Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_27.1149429929615870.0
Sklu_2251.929930012821e-180
ADL207W36029712641e-176
Scas_666.2633532811321e-156
YNL025C (SSN8)32331711281e-156
CAGL0M06875g33933411051e-152
KLLA0E08151g30429710981e-152
YPR025C (CCL1)3932421429e-10
Kwal_27.106413762371347e-09
CAGL0K05115g3672381312e-08
Scas_672.123741591293e-08
KLLA0E06666g3982411204e-07
AGL273C399172983e-04
Scas_684.18330164800.037
Kwal_23.2880324148800.038
KLLA0D09482g323123790.052
ACR041W326168790.056
CAGL0D02992g313123760.14
YGR109C (CLB6)38031710.56
CAGL0M11044g37992700.69
CAGL0D04620g476104671.8
Sklu_1845.4332148653.2
YPR119W (CLB2)491104644.0
Scas_705.15479104644.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.11494
         (296 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.11494                                                         615   0.0  
Sklu_2251.9 YNL025C, Contig c2251 9078-9977 reverse complement        498   e-180
ADL207W [1534] [Homologous to ScYNL025C (SSN8) - SH] complement(...   491   e-176
Scas_666.26                                                           440   e-156
YNL025C (SSN8) [4561] chr14 complement(584318..585289) Cyclin C ...   439   e-156
CAGL0M06875g complement(699260..700279) highly similar to sp|P47...   430   e-152
KLLA0E08151g complement(737811..738725) similar to sp|P47821 Sac...   427   e-152
YPR025C (CCL1) [5459] chr16 complement(613372..614553) Cyclin C ...    59   9e-10
Kwal_27.10641                                                          56   7e-09
CAGL0K05115g complement(497262..498365) similar to sp|P37366 Sac...    55   2e-08
Scas_672.12                                                            54   3e-08
KLLA0E06666g 605566..606762 similar to sgd|S0006229 Saccharomyce...    51   4e-07
AGL273C [4039] [Homologous to ScYPR025C (CCL1) - SH] (194015..19...    42   3e-04
Scas_684.18                                                            35   0.037
Kwal_23.2880                                                           35   0.038
KLLA0D09482g complement(800338..801309) similar to sp|P46962 Sac...    35   0.052
ACR041W [1089] [Homologous to ScYJL006C (CTK2) - SH] complement(...    35   0.056
CAGL0D02992g 311423..312364 similar to sp|P46962 Saccharomyces c...    34   0.14 
YGR109C (CLB6) [2068] chr7 complement(705361..706503) B-type cyc...    32   0.56 
CAGL0M11044g 1090429..1091568 weakly similar to sp|P24869 Saccha...    32   0.69 
CAGL0D04620g 453500..454930 highly similar to sp|P24869 Saccharo...    30   1.8  
Sklu_1845.4 YJL006C, Contig c1845 4713-5711                            30   3.2  
YPR119W (CLB2) [5540] chr16 (771649..773124) G2/M-phase-specific...    29   4.0  
Scas_705.15                                                            29   4.3  

>Kwal_27.11494
          Length = 299

 Score =  615 bits (1587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/296 (100%), Positives = 296/296 (100%)

Query: 1   MSASYWESTQRLKWQYTREGLFRERHQLWLLECQLFPQGLTVTMENNKGTGEPVSRNIPI 60
           MSASYWESTQRLKWQYTREGLFRERHQLWLLECQLFPQGLTVTMENNKGTGEPVSRNIPI
Sbjct: 1   MSASYWESTQRLKWQYTREGLFRERHQLWLLECQLFPQGLTVTMENNKGTGEPVSRNIPI 60

Query: 61  THIDMHYGKDFNLRIYCYFLIMKLGRRLNIRQYALATAHVYLARFLLRASVREVNLYLLV 120
           THIDMHYGKDFNLRIYCYFLIMKLGRRLNIRQYALATAHVYLARFLLRASVREVNLYLLV
Sbjct: 61  THIDMHYGKDFNLRIYCYFLIMKLGRRLNIRQYALATAHVYLARFLLRASVREVNLYLLV 120

Query: 121 TTCIYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTEFEFYLLEELQSYLVVHHPY 180
           TTCIYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTEFEFYLLEELQSYLVVHHPY
Sbjct: 121 TTCIYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTEFEFYLLEELQSYLVVHHPY 180

Query: 181 RAMEQIVTALRAEPYNLTLSATDLQNSWSLINDSYITDLHLLVPPHVIAMASLLIIVCLQ 240
           RAMEQIVTALRAEPYNLTLSATDLQNSWSLINDSYITDLHLLVPPHVIAMASLLIIVCLQ
Sbjct: 181 RAMEQIVTALRAEPYNLTLSATDLQNSWSLINDSYITDLHLLVPPHVIAMASLLIIVCLQ 240

Query: 241 RPHRPAHQETFNNFMAKSQVDLAEVMDTIQDLITLYDYWDKYNEPWIKFLLHCLYL 296
           RPHRPAHQETFNNFMAKSQVDLAEVMDTIQDLITLYDYWDKYNEPWIKFLLHCLYL
Sbjct: 241 RPHRPAHQETFNNFMAKSQVDLAEVMDTIQDLITLYDYWDKYNEPWIKFLLHCLYL 296

