Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_27.1148935735317270.0
Sklu_2251.835935512081e-167
KLLA0E08129g3693629971e-134
ADL206W3723229871e-133
YHL003C (LAG1)4113133081e-31
CAGL0M10219g3973623072e-31
Scas_668.204252633072e-31
YKL008C (LAC1)4182892951e-29
Scas_717.234302582853e-28
CAGL0K02739g4312632835e-28
Kwal_26.78864222652801e-27
Sklu_2243.44092392632e-25
KLLA0B13497g4082152544e-24
ABR009W4132602519e-24
Kwal_47.18842508112629.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.11489
         (353 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.11489                                                         669   0.0  
Sklu_2251.8 , Contig c2251 7738-8817 reverse complement               469   e-167
KLLA0E08129g complement(736008..737117) weakly similar to sp|P28...   388   e-134
ADL206W [1535] [Homologous to ScYHL003C (LAG1) - NSH] complement...   384   e-133
YHL003C (LAG1) [2282] chr8 complement(100643..101878) Protein re...   123   1e-31
CAGL0M10219g complement(1020895..1022088) similar to sp|P28496 S...   122   2e-31
Scas_668.20                                                           122   2e-31
YKL008C (LAC1) [3248] chr11 complement(426938..428194) Protein r...   118   1e-29
Scas_717.23                                                           114   3e-28
CAGL0K02739g complement(246652..247947) highly similar to sp|P38...   113   5e-28
Kwal_26.7886                                                          112   1e-27
Sklu_2243.4 YHL003C, Contig c2243 7329-8558                           105   2e-25
KLLA0B13497g 1181036..1182262 similar to sp|P28496 Saccharomyces...   102   4e-24
ABR009W [600] [Homologous to ScYHL003C (LAG1) - SH; ScYKL008C (L...   101   9e-24
Kwal_47.18842                                                          28   9.0  

>Kwal_27.11489
          Length = 357

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/353 (92%), Positives = 327/353 (92%)

Query: 1   MSSELKHRKNHEAHEPKIPRDPAVPKPAVRRQKKVASRVDQYSCLLSAAFLAILYLVGQV 60
           MSSELKHRKNHEAHEPKIPRDPAVPKPAVRRQKKVASRVDQYSCLLSAAFLAILYLVGQV
Sbjct: 1   MSSELKHRKNHEAHEPKIPRDPAVPKPAVRRQKKVASRVDQYSCLLSAAFLAILYLVGQV 60

Query: 61  KPELTHKFTTLQYQYVXXXXXXXXXXXXXXXVVTCIVALVLVRSFLLEYVLKPIALHKFH 120
           KPELTHKFTTLQYQYV               VVTCIVALVLVRSFLLEYVLKPIALHKFH
Sbjct: 61  KPELTHKFTTLQYQYVDAPDAYDIGIDDAYIVVTCIVALVLVRSFLLEYVLKPIALHKFH 120

Query: 121 IRSHKSQQRYAEQGWSLVYYTFSWVLGFYLYYNSPYFLNCDHIYLGWPHDRFSATFKIYY 180
           IRSHKSQQRYAEQGWSLVYYTFSWVLGFYLYYNSPYFLNCDHIYLGWPHDRFSATFKIYY
Sbjct: 121 IRSHKSQQRYAEQGWSLVYYTFSWVLGFYLYYNSPYFLNCDHIYLGWPHDRFSATFKIYY 180

Query: 181 LLQIASWLQQIVVLNVEERRKDYWQMFAHHIITCLLTLGSYYYYFNRIGHLILIMMDIVD 240
           LLQIASWLQQIVVLNVEERRKDYWQMFAHHIITCLLTLGSYYYYFNRIGHLILIMMDIVD
Sbjct: 181 LLQIASWLQQIVVLNVEERRKDYWQMFAHHIITCLLTLGSYYYYFNRIGHLILIMMDIVD 240

Query: 241 VFLSSAKMLKYCGFTTACDYMFAVFLVFWVLLRHIAYNYIFYHAGTKAPGLMSHGQCMAS 300
           VFLSSAKMLKYCGFTTACDYMFAVFLVFWVLLRHIAYNYIFYHAGTKAPGLMSHGQCMAS
Sbjct: 241 VFLSSAKMLKYCGFTTACDYMFAVFLVFWVLLRHIAYNYIFYHAGTKAPGLMSHGQCMAS 300

Query: 301 AVQKRCWTPLIIDVFLWLLGGLQVITIIWMAXXXXXXXXXXXGGSAEDVRSDA 353
           AVQKRCWTPLIIDVFLWLLGGLQVITIIWMA           GGSAEDVRSDA
Sbjct: 301 AVQKRCWTPLIIDVFLWLLGGLQVITIIWMALIIKVLIKILKGGSAEDVRSDA 353

