVLSGAAMSTVYNSEDLEGVFES----AVAVSPEHPVVISKFIEGAQELDIDAVAYKG 785

Query: 880 KGKAIAIGERDCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFI 939
                AI E   +    +       P  +L E+ + R+++ +  + +         ++ I
Sbjct: 786 SLLVHAISEHVENAGVHSGDATLVLPPQSLKEEEKTRLKQLAAQVAAAWNITGPFNMQII 845

Query: 940 YDERRDE--FYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAG---TPPDFD 987
                       +E N R     P    V G++ VE  +    G    PP  D
Sbjct: 846 KTAEGGHTCLKIIECNIRASRSFPFVSKVLGVNFVEIAVKAFLGGDLVPPSCD 898

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 59/271 (21%), Positives = 106/271 (39%), Gaps = 37/271 (13%)

Query: 802  TPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFL 861
            T ++A   A  + YPV+V+S    GG+G    D +       +  Q   ++      V +
Sbjct: 172  TVEDAVAAANDIGYPVIVRSAYALGGLGSGFADDD------LQLRQLCAQSLALSPQVLV 225

Query: 862  ERFVENARHVEIQMMGDGKGKAIAIGERDCSLQR------RNQKVIEETPAPNLSEKTRA 915
            E+ ++  + +E +++ D  G  I +    C+++            I   P+  LS++   
Sbjct: 226  EKSLKGWKEIEYEVVRDRVGNCITV----CNMENFDPLGIHTGDSIVLAPSQTLSDEEFH 281

Query: 916  RMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWM 975
             +R A+  +   L       V++        F  +EVNARL     +    TG  L    
Sbjct: 282  MLRTAAIEIIRHLGVVGECNVQYALQPDGLAFKVIEVNARLSRSSALASKATGYPLAYTA 341

Query: 976  LLIAAG-TPPDF--DATKITVTGASIEARLYAENPVKDFRPSPGQLTDVSFPEWARVDTW 1032
              IA G T P+     TK TV                +F PS   +     P W  +  +
Sbjct: 342  AKIALGYTLPELPNPVTKSTVA---------------NFEPSLDYIV-AKVPRW-DLSKF 384

Query: 1033 VSKGTTISAEYDPTLAKIIVHGKDRDEAIQK 1063
                 TI +    ++ +++  G++ +EA QK
Sbjct: 385  QHVDKTIGSAMK-SVGEVMAIGRNFEEAFQK 414

>Kwal_27.10438
          Length = 569

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 58/132 (43%), Gaps = 3/132 (2%)

Query: 106 DKKEL--PLYGVPIAVKDNIDATGCETTAACPEFAYTPS-NDSTVVALLRDAGAIVIGKT 162
           D K+L  PL+GV +++K+ ++  G  TTA+   +    +  +   +++LR  GA+   +T
Sbjct: 136 DNKKLIGPLHGVVVSLKEQMNYKGKVTTASYVAYLRNVTEKEGLSISILRKLGAVFHVRT 195

Query: 163 NLDQFATGLVGTRSPYGKTPCVFSNEHXXXXXXXXXXXXXXXXIVPLALGTDTAGSGRVP 222
              Q    L    +  G+T    S                      +  G+D  GS R P
Sbjct: 196 AQPQGIMHLDTWNNITGRTRNPLSTRLSPGGSSGGESAIVAMHGSVIGHGSDIGGSIRAP 255

Query: 223 AALNNLIGLKPS 234
           AA  +L G++P+
Sbjct: 256 AAFADLFGIRPT 267

>CAGL0C04917g 457506..460847 highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2, hypothetical
           start
          Length = 1113

 Score = 39.3 bits (90), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 33/173 (19%), Positives = 74/173 (42%), Gaps = 10/173 (5%)

Query: 804 QEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLER 863
           +EA+  A  + YPV+++ +    G  +  V++E ++E               D  V + +
Sbjct: 718 EEAKTFANKVSYPVLIRPSYVLSGAAMSVVNNEHELEDKLTLASDVSP----DHPVVMSK 773

