Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_27.1131430530115250.0
AGL163W402831054e-05
Scas_506.2113779810.041
KLLA0E15774g114854681.7
YJL154C (VPS35)94457672.3
KLLA0F21692g152536672.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.11314
         (301 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.11314                                                         592   0.0  
AGL163W [4149] [Homologous to NOHBY] complement(391065..392273) ...    45   4e-05
Scas_506.2                                                             36   0.041
KLLA0E15774g 1402940..1406386 similar to sp|P17442 Saccharomyces...    31   1.7  
YJL154C (VPS35) [2767] chr10 complement(131019..133853) Protein ...    30   2.3  
KLLA0F21692g complement(2014152..2018729) gi|14571818|gb|AAK6729...    30   2.3  

>Kwal_27.11314
          Length = 305

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/301 (96%), Positives = 289/301 (96%)

Query: 1   MNNGYEWSEEAKKLLKFRDQKLRKLDQETNEDSLQQKRSLIEKRIAEAAREHRQNEDAFA 60
           MNNGYEWSEEAKKLLKFRDQKLRKLDQETNEDSLQQKRSLIEKRIAEAAREHRQNEDAFA
Sbjct: 1   MNNGYEWSEEAKKLLKFRDQKLRKLDQETNEDSLQQKRSLIEKRIAEAAREHRQNEDAFA 60

Query: 61  HGRLDLVSSEYLKAMCVDYSELKTAGVAYRHKKLDVDSKLPDLRTSDREESRSPGREVVT 120
           HGRLDLVSSEYLKAMCVDYSELKTAGVAYRHKKLDVDSKLPDLRTSDREESRSPGREVVT
Sbjct: 61  HGRLDLVSSEYLKAMCVDYSELKTAGVAYRHKKLDVDSKLPDLRTSDREESRSPGREVVT 120

Query: 121 MERLVSKELDNDRGSEKIHHVSKEAELVINAKKNTELIKSMLEPRAGPGGNRNAYHSSEN 180
           MERLVSKELDNDRGSEKIHHVSKEAELVINAKKNTELIKSMLEPRAGPGGNRNAYHSSEN
Sbjct: 121 MERLVSKELDNDRGSEKIHHVSKEAELVINAKKNTELIKSMLEPRAGPGGNRNAYHSSEN 180

Query: 181 LESIGVFEGSIEQKNYPLPVPSFTRVADLQPQTSPPQFESFSNYPYPGSMXXXXXXXXXX 240
           LESIGVFEGSIEQKNYPLPVPSFTRVADLQPQTSPPQFESFSNYPYPGSM          
Sbjct: 181 LESIGVFEGSIEQKNYPLPVPSFTRVADLQPQTSPPQFESFSNYPYPGSMPPFQPVPYQQ 240

Query: 241 XXHTQPLNVHGQPQFNYDQPAMELKKTRTGTLPPRNNAEVHKGPTRSKAPKALRKMENIA 300
             HTQPLNVHGQPQFNYDQPAMELKKTRTGTLPPRNNAEVHKGPTRSKAPKALRKMENIA
Sbjct: 241 PQHTQPLNVHGQPQFNYDQPAMELKKTRTGTLPPRNNAEVHKGPTRSKAPKALRKMENIA 300

Query: 301 R 301
           R
Sbjct: 301 R 301

>AGL163W [4149] [Homologous to NOHBY] complement(391065..392273)
          [1209 bp, 402 aa]
          Length = 402

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 43/83 (51%), Gaps = 6/83 (7%)

Query: 4  GYEWSEEAKKLLKFRDQKLRKL-DQETNEDSLQQKRSLIEKRIAEAAREHRQNEDAFAHG 62
          G+++ +E  KL   R +    L D +T +  LQ     IE R+ +  R +RQN   FA G
Sbjct: 18 GFDFEQEFDKLALLRQKAFDALSDHDTRKKRLQ-----IELRLRQKYRRYRQNAAYFAKG 72

Query: 63 RLDLVSSEYLKAMCVDYSELKTA 85
          R D V  +YL ++ +   +L+ A
Sbjct: 73 RFDKVDMDYLNSVIMSNDQLRAA 95

>Scas_506.2
          Length = 1137

 Score = 35.8 bits (81), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 2/79 (2%)

Query: 4  GYEWSEEAKKLLKFRDQKLRKLDQETNEDSLQQKRSLIEKRIAEAAREHRQNEDAFAHGR 63
           Y + EE+KKLL +      K   E N++   +KR  IE+++    R   + + A A+ R
Sbjct: 2  SYSYEEESKKLLDYLRVVCEK--AEENKNGRSRKRMEIERKMRTQFRAVMEMQTAVANYR 59

Query: 64 LDLVSSEYLKAMCVDYSEL 82
           DL+ S  +K    +Y+++
Sbjct: 60 YDLIPSGMVKYYVQNYTDM 78

>KLLA0E15774g 1402940..1406386 similar to sp|P17442 Saccharomyces
           cerevisiae YGR233c PHO81 cyclin-dependent kinase
           inhibitor singleton, start by similarity
          Length = 1148

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 31/54 (57%)

Query: 159 KSMLEPRAGPGGNRNAYHSSENLESIGVFEGSIEQKNYPLPVPSFTRVADLQPQ 212
           KS        G + NA+H S +  + G+F+  +E +++ + V S +++ D++P+
Sbjct: 250 KSTFLINFSQGASSNAHHYSTSSSTAGLFDIELEIESWYMEVLSISKLKDVEPR 303

>YJL154C (VPS35) [2767] chr10 complement(131019..133853) Protein
           involved in vacuolar sorting, mutant has vacuoles of
           normal morphology [2835 bp, 944 aa]
          Length = 944

 Score = 30.4 bits (67), Expect = 2.3,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 5/57 (8%)

Query: 119 VTMERLVSKELDNDRGSEKIHHVSKEAELVINAKKNTELIKSMLEP----RAGPGGN 171
           + M+R V +  DND  S K+H     A LVI  K   + + S+ EP    R+GP  N
Sbjct: 448 ILMDREVEEMADNDSES-KLHPPGHSAYLVIEDKLQVQRLLSICEPLIISRSGPPAN 503

>KLLA0F21692g complement(2014152..2018729)
           gi|14571818|gb|AAK67294.1|AF245358_1 Kluyveromyces
           lactis multidrug pump KlPDR5, start by similarity
          Length = 1525

 Score = 30.4 bits (67), Expect = 2.3,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 25/36 (69%), Gaps = 1/36 (2%)

Query: 20  QKLR-KLDQETNEDSLQQKRSLIEKRIAEAAREHRQ 54
           ++LR ++++E N+DS Q ++ LIE  IA  ++  R+
Sbjct: 446 KQLRGEIEEELNKDSTQTRQELIEAHIARQSKRQRK 481

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.128    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,051,222
Number of extensions: 438704
Number of successful extensions: 1378
Number of sequences better than 10.0: 51
Number of HSP's gapped: 1368
Number of HSP's successfully gapped: 51
Length of query: 301
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 200
Effective length of database: 13,099,691
Effective search space: 2619938200
Effective search space used: 2619938200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 61 (28.1 bits)