>Sklu_2251.8 , Contig c2251 7738-8817 reverse complement
          Length = 359

 Score =  469 bits (1208), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 237/355 (66%), Positives = 265/355 (74%), Gaps = 4/355 (1%)

Query: 1   MSSELKHRKNHEAHEPK---IPRDPAVPKPAVRRQKKVASRVDQYSCLLSAAFLAILYLV 57
           MS EL+ R + +A +PK                 Q+KVAS+VDQYS  LS   L+ LYL+
Sbjct: 1   MSGELRQRPSAQA-QPKHVSSHEHKEKHHSHHTMQRKVASKVDQYSVALSILMLSFLYLL 59

Query: 58  GQVKPELTHKFTTLQYQYVXXXXXXXXXXXXXXXVVTCIVALVLVRSFLLEYVLKPIALH 117
              KP+ ++KFT LQYQY                V+T IVALVLVRSFLLEYVLKPIA +
Sbjct: 60  HCFKPQYSYKFTHLQYQYASAPGRYDIGIDDTYMVMTFIVALVLVRSFLLEYVLKPIAFY 119

Query: 118 KFHIRSHKSQQRYAEQGWSLVYYTFSWVLGFYLYYNSPYFLNCDHIYLGWPHDRFSATFK 177
           KF I S+KSQQRYAEQGWSL YY+FSW  GFYLYYNSPYFLNCDHIYLGWPHD+ S TFK
Sbjct: 120 KFKIHSNKSQQRYAEQGWSLAYYSFSWCFGFYLYYNSPYFLNCDHIYLGWPHDKLSGTFK 179

Query: 178 IYYLLQIASWLQQIVVLNVEERRKDYWQMFAHHIITCLLTLGSYYYYFNRIGHLILIMMD 237
           +YYLLQIASWLQQI+VLNVEERRKD+WQMFAHHIITCLLT GSYYYYF RIGH+ILI+MD
Sbjct: 180 VYYLLQIASWLQQIIVLNVEERRKDHWQMFAHHIITCLLTTGSYYYYFTRIGHVILILMD 239

Query: 238 IVDVFLSSAKMLKYCGFTTACDYMFAVFLVFWVLLRHIAYNYIFYHAGTKAPGLMSHGQC 297
           IVDV LSSAKMLKYCGF+TACDYMF +FLVFWV LRH  YNY+FYHA  KA  LM+ G+C
Sbjct: 240 IVDVLLSSAKMLKYCGFSTACDYMFVIFLVFWVALRHGIYNYVFYHAWAKARDLMAMGRC 299

Query: 298 MASAVQKRCWTPLIIDVFLWLLGGLQVITIIWMAXXXXXXXXXXXGGSAEDVRSD 352
             +  QKRCWTP +IDVFL LLGGLQVITIIWM            G  AEDVRSD
Sbjct: 300 GLTPDQKRCWTPFVIDVFLGLLGGLQVITIIWMFLIVKVLIKVIKGAGAEDVRSD 354

>KLLA0E08129g complement(736008..737117) weakly similar to sp|P28496
           Saccharomyces cerevisiae YKL008c LAC1 protein required
           with LAG1P for ER-to-Golgi transport of GPI-anchored
           proteins P2.313.f2.1, hypothetical start
          Length = 369

 Score =  388 bits (997), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 197/362 (54%), Positives = 243/362 (67%), Gaps = 10/362 (2%)

Query: 1   MSSELKHRKNHEAHEPKIPRDPAVPKPAV----------RRQKKVASRVDQYSCLLSAAF 50
           MSSEL+ R +  +  P +       K             +   K  S+VD+YS LLS+  
Sbjct: 1   MSSELRQRHSSGSAAPSLTEHRFDEKKQARSRSRTGSSSKHHFKPVSKVDRYSVLLSSIL 60

Query: 51  LAILYLVGQVKPELTHKFTTLQYQYVXXXXXXXXXXXXXXXVVTCIVALVLVRSFLLEYV 110
           L++L++     PE T KF  LQY+Y                ++T IV   LVRSFLLE+V
Sbjct: 61  LSLLFVGNSFYPEYTKKFVNLQYEYPDNPGKYDIGIDDGYVILTFIVVFCLVRSFLLEFV 120

Query: 111 LKPIALHKFHIRSHKSQQRYAEQGWSLVYYTFSWVLGFYLYYNSPYFLNCDHIYLGWPHD 170
           LKP+  ++FH+RS KS QR+ EQGWS++YY FSW+ GFYLYY+SPY+ N DHIY GWPHD
Sbjct: 121 LKPVGRNRFHMRSVKSLQRFGEQGWSMIYYLFSWIFGFYLYYHSPYYFNIDHIYSGWPHD 180