>Sklu_2251.9 YNL025C, Contig c2251 9078-9977 reverse complement
          Length = 299

 Score =  498 bits (1282), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 238/300 (79%), Positives = 265/300 (88%), Gaps = 7/300 (2%)

Query: 1   MSASYWESTQRLKWQYTREGLFRERHQLWLLECQLFPQGLTVTMENNKGTGE--PVSRNI 58
           MSASYWESTQR KWQYTRE L RER  LWL+ECQLFP GL++ MEN+K  G+   ++RNI
Sbjct: 1   MSASYWESTQRHKWQYTRESLARERQNLWLMECQLFPHGLSIVMENSKNGGQQQSITRNI 60

Query: 59  PITHIDMHYGKDFNLRIYCYFLIMKLGRRLNIRQYALATAHVYLARFLLRASVREVNLYL 118
           PI+H D+HY KD+NLRIYCYFLIMKLGRRLNIRQ ALATAHVYL+RFLL+AS+REVNLYL
Sbjct: 61  PISHKDLHYDKDYNLRIYCYFLIMKLGRRLNIRQCALATAHVYLSRFLLKASIREVNLYL 120

Query: 119 LVTTCIYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTEFEFYLLEELQSYLVVHH 178
           LVTTCIYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTEFEFYL+EELQSYL+VHH
Sbjct: 121 LVTTCIYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTEFEFYLIEELQSYLIVHH 180

Query: 179 PYRAMEQIVTALRAEPYNLTLSATDLQNSWSLINDSYITDLHLLVPPHVIAMASLLIIVC 238
           PYR+ME IV++LR EPY L LS  DLQNSWSLINDSYITDLHL+ PPHVIAMA + I VC
Sbjct: 181 PYRSMEHIVSSLREEPYQLALSPEDLQNSWSLINDSYITDLHLMYPPHVIAMACMFITVC 240

Query: 239 LQR--PHRPAHQETFNNFMAKSQVDLAEVMDTIQDLITLYDYWDKYNEPWIKFLLHCLYL 296
           L++   HR   Q+TFN FMA+SQVDL EVM+ IQDLITLYD+WDKYNEPWIKFLLH +YL
Sbjct: 241 LKKSVSHR---QQTFNRFMAESQVDLQEVMNVIQDLITLYDHWDKYNEPWIKFLLHTVYL 297

>ADL207W [1534] [Homologous to ScYNL025C (SSN8) - SH]
           complement(339219..340301) [1083 bp, 360 aa]
          Length = 360

 Score =  491 bits (1264), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 233/297 (78%), Positives = 256/297 (86%), Gaps = 1/297 (0%)

Query: 1   MSASYWESTQRLKWQYTREGLFRERHQLWLLECQLFPQGLTVTMENNKGTGEPVSRNIPI 60
           MSASYW+S+QR KWQY+RE L R R +LW+LECQL+PQG  + ME      +PV++NIPI
Sbjct: 29  MSASYWDSSQRNKWQYSRESLARTRQKLWMLECQLYPQGTNILMEGGGKDAQPVTKNIPI 88

Query: 61  THIDMHYGKDFNLRIYCYFLIMKLGRRLNIRQYALATAHVYLARFLLRASVREVNLYLLV 120
           TH D+HY +D+NLRIYCYFLIMKLGRRLN+RQYALATAHVYLARF L+AS+REVNLYLLV
Sbjct: 89  THRDLHYDRDYNLRIYCYFLIMKLGRRLNVRQYALATAHVYLARFCLKASIREVNLYLLV 148

Query: 121 TTCIYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTEFEFYLLEELQSYLVVHHPY 180
           TTCIYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTEFEFYL+EELQSY++VH+PY
Sbjct: 149 TTCIYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTEFEFYLIEELQSYMIVHYPY 208

Query: 181 RAMEQIVTALRAEPYNLTLSATDLQNSWSLINDSYITDLHLLVPPHVIAMASLLIIVCLQ 240
           RAMEQI  ALR  PYNL LS  DLQNSWSLINDSYITD+HLL PPHVIAMA L I VCL+
Sbjct: 209 RAMEQIAAALRRPPYNLVLSPDDLQNSWSLINDSYITDVHLLYPPHVIAMACLFITVCLR 268

Query: 241 RPHRPAH-QETFNNFMAKSQVDLAEVMDTIQDLITLYDYWDKYNEPWIKFLLHCLYL 296
                   QETFN FMA SQVDL EVMDTIQD ITLYD+WDKYNEPWIKFLLH LYL
Sbjct: 269 SAAGARDLQETFNRFMADSQVDLHEVMDTIQDFITLYDHWDKYNEPWIKFLLHNLYL 325

>Scas_666.26
          Length = 335

 Score =  440 bits (1132), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 216/328 (65%), Positives = 252/328 (76%), Gaps = 32/328 (9%)

Query: 1   MSASYWESTQRLKWQYTREGLFRERHQLWLLECQLFPQGLTVTME--------NNKGT-G 51
           MS SYW STQR  WQ+T+  L +ER +LW+LECQLFPQGL +TM+        N+ GT  
Sbjct: 1   MSGSYWTSTQRHNWQFTKTSLAKERQKLWILECQLFPQGLNITMDAPKPNSSDNSNGTIM 60