Query: 864 FVENARHVEIQMMG-DGKGKAIAIGER--DCSLQRRNQKVIEETPAPNLSEKTRARMREA 920
           F++ A+ +++  +  +G+    AI E   D  +   +  +I   P  +LSE  +++++  
Sbjct: 774 FIQGAQEIDVDAVACNGELLVHAISEHVEDAGVHSGDATLI--LPPQHLSENVKSQLKTI 831

Query: 921 SENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVE 973
           ++ +           ++ I     D    +E N R     P    V G++ +E
Sbjct: 832 AKKVAKAWNITGPFNMQVIKAGEND-LKVIECNIRASRSFPFVSKVLGVNFIE 883

 Score = 35.4 bits (80), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 54/261 (20%), Positives = 104/261 (39%), Gaps = 33/261 (12%)

Query: 810  AKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENAR 869
            A  + YPV+++S    GG+G    ++ E+++ +        ++      V +E+ +   +
Sbjct: 179  ASTIGYPVIIRSAYALGGLGSGFANNPEELKEL------ASQSLSLAPQVLVEKSLRGWK 232

Query: 870  HVEIQMMGDGKGKAIAIGERDCSLQR------RNQKVIEETPAPNLSEKTRARMREASEN 923
             VE +++ D +   I +    C+++            I   P+  LS++    +R A+  
Sbjct: 233  EVEYEVVRDRENNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEFHMLRSAAIK 288

Query: 924  LGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAG-T 982
            +   L       V++       ++  +EVNARL     +    TG  L      IA G T
Sbjct: 289  IIRHLGVVGECNVQYALSPNSLDYRVIEVNARLSRSSALASKATGYPLAYTAAKIALGYT 348

Query: 983  PPDFDATKITVTGASIEARLYAENPVKDFRPSPGQLTDVSFPEWARVDTWVSKGTTISAE 1042
             P+     IT T             V +F PS   +     P+W          +  SA 
Sbjct: 349  LPEL-PNPITKT------------TVANFEPSLDYIV-AKIPKWDLSKFQYVNRSIGSAM 394

Query: 1043 YDPTLAKIIVHGKDRDEAIQK 1063
               ++ +++  G++ +EA QK
Sbjct: 395  --KSVGEVMAIGRNYEEAFQK 413

>YJR109C (CPA2) [3001] chr10 complement(629500..632856)
           Carbamoylphosphate synthetase of arginine biosynthetic
           pathway, synthetase (large) subunit [3357 bp, 1118 aa]
          Length = 1118

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/173 (18%), Positives = 74/173 (42%), Gaps = 10/173 (5%)

Query: 804 QEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLER 863
           +EA+  A  + YPV+++ +    G  +  V++EE+++               D  V + +
Sbjct: 718 EEAKLFASKVNYPVLIRPSYVLSGAAMSVVNNEEELKAKLTLASDVSP----DHPVVMSK 773

Query: 864 FVENARHVEIQMMG-DGKGKAIAIGER--DCSLQRRNQKVIEETPAPNLSEKTRARMREA 920
           F+E A+ +++  +  +G     AI E   +  +   +  ++   P  +LS+  +  +++ 
Sbjct: 774 FIEGAQEIDVDAVAYNGNVLVHAISEHVENAGVHSGDASLV--LPPQHLSDDVKIALKDI 831

Query: 921 SENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVE 973
           ++ +    K      ++ I D        +E N R     P    V G++ +E
Sbjct: 832 ADKVAKAWKITGPFNMQIIKDGEH-TLKVIECNIRASRSFPFVSKVLGVNFIE 883

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 56/271 (20%), Positives = 113/271 (41%), Gaps = 35/271 (12%)

Query: 801  KTPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVF 860
            +T  EA E A+ ++YPV+V+S    GG+G    ++  +++ +        ++      + 
Sbjct: 171  ETVDEALEAAERVKYPVIVRSAYALGGLGSGFANNASEMKEL------AAQSLSLAPQIL 224