Query: 171 RFSATFKIYYLLQIASWLQQIVVLNVEERRKDYWQMFAHHIITCLLTLGSYYYYFNRIGH 230
           + S  FK YYL QIASW  QI+VLNVEERRKD+WQMFAHHIIT  LT GSYYYYF RIG+
Sbjct: 181 QLSGLFKTYYLFQIASWFHQIIVLNVEERRKDFWQMFAHHIITVALTTGSYYYYFTRIGN 240

Query: 231 LILIMMDIVDVFLSSAKMLKYCGFTTACDYMFAVFLVFWVLLRHIAYNYIFYHAGTKAPG 290
           +ILI+MDIVDV LS AKMLKYCG++T CDYMF VFL +WV+LRH+ YNY+ Y    +A  
Sbjct: 241 VILILMDIVDVLLSFAKMLKYCGYSTLCDYMFVVFLFWWVMLRHVVYNYLTYQTWLRAKN 300

Query: 291 LMSHGQCMASAVQKRCWTPLIIDVFLWLLGGLQVITIIWMAXXXXXXXXXXXGGSAEDVR 350
           LM+ G+C+A   QKRCWTP ++++FL LLGGLQVIT IWM            G  AEDVR
Sbjct: 301 LMADGECIAGLAQKRCWTPTVVNIFLALLGGLQVITCIWMYLILKVLVKVIKGIGAEDVR 360

Query: 351 SD 352
           SD
Sbjct: 361 SD 362

>ADL206W [1535] [Homologous to ScYHL003C (LAG1) - NSH]
           complement(340558..341676) [1119 bp, 372 aa]
          Length = 372

 Score =  384 bits (987), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 191/322 (59%), Positives = 225/322 (69%)

Query: 31  RQKKVASRVDQYSCLLSAAFLAILYLVGQVKPELTHKFTTLQYQYVXXXXXXXXXXXXXX 90
           R +   S+VD Y+   S A L  L +    +     KF  LQY  V              
Sbjct: 48  RGQLAVSKVDLYTVYASGALLVALAVGFLRQAAWCDKFLRLQYASVESPGKYDIGIDDAY 107

Query: 91  XVVTCIVALVLVRSFLLEYVLKPIALHKFHIRSHKSQQRYAEQGWSLVYYTFSWVLGFYL 150
            V T +V L LVRS LLE+VLKP+A +KF I S K QQRY EQ WS++YYT SWV GFYL
Sbjct: 108 IVGTFVVVLCLVRSSLLEFVLKPLAHYKFRISSGKIQQRYGEQSWSMLYYTASWVTGFYL 167

Query: 151 YYNSPYFLNCDHIYLGWPHDRFSATFKIYYLLQIASWLQQIVVLNVEERRKDYWQMFAHH 210
           YY+SPYFLNCDHIYL WPHD+ +  FK+YYL+QIASWLQQI+VLNVEE+RKDYWQMFAHH
Sbjct: 168 YYHSPYFLNCDHIYLNWPHDKMAGVFKVYYLVQIASWLQQIIVLNVEEKRKDYWQMFAHH 227

Query: 211 IITCLLTLGSYYYYFNRIGHLILIMMDIVDVFLSSAKMLKYCGFTTACDYMFAVFLVFWV 270
           IIT  LT GSYYYYFNRIGH+ILI+MD+VD+ LSSAK+LKYCGF+ ACDYMF VFL FWV
Sbjct: 228 IITVALTTGSYYYYFNRIGHVILIIMDVVDILLSSAKILKYCGFSVACDYMFVVFLGFWV 287

Query: 271 LLRHIAYNYIFYHAGTKAPGLMSHGQCMASAVQKRCWTPLIIDVFLWLLGGLQVITIIWM 330
           +LRH  YNYI +HA  K+ GLM + +C   A   RCWTPL+ID+F+ LL GLQ+IT+IW 
Sbjct: 288 VLRHGVYNYILHHAWAKSRGLMQNQRCGVHAPGTRCWTPLVIDIFVLLLAGLQLITVIWS 347

Query: 331 AXXXXXXXXXXXGGSAEDVRSD 352
                       G  AEDVRSD
Sbjct: 348 FLIVKVFMKVIRGSGAEDVRSD 369

>YHL003C (LAG1) [2282] chr8 complement(100643..101878) Protein
           required with Lac1p for ceramide synthesis and
           ER-to-Golgi transport of GPI-anchored proteins,
           indirectly affects cell longevity [1236 bp, 411 aa]
          Length = 411

 Score =  123 bits (308), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 94/313 (30%), Positives = 154/313 (49%), Gaps = 13/313 (4%)

Query: 44  CLLSAAFLAILYLVGQVKPELTHKFTTLQYQYVXXXXXXXXXXXXXXXVVTCIVALVLVR 103
           C+ SA FL+      + +    H F  + YQ V               V   ++    +R
Sbjct: 93  CVYSAYFLS----GNRTESNPLHMFVAISYQ-VDGTDSYAKGIKDLSFVFFYMIFFTFLR 147