Query: 52  EPVSRNIPITHIDMHYGKDFNLRIYCYFLIMKLGRRLNIRQYALATAHVYLARFLLRASV 111
            P ++NIPITH D+HY +D+NLRIYCYFLIMKLGRRLNIRQ ALATAH+YL+RFLLR SV
Sbjct: 61  RPTTKNIPITHRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALATAHIYLSRFLLRTSV 120

Query: 112 REVNLYLLVTTCIYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTEFEFYLLEELQ 171
           REVNLYLLVTT +YLACKVEECPQ+IRTLV+EARSLWPEFVPPDPTKVTEFEFYLLEEL+
Sbjct: 121 REVNLYLLVTTTVYLACKVEECPQYIRTLVSEARSLWPEFVPPDPTKVTEFEFYLLEELE 180

Query: 172 SYLVVHHPYRAMEQIVTALRAEPYNLTLSATDLQNSWSLINDSYITDLHLLVPPHVIAMA 231
           SYL+VHHPYR +EQIV  L+ EP+ L L+A DLQN WSLINDSYITD +L+ PPH+IAM+
Sbjct: 181 SYLIVHHPYRPLEQIVETLKMEPFQLNLTADDLQNCWSLINDSYITDANLIYPPHIIAMS 240

Query: 232 SLLIIVCLQ-----------------------RPHRPAHQETFNNFMAKSQVDLAEVMDT 268
            L I + L+                              QE FN +MA+SQVDL EVMDT
Sbjct: 241 CLFITIALKNIDANVGNGNTKNDNLITRALSGENGMSKTQEVFNLYMAQSQVDLEEVMDT 300

Query: 269 IQDLITLYDYWDKYNEPWIKFLLHCLYL 296
           IQ+ ITLYD+WDKY+EPW+KFLLH LYL
Sbjct: 301 IQEQITLYDHWDKYHEPWVKFLLHTLYL 328

>YNL025C (SSN8) [4561] chr14 complement(584318..585289) Cyclin C
           homolog, component of RNA polymerase holoenzyme complex
           and Kornberg's mediator (SRB) subcomplex [972 bp, 323
           aa]
          Length = 323

 Score =  439 bits (1128), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 208/317 (65%), Positives = 255/317 (80%), Gaps = 21/317 (6%)

Query: 1   MSASYWESTQRLKWQYTREGLFRERHQLWLLECQLFPQGLTVTMENNK-GTGEPVSRNIP 59
           MS S+W STQR  WQYT+  L +ER +LWLLECQLFPQGL + M++ + G  + +++NIP
Sbjct: 1   MSGSFWTSTQRHHWQYTKASLAKERQKLWLLECQLFPQGLNIVMDSKQNGIEQSITKNIP 60

Query: 60  ITHIDMHYGKDFNLRIYCYFLIMKLGRRLNIRQYALATAHVYLARFLLRASVREVNLYLL 119
           ITH D+HY KD+NLRIYCYFLIMKLGRRLNIRQYALATAH+YL+RFL++ASVRE+NLY+L
Sbjct: 61  ITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIYLSRFLIKASVREINLYML 120

Query: 120 VTTCIYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTEFEFYLLEELQSYLVVHHP 179
           VTTC+YLACKVEECPQ+IRTLV+EAR+LWPEF+PPDPTKVTEFEFYLLEEL+SYL+VHHP
Sbjct: 121 VTTCVYLACKVEECPQYIRTLVSEARTLWPEFIPPDPTKVTEFEFYLLEELESYLIVHHP 180

Query: 180 YRAMEQIVTALRAEPYNLTLSATDLQNSWSLINDSYITDLHLLVPPHVIAMASLLIIVCL 239
           Y++++QIV  L+  P+ +TLS+ DLQN WSLINDSYI D+HLL PPH+IA+A L I + +
Sbjct: 181 YQSLKQIVQVLKQPPFQITLSSDDLQNCWSLINDSYINDVHLLYPPHIIAVACLFITISI 240

Query: 240 Q-RPHRPAH-------------------QETFNNFMAKSQVDLAEVMDTIQDLITLYDYW 279
             +P + +                    Q  FN FMA+S VDL EVMDTIQ+ ITLYD+W
Sbjct: 241 HGKPTKGSSLASAASEAIRDPKNSSSPVQIAFNRFMAESLVDLEEVMDTIQEQITLYDHW 300

Query: 280 DKYNEPWIKFLLHCLYL 296
           DKY+E WIKFLLH LYL
Sbjct: 301 DKYHEQWIKFLLHTLYL 317

>CAGL0M06875g complement(699260..700279) highly similar to sp|P47821
           Saccharomyces cerevisiae YNL025c SSN8, start by
           similarity
          Length = 339

 Score =  430 bits (1105), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 206/334 (61%), Positives = 249/334 (74%), Gaps = 38/334 (11%)

Query: 1   MSASYWESTQRLKWQYTREGLFRERHQLWLLECQLFPQGLTVTMENNKGTGEP------- 53
           MS SYW S QR KWQ+T+  L RER +LW++ECQLFPQGL + +++   + +        
Sbjct: 1   MSGSYWTSMQRQKWQHTKPSLARERQRLWVMECQLFPQGLNIIVDSKPNSADSSNGNAAN 60