Query: 861  LERFVENARHVEIQMMGDGKGKAIAIGERDCSLQRRNQKVIEE------TPAPNLSEKTR 914
            +E+ ++  + VE +++ D  G  I +    C+++  +   +         P+  LS++  
Sbjct: 225  VEKSLKGWKEVEYEVVRDRVGNCITV----CNMENFDPLGVHTGDSMVFAPSQTLSDEEF 280

Query: 915  ARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEW 974
              +R A+  +   L       V++       ++  +EVNARL     +    TG  L   
Sbjct: 281  HMLRSAAIKIIRHLGVIGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPLAYT 340

Query: 975  MLLIAAG-TPPDFDATKITVTGASIEARLYAENPVKDFRPSPGQLTDVSFPEWARVD-TW 1032
               I  G T P+     IT T             V +F PS   +     P+W      +
Sbjct: 341  AAKIGLGYTLPEL-PNPITKT------------TVANFEPSLDYIV-AKIPKWDLSKFQY 386

Query: 1033 VSKGTTISAEYDPTLAKIIVHGKDRDEAIQK 1063
            V +    S +   ++ +++  G++ +EA QK
Sbjct: 387  VDRSIGSSMK---SVGEVMAIGRNYEEAFQK 414

>KLLA0D12628g 1071637..1073373 weakly similar to sp|P22580
           Saccharomyces cerevisiae YDR242w AMD2 amidase singleton,
           hypothetical start
          Length = 578

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 57/139 (41%), Gaps = 3/139 (2%)

Query: 111 PLYGVPIAVKDNIDATGCETTAACPEF--AYTPSNDSTVVALLRDAGAIVIGKTNLDQFA 168
           P++G+PI++K+++   G  T A+      + TP +  TV  +    GA+   +T   Q  
Sbjct: 143 PMHGIPISLKEHLSFKGEITHASYVSLLSSVTPKHALTV-DIFDKQGALYHVRTAQPQTI 201

Query: 169 TGLVGTRSPYGKTPCVFSNEHXXXXXXXXXXXXXXXXIVPLALGTDTAGSGRVPAALNNL 228
             L       G+T    S +                    + +GTD  GS R PAA   +
Sbjct: 202 MHLDTWNIITGRTRNPRSTKLSPGGSSGGESAAIGMHGSVIGIGTDIGGSIRCPAAFAGI 261

Query: 229 IGLKPSKGVFSCSGVVPAC 247
            G++P+    S   V P+ 
Sbjct: 262 CGMRPTVKRVSLLDVTPSS 280

>Kwal_27.11485
          Length = 471

 Score = 35.0 bits (79), Expect = 0.68,   Method: Composition-based stats.
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 9/60 (15%)

Query: 435 MNSRQGTWTNFVNLADL-------AALAVPCGFRSDGLPTGI--TLIGKTFTDYALLELA 485
           MN+  GT T F +  +L         LA+P  FRSDG+  GI  TLI    + + L  LA
Sbjct: 1   MNTNTGTATAFFSTINLVKTIVGAGMLAIPYAFRSDGVLVGIVLTLIAALTSGFGLFVLA 60

>Kwal_14.783
          Length = 1280

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 1232 VPEYLGSRSTFALGNMGGYNGRVLKLGDVLFLNQPELPSSGIP 1274
            VP +LGS ST        + G+ LK GDVLF N PE+  + +P
Sbjct: 796  VPVHLGSMSTCIAAQAKLWKGK-LKPGDVLFTNHPEIGGTHLP 837

>CAGL0G00550g 59768..60460 similar to sp|P40325 Saccharomyces
            cerevisiae YGR268c, hypothetical start
          Length = 230

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 23/54 (42%), Gaps = 6/54 (11%)