Query: 104 SFLLEYVLKPIALHKFHIRSHKSQQRYAEQGWSLVYYTFSWVLGFYLYYNSPYFL-NCDH 162
            FL++ V++P  ++  ++ S   Q+R  EQ +++ Y   S   G Y+ Y+S  +L     
Sbjct: 148 EFLMDVVIRPFTVY-LNVTSEHRQKRMLEQMYAIFYCGVSGPFGLYIMYHSDLWLFKTKP 206

Query: 163 IYLGWPHDRFSATFKIYYLLQIASWLQQ--IVVLNVEERRKDYWQMFAHHIITCLLTLGS 220
           +Y  +P       FKI+YL Q A W QQ  ++VL +E+ RKDY ++  HHI+T LL   S
Sbjct: 207 MYRTYPVITNPFLFKIFYLGQAAFWAQQACVLVLQLEKPRKDYKELVFHHIVTLLLIWSS 266

Query: 221 YYYYFNRIGHLILIMMDIVDVFLSSAKMLKYCGFTTACDYMFAVFLVFWVLLRHIAYNYI 280
           Y ++F ++G  I I MD+ D FLS +K L Y   +    ++F +F+ FW+ LRH+    I
Sbjct: 267 YVFHFTKMGLAIYITMDVSDFFLSLSKTLNYLN-SVFTPFVFGLFVFFWIYLRHVVNIRI 325

Query: 281 FYHAGTKAPGLMSHGQCMASAVQKRCWTPLIIDVFLWLLGGLQVITIIWMAXXXXXXXXX 340
            +   T+     ++    A+  Q +CW  L I VF+ L+  LQ++ + W+          
Sbjct: 326 LWSVLTEFRHEGNYVLNFATQ-QYKCWISLPI-VFV-LIAALQLVNLYWLFLILRILYRL 382

Query: 341 XXGGSAEDVRSDA 353
              G  +D RSD+
Sbjct: 383 IWQGIQKDERSDS 395

>CAGL0M10219g complement(1020895..1022088) similar to sp|P28496
           Saccharomyces cerevisiae YKL008c protein required with
           LAG1 or sp|P38703 Saccharomyces cerevisiae YHL003c LAG1,
           hypothetical start
          Length = 397

 Score =  122 bits (307), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 96/362 (26%), Positives = 169/362 (46%), Gaps = 29/362 (8%)

Query: 11  HEAHEPKIPRDPAVPKPAVRRQKKVASRV----DQYS---------CLLSAAFLAILYLV 57
           HE+   K+       + A +R  K+ +++      Y+         C+L   + A   + 
Sbjct: 32  HESKASKVAAKRRHERLATQRNLKMTTKLYLKARDYNYHHMWFLPLCILILTYAAYFGIS 91

Query: 58  GQVKPELTHKFTTLQYQYVXXXXXXXXXXXXXXXVVTCIVALVLVRSFLLEYVLKPIALH 117
            +      H F  + Y+                 V   ++    +R FL++ +++ I   
Sbjct: 92  NKRVKGFLHMFVAISYEQESNPQYYGKGIKDLAFVFFHMIFFTFLREFLMDVIIRRIT-Q 150

Query: 118 KFHIRSHKSQQRYAEQGWSLVYYTFSWVLGFYLYYNSP-YFLNCDHIYLGWPHDRFSATF 176
             +I S    +R  EQ +S+ YY FS   G Y+ Y+S  ++   + +Y  +P       F
Sbjct: 151 WLNITSKYKIKRMMEQMFSIFYYGFSSPFGVYVMYHSDLWYFRTNTMYNTYPDILIPKLF 210

Query: 177 KIYYLLQIASWLQQ--IVVLNVEERRKDYWQMFAHHIITCLLTLGSYYYYFNRIGHLILI 234
           K +YL+Q A W QQ  ++VL +E+ RKD+ ++  HH++T LL   SY ++F+++G  + I
Sbjct: 211 KAFYLIQAAFWAQQAFVLVLQLEKPRKDHKELCFHHVVTLLLIWSSYVFHFHKMGLAVYI 270

Query: 235 MMDIVDVFLSSAKMLKYCGFTTACDYMFAVFLVFWVLLRHIAYNYIFYHA----GTKAPG 290
            MD+ D FL+ +K L Y   +   + +F +F++ W+ LRH+    I +       T+ P 
Sbjct: 271 TMDVSDFFLALSKTLNYID-SPLTEVVFGMFVLVWIYLRHVINGKILWSVLTEFRTEGPY 329