Query: 54  ------------VSRNIPITHIDMHYGKDFNLRIYCYFLIMKLGRRLNIRQYALATAHVY 101
                        ++NIPITH D+HY KD+NLRIYCYFLIMKLGRRLNIRQYALATAH+Y
Sbjct: 61  NGGGNGRSQLVATTKNIPITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIY 120

Query: 102 LARFLLRASVREVNLYLLVTTCIYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTE 161
           L+RFLL+ASVREVNLYLLVTTC+YLACKVEECPQ+IRTLV+EARSLWPEF+PPDPTKVTE
Sbjct: 121 LSRFLLKASVREVNLYLLVTTCVYLACKVEECPQYIRTLVSEARSLWPEFIPPDPTKVTE 180

Query: 162 FEFYLLEELQSYLVVHHPYRAMEQIVTALRAEPYNLTLSATDLQNSWSLINDSYITDLHL 221
           FEFYL+EELQ YL+VHHPY++MEQIV AL+ EP+ LT ++ +LQN WSLINDS+I D+HL
Sbjct: 181 FEFYLIEELQCYLIVHHPYKSMEQIVEALKEEPFKLTFTSDELQNCWSLINDSFINDVHL 240

Query: 222 LVPPHVIAMASLLIIVCLQRPHRPA-------------------HQETFNNFMAKSQVDL 262
              PH+IAMA L I V +Q  +                       Q+TF  F+A+S VDL
Sbjct: 241 TYAPHIIAMACLFITVSIQGSNTKELSLTSAVTETLTSQSSLTPQQQTFFRFLAESHVDL 300

Query: 263 AEVMDTIQDLITLYDYWDKYNEPWIKFLLHCLYL 296
            EVMDTIQ  I LYD+WD+Y+EPWIK+LLH LYL
Sbjct: 301 EEVMDTIQQQIILYDHWDRYHEPWIKYLLHTLYL 334

>KLLA0E08151g complement(737811..738725) similar to sp|P47821
           Saccharomyces cerevisiae YNL025c SSN8 DNA-directed RNA
           polymerase II holoenzyme and Kornberg s mediator (SRB)
           subcomplex subunit, cyclin C homolog singleton, start by
           similarity
          Length = 304

 Score =  427 bits (1098), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 204/297 (68%), Positives = 245/297 (82%), Gaps = 2/297 (0%)

Query: 1   MSASYWESTQRLKWQYTREGLFRERHQLWLLECQLFPQGLTVTMENNKGTGEPVSRNIPI 60
           MSASYW+S+QR KW+YTRE L +E+ +LWLLECQLFPQGL VT+ ++K   + V+ NIP+
Sbjct: 1   MSASYWDSSQRHKWKYTRESLAKEKQKLWLLECQLFPQGLNVTIHDSKANKQ-VTTNIPV 59

Query: 61  THIDMHYGKDFNLRIYCYFLIMKLGRRLNIRQYALATAHVYLARFLLRASVREVNLYLLV 120
           T  D+HY +D+NLRIYCYFLIMKLGRRLNIRQ AL TAHVYL+RFLLRASVREVNLYLL+
Sbjct: 60  TQRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALVTAHVYLSRFLLRASVREVNLYLLI 119

Query: 121 TTCIYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTEFEFYLLEELQSYLVVHHPY 180
           TTCIYLACKVEECPQHIRTLVNEARSLWPEF+PPD TKVTEFEFYL+EELQSYL+VHHPY
Sbjct: 120 TTCIYLACKVEECPQHIRTLVNEARSLWPEFIPPDVTKVTEFEFYLIEELQSYLIVHHPY 179

Query: 181 RAMEQIVTALRAEPYNLTLSATDLQNSWSLINDSYITDLHLLVPPHVIAMASLLIIVC-L 239
           R++EQI  AL +E YN  LS  +LQ  WSLINDSY TD+HLL  PHVIA++ L  + C +
Sbjct: 180 RSLEQIEKALSSEKYNYKLSDDELQKIWSLINDSYTTDVHLLYSPHVIAISCLFAVSCII 239

Query: 240 QRPHRPAHQETFNNFMAKSQVDLAEVMDTIQDLITLYDYWDKYNEPWIKFLLHCLYL 296
            +P     +   N F+A++QV+L +VM  +Q+LI+LYD+WDKYNE  I+ LLH LYL
Sbjct: 240 HKPEDSTKRANINMFIAETQVNLEQVMFILQELISLYDHWDKYNELRIRALLHELYL 296

>YPR025C (CCL1) [5459] chr16 complement(613372..614553) Cyclin C
           component of RNA polymerase transcription initiation
           factor TFIIH, required for PolII transcription, for
           nucleotide excision repair, and for activity of Kin28p
           [1182 bp, 393 aa]
          Length = 393

 Score = 59.3 bits (142), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 104/242 (42%), Gaps = 28/242 (11%)

Query: 5   YWESTQRLKWQYTREGLFRERHQLWLLECQLFPQGLTVTMENNKGTGEPV----SRNIPI 60
           Y  S+Q   W YT++ L  +R            + L    E +  T E +    ++ IP+
Sbjct: 49  YRHSSQYRMWSYTKDQLQEKRVDTNARAIAYIEENLLKFREAHNLTEEEIKVLEAKAIPL 108