Query: 1355 LHPSNAHDYVYSLGAINFTGDEPVIITADGPSLGGFVCQAVVPEGELWKVGQVK 1408
            LHP +   Y Y    +   G  P+ +    P LGG VC      GE    G+V+
Sbjct: 164  LHPFSQPTYQYGAPPMQIGGQAPIYVRPGDPRLGGVVC------GECRGTGRVR 211

>YHR014W (SPO13) [2300] chr8 (132039..132914) Meiosis-specific
           protein required for sister centromere cohesion during
           meiosis I chromosome division [876 bp, 291 aa]
          Length = 291

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 88  LVSQEHLEHQWRILQSKGDKKELPLYGVPIAVKDNIDATGCETTAACPEFA 138
           L  +  L HQ + L  + + + LP+Y  P+++ +N D  G ET  A P+ +
Sbjct: 211 LFKKTRLPHQTKSLDKEKNYQYLPIY--PVSISNNGDFVGQETPRAAPKLS 259

>YKL162C (YKL162C) [3108] chr11 complement(147635..148843) Protein of
            unknown function [1209 bp, 402 aa]
          Length = 402

 Score = 33.5 bits (75), Expect = 1.8,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 24/52 (46%)

Query: 1076 CITNIDYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEITSPGAYTTVQDYP 1127
            C   + YL+S  S  MF+  K     L   D  PS      PG+ + VQDYP
Sbjct: 126  CKNLMSYLKSTLSDNMFQKIKYFMVPLYKCDKIPSKLLDGIPGSVSLVQDYP 177

>Scas_712.17
          Length = 793

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 57/120 (47%), Gaps = 6/120 (5%)

Query: 762 GIVFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGSGLVKTPQEAREIAKALEYPVMVKS 821
           GI   GP+    +  G K  ++   +K G+P    +      ++A++    ++Y V++K+
Sbjct: 95  GIPVFGPSAKVAQLEGSKVFSKRFMDKHGIPTAKYASFTDF-EKAKKYLAEVDYNVVLKA 153

Query: 822 TAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSG--VFLERFVENARHVEIQMMGDG 879
                G G+   DS+E   +  +T+  + +  FG +G  V +E F+E    + I  + DG
Sbjct: 154 DGIAAGKGVLIPDSKEQALKDLDTIMVERQ--FGSAGDSVVIEEFLE-GEEISILTISDG 210

>Sklu_2372.4 YKL215C, Contig c2372 8103-11945
          Length = 1280

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 1232 VPEYLGSRSTFALGNMGGYNGRVLKLGDVLFLNQPELPSSGIP 1274
            VP +LGS ST        + G+ LK GDVL  N PE+  + +P
Sbjct: 798  VPVHLGSMSTCISAQANLWKGK-LKSGDVLITNHPEIGGTHLP 839

>YLR443W (ECM7) [3818] chr12 (1022621..1023967) Protein possibly
            involved in cell wall structure or biosynthesis [1347 bp,
            448 aa]
          Length = 448

 Score = 31.2 bits (69), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 37/71 (52%), Gaps = 4/71 (5%)

Query: 1425 VLKESQDQAIETFENGSLRTLTSEL-VLPAAENPVLAQLPRYSEFSPKVTYRQAGDRYVL 1483
            VL+ES +Q+  T EN  +   TSEL +L A     +  +P+Y   S    Y +    Y +
Sbjct: 72   VLRESMEQSTSTEENNGVGLTTSELYILTAYTESQIKNVPQYITVS---LYGRCDSTYTM 128

Query: 1484 VEYGENEMDLN 1494
            VE  ++E +++
Sbjct: 129  VEVFDSEGNMH 139

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.134    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 59,970,968
Number of extensions: 2676700
Number of successful extensions: 7000
Number of sequences better than 10.0: 80
Number of HSP's gapped: 7054
Number of HSP's successfully gapped: 99
Length of query: 1842
Length of database: 16,596,109
Length adjustment: 116
Effective length of query: 1726
Effective length of database: 12,580,421
Effective search space: 21713806646
Effective search space used: 21713806646
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)