Query: 291 LMSHGQCMASAVQKRCWTPLIIDVFLWLLGGLQVITIIWMAXXXXXXXXXXXGGSAEDVR 350
           +++      +  Q +CW  L I VF+ L+  LQV+ I W+             G  EDVR
Sbjct: 330 ILNF-----ATQQYKCWISLPI-VFV-LIFALQVLNIYWLFLIFKVLYKIVWQGVTEDVR 382

Query: 351 SD 352
           SD
Sbjct: 383 SD 384

>Scas_668.20
          Length = 425

 Score =  122 bits (307), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 91/263 (34%), Positives = 132/263 (50%), Gaps = 12/263 (4%)

Query: 96  IVALVLVRSFLLEYVLKPIALHKFHIRSHKSQQRYAEQGWSLVYYTFSWVLGFYLYYNSP 155
           ++    +R FLL+ VL+PI     H  S    +R  EQ + +VYY FS   G Y+ Y+S 
Sbjct: 151 MIFFTFLREFLLDVVLRPIP-DILHANSKHKSKRIIEQMFYIVYYGFSAPFGLYVMYHSN 209

Query: 156 YFL-NCDHIYLGWPHDRFSATFKIYYLLQIASWLQQ--IVVLNVEERRKDYWQMFAHHII 212
            +L     +Y  +P       FK++YL Q A W QQ  ++VL +E+ RKD+ +M  HHI+
Sbjct: 210 LWLFKTAPMYETYPDLTNPFLFKVFYLGQAAFWAQQACVLVLQLEKPRKDHQEMIFHHIV 269

Query: 213 TCLLTLGSYYYYFNRIGHLILIMMDIVDVFLSSAKMLKYCG--FTTACDYMFAVFLVFWV 270
           T LL   SY ++F RIG  I I MDI D  LS +K+  Y    FT     +F +F+  W+
Sbjct: 270 TLLLVWSSYVFHFTRIGLAIYITMDISDFLLSLSKIFNYLDSPFTPP---VFFIFVTTWI 326

Query: 271 LLRHIAYNYIFYHAGTKAPGLMSHGQCMASAVQKRCWTPLIIDVFLWLLGGLQVITIIWM 330
            LRH     I +   T+   +  +    A+  Q +CW  L I VF  L+  LQ++ + W+
Sbjct: 327 YLRHYINIKILWSVLTEFRTVGDYVLDFATQ-QYKCWISLPI-VFT-LIAALQLVNLYWL 383

Query: 331 AXXXXXXXXXXXGGSAEDVRSDA 353
                        G  ED RSD 
Sbjct: 384 FLIFRILYRMVWKGIVEDTRSDT 406

>YKL008C (LAC1) [3248] chr11 complement(426938..428194) Protein
           required with Lag1p for ceramide synthesis and
           ER-to-Golgi transport of GPI-anchored proteins [1257 bp,
           418 aa]
          Length = 418

 Score =  118 bits (295), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 89/289 (30%), Positives = 146/289 (50%), Gaps = 9/289 (3%)

Query: 45  LLSAAFLAILYLVGQVKPELTHKFTTLQYQYVXXXXXXXXXXXXXXXVVTCIVALVLVRS 104
           +L A + A        K  + H+F  + YQ +               V   ++    +R 
Sbjct: 90  ILIAVYSAYFTSGNTTKTNVLHRFVAVSYQ-IGDTNAYGKGINDLCFVFYYMIFFTFLRE 148

Query: 105 FLLEYVLKPIALHKFHIRSHKSQQRYAEQGWSLVYYTFSWVLGFY-LYYNSPYFLNCDHI 163
           FL++ V++P A+ + H+ S    +R  EQ +++ Y   S   G Y +Y++  +F N   +
Sbjct: 149 FLMDVVIRPFAI-RLHVTSKHRIKRIMEQMYAIFYTGVSGPFGIYCMYHSDLWFFNTKAM 207

Query: 164 YLGWPHDRFSATFKIYYLLQIASWLQQ--IVVLNVEERRKDYWQMFAHHIITCLLTLGSY 221
           Y  +P       FK++YL Q A W QQ  I+VL +E+ RKD+ ++  HHI+T LL   SY
Sbjct: 208 YRTYPDFTNPFLFKVFYLGQAAFWAQQACILVLQLEKPRKDHNELTFHHIVTLLLIWSSY 267

Query: 222 YYYFNRIGHLILIMMDIVDVFLSSAKMLKYCGFTTACDYMFAVFLVFWVLLRHIAYNYIF 281
            ++F ++G  I I MD+ D  LS +K L Y     A  + FA+F+V W+ LRH     I 
Sbjct: 268 VFHFTKMGLPIYITMDVSDFLLSFSKTLNYLDSGLAF-FSFAIFVVAWIYLRHYINLKIL 326