Query: 61  THIDMHYGKDFNLRIYCYFLIMKLGRRLNIRQYALATAHVYLARFLLRASVREVNLYLLV 120
           T       ++ +L  +    +  + + LN+    +ATA  +  RF L  SV +++   +V
Sbjct: 109 T-----MEEELDLVNFYAKKVQVIAQHLNLPTEVVATAISFFRRFFLENSVMQIDPKSIV 163

Query: 121 TTCIYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTEFEFYLLEELQSYLVVHHPY 180
            T I+LACK E     + +   +A+S            V +FEF LLE L+  L+ HHPY
Sbjct: 164 HTTIFLACKSENYFISVDSFAQKAKSTR--------DSVLKFEFKLLESLKFSLLNHHPY 215

Query: 181 RAMEQIVTALRAEPYNLTLSATDLQNSWSL-------INDSYITDLHLLVPPHVIAMASL 233
           + +      ++    N+     DL     +       I  + +TD+     P  I +A+L
Sbjct: 216 KPLHGFFLDIQ----NVLYGKVDLNYMGQIYDRCKKRITAALLTDVVYFYTPPQITLATL 271

Query: 234 LI 235
           LI
Sbjct: 272 LI 273

>Kwal_27.10641
          Length = 376

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 57/237 (24%), Positives = 97/237 (40%), Gaps = 17/237 (7%)

Query: 5   YWESTQRLKWQYTREGLFRERHQLWLLECQLFPQGLTVTMENNKGTGEPVSRNIPITHID 64
           Y  S+Q   W +T E L + RH+          Q L    + N          I    + 
Sbjct: 29  YRHSSQYRLWSFTPERLTQMRHETNARARTKIEQDLRAFRDMNPDLSAEELAGIDEKAVP 88

Query: 65  MHYGKDFNLRIYCYFLIMKLGRRLNIRQYALATAHVYLARFLLRASVREVNLYLLVTTCI 124
           +   ++  L  Y   +++    ++N+     ATA  +  +F L  SV E++   +  T +
Sbjct: 89  VSAEEEILLVNYFARMLLSFANKMNLPTEVAATAISFFRKFYLSNSVAELSPKEIFHTAL 148

Query: 125 YLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTEFEFYLLEELQSYLVVHHPYRAME 184
           + ACK E     + +   +AR+            V + EF LLE L   ++ HHPY+A+ 
Sbjct: 149 FFACKSENYFIGVESFAKKARTTT--------EAVLKHEFRLLESLNFTIMNHHPYKALH 200

Query: 185 ------QIVTALRAEPYNLTLSATDLQNSWSLINDSYITDLHLLVPPHVIAMASLLI 235
                 Q V A + +   +    TD +     I D+ +TD      P  I +A+LL+
Sbjct: 201 GFFLDIQTVLAGKVDMKYMGQVYTDCKK---FITDALLTDAVYFYTPPQITLATLLM 254

>CAGL0K05115g complement(497262..498365) similar to sp|P37366
           Saccharomyces cerevisiae YPR025c Cyclin, hypothetical
           start
          Length = 367

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 104/238 (43%), Gaps = 18/238 (7%)

Query: 5   YWESTQRLKWQYTREGLFRERHQLWLLECQLFPQGLTVTMENNKGTGEP-VSRNIPITHI 63
           Y  S+Q   W +T + L ++R +       +  + L    E +K    P V++ I     
Sbjct: 37  YRHSSQFRLWSFTPDKLLQKRTETNARAVVVIEEKLRAFKEKHKDELTPDVAKVIDSKAT 96

Query: 64  DMHYGKDFNLRIYCYFLIMKLGRRLNIRQYALATAHVYLARFLLRASVREVNLYLLVTTC 123
            +   ++  L  +    +  + +++++    +AT+  +  RF L  SV EV    +V T 
Sbjct: 97  PITTEEELKLVNFYAQKVQVIAQKMSLPTEVVATSISFFRRFFLENSVLEVEPKDIVHTT 156

Query: 124 IYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVT--EFEFYLLEELQSYLVVHHPYR 181
           I+LACK E     + +   +A++          TK T  ++EF LLE L+  L+ HHPY+
Sbjct: 157 IFLACKSENYFISVNSFAEKAKA----------TKETILKYEFKLLETLKFTLMNHHPYK 206

Query: 182 AME----QIVTALRAEPYNLTLSATDLQNSWSLINDSYITDLHLLVPPHVIAMASLLI 235
            +      I   L  +  +L       +     I ++ +TD      P  I +A+L+I
Sbjct: 207 PLHGFFLDIQKTLHGK-IDLKYMGKIYEKCKKRITEALLTDAVYFYTPPQITLATLMI 263

>Scas_672.12
          Length = 374

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 75/159 (47%), Gaps = 19/159 (11%)

Query: 84  LGRRLNIRQYALATAHVYLARFLLRASVREVNLYLLVTTCIYLACKVEECPQHIRTLVNE 143
           + + LN+    +AT+  +  +F L  SV + +   LV T I+LACK E     + +   +
Sbjct: 135 ISQHLNLPTEIIATSISFFKKFFLENSVMQYDPKSLVHTTIFLACKAENYFISVDSFAKK 194

Query: 144 ARSLWPEFVPPDPTKVTEFEFYLLEELQSYLVVHHPYRAMEQIVTALRAEPYNLTLSATD 203
           A+S        +   + ++EF LLE L+  L++HHPY+ +      ++    N+     D
Sbjct: 195 AKS--------NREAILKYEFKLLESLKFSLLIHHPYKPLHGFFLDIQ----NVLHGKVD 242

Query: 204 LQNSWSL-------INDSYITDLHLLVPPHVIAMASLLI 235
           L     +       I ++ +TD+  L  P  I +A L+I
Sbjct: 243 LNYMGQIYDKCKKKITEAILTDVVYLFTPPQITLAILMI 281

>KLLA0E06666g 605566..606762 similar to sgd|S0006229 Saccharomyces
           cerevisiae YPR025c CCL1 TFIIH subunit (transcription
           initiation factor), cyclin C component, start by
           similarity
          Length = 398

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 59/241 (24%), Positives = 99/241 (41%), Gaps = 25/241 (10%)

Query: 5   YWESTQRLKWQYTREGLFRERHQLWLLECQLFPQGL-TVTMENNKGTGEPVS----RNIP 59
           Y  S+Q   W +T+E L   R  L         + L  +  ++N  + E ++    + +P
Sbjct: 58  YRHSSQYRLWSFTKEQLESRRRALNAKVVDKVNEKLQDIISKHNDLSQEELNAINEKAVP 117

Query: 60  ITHIDMHYGKDFNLRIYCYFL--IMKLGRRLNIRQYALATAHVYLARFLLRASVREVNLY 117
           +T  +        L+   +F   +      LN+     ATA  +  RF L  S  E++  
Sbjct: 118 VTMEE-------ELKFVNFFAKKVQSFCHSLNLPTEVCATAISFFRRFFLVNSTMEIHPK 170

Query: 118 LLVTTCIYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTEFEFYLLEELQSYLVVH 177
            ++   I+LACK E     I     + +S         PT + ++EF +LE LQ  L+ H
Sbjct: 171 HILLASIFLACKSENYFIGIEAFAKKTKS--------QPTTILKYEFDVLESLQFTLLNH 222

Query: 178 HPYRAMEQIVTALR---AEPYNLTLSATDLQNSWSLINDSYITDLHLLVPPHVIAMASLL 234
           HPYR +      ++       +L        N    I ++ +TD+     P  I +A LL
Sbjct: 223 HPYRPLHGFFLDIQYILHGKVDLNYMGQIYTNCKRRITETLLTDVVYHYTPPQITLACLL 282

Query: 235 I 235
           I
Sbjct: 283 I 283

>AGL273C [4039] [Homologous to ScYPR025C (CCL1) - SH]
           (194015..195214) [1200 bp, 399 aa]
          Length = 399

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 77/172 (44%), Gaps = 16/172 (9%)

Query: 70  DFNLRIYCYFL--IMKLGRRLNIRQYALATAHVYLARFLLRASVREVNLYLLVTTCIYLA 127
           D  L++  ++   +   G  L +     ATA  +  +F L  SV E++   ++ T I+LA
Sbjct: 99  DEELKLVNFYAKKVRHFGNSLELPTEVTATAISFFRKFFLTNSVMELHPKNILWTTIFLA 158

Query: 128 CKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTEFEFYLLEELQSYLVVHHPYRAME--- 184
           CK E     I +      +   E        + ++E+ LLE L+  L+ HHPY+A+    
Sbjct: 159 CKSENYFLGIDSFSKA--TTRKEL-------ILKYEYTLLESLKFTLMNHHPYKALHGFF 209

Query: 185 -QIVTALRAEPYNLTLSATDLQNSWSLINDSYITDLHLLVPPHVIAMASLLI 235
             I + L+ +  +L        ++   I D+ +TD   +  P  I +A L I
Sbjct: 210 LDIQSVLKGK-VDLDYMGLIYTSAKKKITDALLTDAVYMYTPPQITLAVLAI 260

>Scas_684.18
          Length = 330

 Score = 35.4 bits (80), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 67/164 (40%), Gaps = 17/164 (10%)

Query: 83  KLGRRLNIRQYALATAHVYLARFLLRASVREVNLYLLVTTCIYLACKVEECPQHIRTLVN 142
           +L  RLN  +  L TA  Y  R+ L  S      Y L T+C+ L+CK  E  + I  + N
Sbjct: 51  ELCTRLNFPRKTLETALYYYQRYHLFNSFETELCYTLATSCLVLSCKQVETMKKINEICN 110

Query: 143 EARSLWPEFVPPDPTKVTE-----------FEFYLLEELQSYLVVHHPYRAMEQIVTALR 191
            +  L    +  +P K  E            E  +LE       +++   A E IV   +
Sbjct: 111 LSFVLRN--IKMNPMKNAEILNNFKKQLFHLELKILEACSFDYRINNYVHADEFIVKFGK 168

Query: 192 AEPYNLTLSATDLQNSWSLINDSYITDLHLLVPPHVIAMASLLI 235
                L  S      +W +  D    ++ L+VP H I++A L I
Sbjct: 169 ----KLGFSYQVCHLAWLIGYDVLKLEIMLIVPQHCISLAVLKI 208

>Kwal_23.2880
          Length = 324

 Score = 35.4 bits (80), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 65/148 (43%), Gaps = 10/148 (6%)