Query: 282 YHAGTKAPGLMSHGQCMASAVQKRCWTPLIIDVFLWLLGGLQVITIIWM 330
           +   T+     ++    A+  Q +CW  L I VF+ L+G LQ++ + W+
Sbjct: 327 WSVLTQFRTEGNYVLNFATQ-QYKCWISLPI-VFV-LIGALQLVNLYWL 372

>Scas_717.23
          Length = 430

 Score =  114 bits (285), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 79/258 (30%), Positives = 132/258 (51%), Gaps = 8/258 (3%)

Query: 96  IVALVLVRSFLLEYVLKPIALHKFHIRSHKSQQRYAEQGWSLVYYTFSWVLGFYLYYNSP 155
           ++    +R F+++ V++PI + K ++ S    +R  EQ + ++YY  S   G Y+ YN+ 
Sbjct: 146 MIFFTFLREFMMDMVIRPITI-KLNVTSGHKMKRIMEQAFYIIYYGISGPFGLYIMYNTD 204

Query: 156 YFL-NCDHIYLGWPHDRFSATFKIYYLLQIASWLQQ--IVVLNVEERRKDYWQMFAHHII 212
            +L     +Y  +P    +  +K++YL Q A W QQ  ++VL +E+ RKD+ ++  HHI+
Sbjct: 205 LWLFETKTMYQTYPDFNNTFLYKLFYLGQAAFWAQQACVLVLQLEKPRKDFKELVFHHIV 264

Query: 213 TCLLTLGSYYYYFNRIGHLILIMMDIVDVFLSSAKMLKYCGFTTACDYMFAVFLVFWVLL 272
           T LL   SY ++F R+G  I I MD+ D FL+  K + Y   +     +F  F+V W+ L
Sbjct: 265 TLLLIWSSYTFHFTRMGLAIYITMDVSDFFLALTKTVNYLD-SKFTPPIFFTFIVVWIYL 323

Query: 273 RHIAYNYIFYHAGTKAPGLMSHGQCMASAVQKRCWTPLIIDVFLWLLGGLQVITIIWMAX 332
           RH     I +   T+     ++    A+  Q +CW  L I VF  L+  LQV+ + W+  
Sbjct: 324 RHYVNIKILWSVLTEFRTEGNYVLNFATQ-QYKCWISLPI-VFT-LIFALQVVNLYWLFL 380

Query: 333 XXXXXXXXXXGGSAEDVR 350
                      G  +D R
Sbjct: 381 IFRILYRLIFTGVQKDER 398

>CAGL0K02739g complement(246652..247947) highly similar to sp|P38703
           Saccharomyces cerevisiae YHL003c longevity-assurance
           protein, hypothetical start
          Length = 431

 Score =  113 bits (283), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 85/263 (32%), Positives = 135/263 (51%), Gaps = 12/263 (4%)

Query: 96  IVALVLVRSFLLEYVLKPIALHKFHIRSHKSQQRYAEQGWSLVYYTFSWVLGFYLYYNSP 155
           ++    +R FL++ V++PI     +I S    +R  EQ ++L Y   S   G Y+ Y+S 
Sbjct: 147 MIFFTFLREFLMDVVIRPIT-RILNITSRHKVKRMMEQMYALFYCGCSGPFGLYIMYHSD 205

Query: 156 YFL-NCDHIYLGWPHDRFSATFKIYYLLQIASWLQQ--IVVLNVEERRKDYWQMFAHHII 212
            +L     +Y  +P       +K++YL Q A W QQ  ++VL +E  RKDY ++  HHI+
Sbjct: 206 LWLFKTKEMYNSYPDFTNPFLYKVFYLGQAAFWSQQACVLVLQLERPRKDYKELVFHHIV 265

Query: 213 TCLLTLGSYYYYFNRIGHLILIMMDIVDVFLSSAKMLKYCG--FTTACDYMFAVFLVFWV 270
           T LL   SY ++F ++G  I I MDI D FLS +K+L Y    FT     +F VF+  W+
Sbjct: 266 TLLLIWSSYVFHFTKMGLSIYITMDISDFFLSLSKILNYLDSIFTPP---VFLVFVGSWI 322

Query: 271 LLRHIAYNYIFYHAGTKAPGLMSHGQCMASAVQKRCWTPLIIDVFLWLLGGLQVITIIWM 330
            LRH+    I +   T+     ++    A++ Q +CW    I VF+ L+  LQ++ + W+
Sbjct: 323 YLRHVVNIRILWSVLTEFKTEGNYVLNFATS-QYKCWISQPI-VFV-LIFALQLVNLYWL 379

Query: 331 AXXXXXXXXXXXGGSAEDVRSDA 353
                        G  +D RSD+
Sbjct: 380 FLIFKILLRLIFKGEQKDERSDS 402

>Kwal_26.7886
          Length = 422

 Score =  112 bits (280), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 83/265 (31%), Positives = 132/265 (49%), Gaps = 8/265 (3%)