Query: 94  ALATAHVYLARFLLRASVREVNLYLLVTTCIYLACKVEECPQHIRTLVNEA---RSL--- 147
            L TA  +  RF L         Y + T+C++L+CK  E  + +  LV  +   RS+   
Sbjct: 59  TLETAMYFYQRFYLFNKFETEMCYDVATSCLFLSCKQVETMKKVADLVAVSLRLRSVVKA 118

Query: 148 WPEFVPPDPTKVTEFEFYLLEELQSYLVVHHPYRAMEQIVTALRAEPYNLTLSATDLQNS 207
            PE       ++ + E  +LE       V++     + +V   +    +L LS      +
Sbjct: 119 SPEMQDNCKKRIFQLELRILETCSFDYRVNNTIHIDDILVKIGK----DLKLSHEVCYLA 174

Query: 208 WSLINDSYITDLHLLVPPHVIAMASLLI 235
           W +  D+   ++ L+VP H IA+A L I
Sbjct: 175 WLIAFDALKLEILLMVPQHTIAIAVLKI 202

>KLLA0D09482g complement(800338..801309) similar to sp|P46962
           Saccharomyces cerevisiae YJL006c CTK2 carboxy-terminal
           domain (CTD) kinase, beta subunit singleton, start by
           similarity
          Length = 323

 Score = 35.0 bits (79), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 56/123 (45%), Gaps = 10/123 (8%)

Query: 117 YLLVTTCIYLACKVEECPQHIRTLVNEARSL------WPEFVPPDPTKVTEFEFYLLEEL 170
           Y + T+C++L+CK  E  + +  + + A  +       P+ V     +V + E  +LE  
Sbjct: 80  YDVGTSCLFLSCKQVETFKRLGEVCSTALKIRNVPRVTPDMVDAFKKRVMQMELRVLETC 139

Query: 171 QSYLVVHHPYRAMEQIVTALRAEPYNLTLSATDLQNSWSLINDSYITDLHLLVPPHVIAM 230
                V++     E IV   R     L+L  +  + +W +  D    +L + VPPH IA+
Sbjct: 140 SFDYRVNNEVHIDEFIVKIGR----ELSLPYSCCRLAWLIAFDVLKLELLITVPPHTIAL 195

Query: 231 ASL 233
           A L
Sbjct: 196 AVL 198

>ACR041W [1089] [Homologous to ScYJL006C (CTK2) - SH]
           complement(433909..434889) [981 bp, 326 aa]
          Length = 326

 Score = 35.0 bits (79), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 70/168 (41%), Gaps = 10/168 (5%)

Query: 74  RIYCYFLIMKLGRRLNIRQYALATAHVYLARFLLRASVREVNLYLLVTTCIYLACKVEEC 133
           RI  +  +  L  +L   +  L  A  Y  R+ +         Y + T+C++++CK  E 
Sbjct: 40  RITVFKFLCDLCVQLKFPRKTLEVAMYYYQRYYVFNKFETEMCYDVATSCLFISCKQVET 99

Query: 134 PQHIRTLVNEARSLWP------EFVPPDPTKVTEFEFYLLEELQSYLVVHHPYRAMEQIV 187
            + +  + + +  L        E +    T++ + E  +LE       +++     E IV
Sbjct: 100 VKKVADVCSASLKLRNSLKLSMEKLESYKTRIIQMELRILETCAFDHRINNTVHVDEYIV 159

Query: 188 TALRAEPYNLTLSATDLQNSWSLINDSYITDLHLLVPPHVIAMASLLI 235
              R     L+L  T    +W +  D    ++ L+VP H IA+A L I
Sbjct: 160 KIGR----ELSLDHTVCHLAWLIAFDVIKLEIILIVPQHTIALAVLKI 203

>CAGL0D02992g 311423..312364 similar to sp|P46962 Saccharomyces
           cerevisiae YJL006c CTK2 carboxy-terminal domain kinase,
           hypothetical start
          Length = 313

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 53/123 (43%), Gaps = 10/123 (8%)

Query: 117 YLLVTTCIYLACKVEECPQHIRTLVNEARSL------WPEFVPPDPTKVTEFEFYLLEEL 170
           Y++ T+C+ L+CK  E  + +  +   + SL        E +     +V   E  +LE  
Sbjct: 83  YIIATSCLVLSCKEVETIKKVNDICTVSLSLRNTGKVSGEVLENFKKRVFVMELKVLESC 142

Query: 171 QSYLVVHHPYRAMEQIVTALRAEPYNLTLSATDLQNSWSLINDSYITDLHLLVPPHVIAM 230
                ++      E I+   +     L LS      +W +  D   T+L LLVP HVI++
Sbjct: 143 SFDYRINDAVHVDEYIIKFGKT----LGLSYELCHIAWCIAFDVLKTELLLLVPQHVISL 198

Query: 231 ASL 233
           A +
Sbjct: 199 ACI 201

>YGR109C (CLB6) [2068] chr7 complement(705361..706503) B-type cyclin
           appearing late in G1, involved in initiation of DNA
           synthesis [1143 bp, 380 aa]
          Length = 380

 Score = 32.0 bits (71), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 102 LARFLLRASVREVNLYLLVTTCIYLACKVEE 132
           L RFL +  V+   L LL  TC+++ACK EE
Sbjct: 184 LDRFLSQNVVKLNKLQLLCITCLFIACKFEE 214

>CAGL0M11044g 1090429..1091568 weakly similar to sp|P24869
           Saccharomyces cerevisiae YPR119w CLB2 cyclin,
           G2/M-specific, hypothetical start
          Length = 379

 Score = 31.6 bits (70), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 42/92 (45%), Gaps = 7/92 (7%)

Query: 81  IMKLGRRLNIRQYALATAHVYLARFLLRASVREVNLYLLVTTCIYLACKVEEC-PQHIRT 139
           ++K+ + L +    L      + +FL++  +      LL  TC+Y+A K EE  P  I  
Sbjct: 164 VIKIHQNLKLENETLYMTIDLIDKFLIKKKLPIEKFQLLGLTCLYIASKYEEVLPPSIFQ 223

Query: 140 LVNEARSLWPEFVPPDPTKVTEFEFYLLEELQ 171
              E+  ++      D  ++ E EF +LE L 
Sbjct: 224 FALESNGIF------DSEEIKESEFNILETLN 249

>CAGL0D04620g 453500..454930 highly similar to sp|P24869
           Saccharomyces cerevisiae YPR119w CLB2, start by
           similarity
          Length = 476

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 48/104 (46%), Gaps = 12/104 (11%)

Query: 92  QYALATAHVYLA-----RFLLRASVREVNLYLLVTTCIYLACKVEEC-PQHIRTLVNEAR 145
           ++ L    +YLA     RFL +  V+   L L+ T+C+++A K EE     I+   +E  
Sbjct: 259 KFGLLPETLYLAVNLMDRFLCKELVQLDKLQLVGTSCLFIASKYEEVYSPSIKHFASETD 318

Query: 146 SLWPEFVPPDPTKVTEFEFYLLEELQSYLVVHHPYRAMEQIVTA 189
               E       ++ E E ++L+ L+  L   +P   + +I  A
Sbjct: 319 GACTE------DEIKEGEKFILKTLEFNLNYPNPMNFLRRISKA 356

>Sklu_1845.4 YJL006C, Contig c1845 4713-5711
          Length = 332

 Score = 29.6 bits (65), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 31/148 (20%), Positives = 60/148 (40%), Gaps = 10/148 (6%)

Query: 94  ALATAHVYLARFLLRASVREVNLYLLVTTCIYLACKVEECPQHIRTLVNEARSL------ 147
            L TA  +  R+ +         Y + T+C++++CK  E  + +  +   +  L      
Sbjct: 60  TLETAMYFYQRYHVFNKFETEMCYDVATSCLFISCKQVETVKKVDEICTVSLKLRNLLKI 119

Query: 148 WPEFVPPDPTKVTEFEFYLLEELQSYLVVHHPYRAMEQIVTALRAEPYNLTLSATDLQNS 207
            PE +     ++ + E  +LE       +++     E IV   R   ++  +       +
Sbjct: 120 SPETLDTFKKRIFQLELRVLETCSFDFRINNSVHIDEFIVKFGRELSFDYKICHL----A 175

Query: 208 WSLINDSYITDLHLLVPPHVIAMASLLI 235
           W +  D    ++ L VP H IA+A L I
Sbjct: 176 WLIGFDVLKLEIVLAVPQHTIAIAVLKI 203

>YPR119W (CLB2) [5540] chr16 (771649..773124) G2/M-phase-specific
           cyclin [1476 bp, 491 aa]
          Length = 491

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 48/104 (46%), Gaps = 12/104 (11%)

Query: 92  QYALATAHVYLA-----RFLLRASVREVNLYLLVTTCIYLACKVEEC-PQHIRTLVNEAR 145
           ++ L    +YLA     RFL +  V+   L L+ T+C+++A K EE     I+   +E  
Sbjct: 274 KFGLLPETLYLAINIMDRFLGKELVQLDKLQLVGTSCLFIASKYEEVYSPSIKHFASETD 333

Query: 146 SLWPEFVPPDPTKVTEFEFYLLEELQSYLVVHHPYRAMEQIVTA 189
               E       ++ E E ++L+ L+  L   +P   + +I  A
Sbjct: 334 GACTE------DEIKEGEKFILKTLKFNLNYPNPMNFLRRISKA 371

>Scas_705.15
          Length = 479

 Score = 29.3 bits (64), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 48/104 (46%), Gaps = 12/104 (11%)

Query: 92  QYALATAHVYLA-----RFLLRASVREVNLYLLVTTCIYLACKVEEC-PQHIRTLVNEAR 145
           ++ L    +YLA     RFL +  V+   L L+ T+C+++A K EE     I+   +E  
Sbjct: 261 KFGLLPETLYLAINIMDRFLCKELVQLDKLQLVGTSCLFIASKYEEVYSPSIKHYASETD 320

Query: 146 SLWPEFVPPDPTKVTEFEFYLLEELQSYLVVHHPYRAMEQIVTA 189
               E       ++ E E ++L+ L+  L   +P   + +I  A
Sbjct: 321 GACTE------EEIKEGEKFILKTLEFTLNYPNPMNFLRRISKA 358

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.138    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,681,190
Number of extensions: 388106
Number of successful extensions: 1302
Number of sequences better than 10.0: 31
Number of HSP's gapped: 1296
Number of HSP's successfully gapped: 31
Length of query: 296
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 195
Effective length of database: 13,099,691
Effective search space: 2554439745
Effective search space used: 2554439745
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 61 (28.1 bits)