Query: 92  VVTCIVALVLVRSFLLEYVLKPIALHKFHIRSHKSQQRYAEQGWSLVYYTFSWVLGFYLY 151
           V+  ++    +R FL+E  L+P+A     +  HK+  R  EQ +S++YY  S   G Y+ 
Sbjct: 130 VIFYMIFFTFLREFLMEVALRPLASALGVVSQHKTN-RIMEQTYSIIYYGISGPFGLYIM 188

Query: 152 YNSPYFL-NCDHIYLGWPHDRFSATFKIYYLLQIASWLQQ--IVVLNVEERRKDYWQMFA 208
           Y+S  +L     +Y  +P        K++YL Q A W QQ  I+ L +E+ RKD+ ++  
Sbjct: 189 YHSDLWLFKTAPMYATYPDLTNQFMTKVFYLGQAAFWTQQACILTLQLEKPRKDFKELVF 248

Query: 209 HHIITCLLTLGSYYYYFNRIGHLILIMMDIVDVFLSSAKMLKYCGFTTACDYMFAVFLVF 268
           HHI+T  L   SY ++F  +G  + I MD+ D FLS +K L Y     A  + F +F+  
Sbjct: 249 HHIVTLALIWLSYVFHFTNMGLAVYITMDVSDFFLSLSKTLNYLDSALAAPF-FMLFVCS 307

Query: 269 WVLLRHIAYNYIFYHAGTKAPGLMSHGQCMASAVQKRCWTPLIIDVFLWLLGGLQVITII 328
           WV LRH     I +   T+   +  +    A+  Q +CW  L I VF  L+  LQ++ + 
Sbjct: 308 WVYLRHYINIKILWSVLTEFRTIGDYTLNFATQ-QYKCWISLPI-VFT-LISALQLVNLY 364

Query: 329 WMAXXXXXXXXXXXGGSAEDVRSDA 353
           W+             G  +D RS++
Sbjct: 365 WLFLIVRVLYRILFQGIQKDDRSES 389

>Sklu_2243.4 YHL003C, Contig c2243 7329-8558
          Length = 409

 Score =  105 bits (263), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 124/239 (51%), Gaps = 12/239 (5%)

Query: 96  IVALVLVRSFLLEYVLKPIALHKFHIRSHKSQQRYAEQGWSLVYYTFSWVLGFYLYYNSP 155
           ++    +R FL+E +L+P+++ K  I      +R  EQ +S++YY  S   G Y+ Y + 
Sbjct: 135 MIFFTFLREFLMELLLRPLSI-KLGITKEHKIRRMMEQAYSIIYYGISGPFGLYIMYQTD 193

Query: 156 YFLNCDH-IYLGWPHDRFSATFKIYYLLQIASWLQQ--IVVLNVEERRKDYWQMFAHHII 212
            +L     +Y  +P       +KI+YL Q + W QQ  ++VL +E+ RKD+ ++  HHII
Sbjct: 194 LWLFATAPMYKTYPDMTNEYLYKIFYLGQASFWTQQACVLVLQLEKPRKDFKELVFHHII 253

Query: 213 TCLLTLGSYYYYFNRIGHLILIMMDIVDVFLSSAKMLKYCGFTTACDYMFAVFLVFWVLL 272
           T  L   SY ++F ++G  + I MD+ D FL+ +K   Y   T    + F +F+V W+ L
Sbjct: 254 TLALIWLSYVFHFTKMGLAVYITMDVSDFFLALSKTFNYLDSTLTAPFFF-LFVVSWIYL 312

Query: 273 RHIAYNYIFYHAGTKAPGLMSHGQCMASAVQKRCW--TPLIIDVFLWLLGGLQVITIIW 329
           RH     I +   T+   +  +    A+  Q +CW   P++      L+  LQ++ + W
Sbjct: 313 RHYVNIKILWSVLTEFRTVGDYTLNFATQ-QYKCWISQPIVFA----LIFALQLVNLYW 366

>KLLA0B13497g 1181036..1182262 similar to sp|P28496 Saccharomyces
           cerevisiae YKL008c LAC1 protein required with LAG1P for
           ER-to-Golgi transport of GPI-anchored proteins,
           hypothetical start
          Length = 408

 Score =  102 bits (254), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 65/215 (30%), Positives = 115/215 (53%), Gaps = 6/215 (2%)

Query: 96  IVALVLVRSFLLEYVLKPIALHKFHIRSHKSQQRYAEQGWSLVYYTFSWVLGFYLYYNSP 155
           ++    +R F+++ +L+P+++     R +K + R  EQ +S+ YY+ S   G Y+ Y++ 
Sbjct: 134 MIFFTFLREFIMQVILRPLSIKMGSTRENKIR-RMMEQMYSIFYYSISGPFGLYIMYHTD 192

Query: 156 YFL-NCDHIYLGWPHDRFSATFKIYYLLQIASWLQQ--IVVLNVEERRKDYWQMFAHHII 212
            +L   D +Y  +P       +KI+YL Q A W QQ  ++ L +E+ RKD+ ++  HHI+
Sbjct: 193 LWLFRTDTMYKTYPDFNNEYLYKIFYLGQAAFWTQQSCVLTLQLEKPRKDFQELIFHHIV 252

Query: 213 TCLLTLGSYYYYFNRIGHLILIMMDIVDVFLSSAKMLKYCGFTTACDYMFAVFLVFWVLL 272
           T  L   SY ++F ++G  + + MD+ D FLS +K   Y   ++     F  F+V WV L
Sbjct: 253 TLALIWLSYVFHFTKMGLSVYVTMDVSDFFLSLSKTFNYLD-SSLTPPFFLFFIVSWVYL 311

Query: 273 RHIAYNYIFYHAGTKAPGLMSHGQCMASAVQKRCW 307
           RH     I +   T+   + ++    A+  Q +CW
Sbjct: 312 RHYINLKILWSLLTEFTTVGNYTLNFATQ-QYKCW 345

>ABR009W [600] [Homologous to ScYHL003C (LAG1) - SH; ScYKL008C
           (LAC1) - SH] complement(408462..409703) [1242 bp, 413
           aa]
          Length = 413

 Score =  101 bits (251), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 79/260 (30%), Positives = 127/260 (48%), Gaps = 12/260 (4%)

Query: 96  IVALVLVRSFLLEYVLKPIALHKFHIRSHKSQQRYAEQGWSLVYYTFSWVLGFYLYYNSP 155
           +V    +R F++E VL+P+       + HK + R  EQ +S  YY  S   G ++ Y + 
Sbjct: 136 MVFFTFLREFMMEMVLRPLTFRLGVTKPHKVK-RMMEQAYSTFYYGLSGPFGLFVMYRTD 194

Query: 156 YFL-NCDHIYLGWPHDRFSATFKIYYLLQIASWLQQ--IVVLNVEERRKDYWQMFAHHII 212
            +L     +Y  +P       +KI+YL Q A W QQ  I+VL +E+ RKD+ ++  HHI+
Sbjct: 195 LWLFKTAEMYKTYPDLTNEYYYKIFYLGQAAFWAQQACILVLQLEKPRKDFRELVFHHIV 254

Query: 213 TCLLTLGSYYYYFNRIGHLILIMMDIVDVFLSSAKMLKY--CGFTTACDYMFAVFLVFWV 270
           T  L   SY ++F ++G  + I MD+ D FL+ +K+  Y    FT     +F +F+  WV
Sbjct: 255 TLALISLSYVFHFTKMGLAVYITMDVSDFFLALSKIFNYMESSFTAP---LFLLFVSSWV 311

Query: 271 LLRHIAYNYIFYHAGTKAPGLMSHGQCMASAVQKRCWTPLIIDVFLWLLGGLQVITIIWM 330
            LRH     I +   T+   +  +    A+  Q + W  L I VF  L+  L ++ + W+
Sbjct: 312 YLRHYVNIKILWSVLTEFRTVGDYTLNFATE-QYKSWIALPI-VF-GLIFALHLVNLYWL 368

Query: 331 AXXXXXXXXXXXGGSAEDVR 350
           A            G  +D R
Sbjct: 369 ALIFRILYRMLFQGVQKDER 388

>Kwal_47.18842
          Length = 508

 Score = 28.5 bits (62), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 51/112 (45%), Gaps = 15/112 (13%)

Query: 156 YFLNCDHIYLGWPHDRFSATFKIYYLLQIASWLQQIVVLNVEERRKDYWQMFAHHIITCL 215
           ++++  +I   +    FS + +   LL + S  Q ++    + R K ++     H  TC+
Sbjct: 121 FYISTSYIVWTYQSHLFSNSLETIALLVVLSLFQTLIQ---DSRDKQFY-----HYKTCI 172

Query: 216 -LTLGSYYYYFNRIGHLILIMMDIVDV----FLSSAKMLKYCG--FTTACDY 260
            L L   + +FNRI  L  I++ I+      FL   K L  C   F +AC +
Sbjct: 173 ALGLVVAFGFFNRITFLAFIVLPIIPTFNAFFLHHFKSLMVCAISFISACAF 224

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.330    0.141    0.461 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,470,618
Number of extensions: 408764
Number of successful extensions: 1208
Number of sequences better than 10.0: 17
Number of HSP's gapped: 1182
Number of HSP's successfully gapped: 17
Length of query: 353
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 250
Effective length of database: 13,030,455
Effective search space: 3257613750
Effective search space used: 3257613750
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 62 (28.5 bits)