Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_27.1094984844382e-58
KLLA0F18634g84842621e-31
AGR026C107822545e-30
Scas_718.48*88812301e-26
YBR058C-A (TSC3)80771719e-18
Scas_721.8530861610.79
CAGL0H09812g98336601.00
CAGL0M01386g142733546.7
AER295C83636547.5
CAGL0D01386g56578538.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10949
         (84 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10949                                                         173   2e-58
KLLA0F18634g 1713947..1714201 weakly similar to sgd|S0007521 Sac...   105   1e-31
AGR026C [4336] [Homologous to ScYBR058C-A (TSC3) - SH] (762745.....   102   5e-30
Scas_718.48*                                                           93   1e-26
YBR058C-A (TSC3) [249] chr2 complement(356284..356526) Protein a...    70   9e-18
Scas_721.85                                                            28   0.79 
CAGL0H09812g complement(955495..958446) some similarities with s...    28   1.00 
CAGL0M01386g 155052..159335 similar to tr|Q06681 Saccharomyces c...    25   6.7  
AER295C [2797] [Homologous to ScYHR172W (SPC97) - SH] (1178536.....    25   7.5  
CAGL0D01386g complement(155762..157459) similar to tr|Q12321 Sac...    25   8.6  

>Kwal_27.10949
          Length = 84

 Score =  173 bits (438), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%)

Query: 1  MNKNEVEKGQETNNGTMIYRPTDEELSNGSFLEKVSNFGENLYWMYYIHLPYYLMTTGDA 60
          MNKNEVEKGQETNNGTMIYRPTDEELSNGSFLEKVSNFGENLYWMYYIHLPYYLMTTGDA
Sbjct: 1  MNKNEVEKGQETNNGTMIYRPTDEELSNGSFLEKVSNFGENLYWMYYIHLPYYLMTTGDA 60

Query: 61 FCLHTFFLAMLTLGLFGLVKYIFL 84
          FCLHTFFLAMLTLGLFGLVKYIFL
Sbjct: 61 FCLHTFFLAMLTLGLFGLVKYIFL 84

>KLLA0F18634g 1713947..1714201 weakly similar to sgd|S0007521
          Saccharomyces cerevisiae YBR058ca required for optimal
          serine palmitoyltransferase activity, start by
          similarity
          Length = 84

 Score =  105 bits (262), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 46/84 (54%), Positives = 66/84 (78%)

Query: 1  MNKNEVEKGQETNNGTMIYRPTDEELSNGSFLEKVSNFGENLYWMYYIHLPYYLMTTGDA 60
          M   ++ +  + + GTMIY PT++++S G   EK+++F +NLYW+YYIHLP+YLMT+ DA
Sbjct: 1  MAAEKIYEPYKKSRGTMIYTPTNQQMSRGGIGEKLADFVKNLYWVYYIHLPFYLMTSLDA 60

Query: 61 FCLHTFFLAMLTLGLFGLVKYIFL 84
          FCLHT FL +++L LFGL+KYIFL
Sbjct: 61 FCLHTIFLVVVSLSLFGLLKYIFL 84

>AGR026C [4336] [Homologous to ScYBR058C-A (TSC3) - SH]
          (762745..763068) [324 bp, 107 aa]
          Length = 107

 Score =  102 bits (254), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 44/82 (53%), Positives = 58/82 (70%)

Query: 1  MNKNEVEKGQETNNGTMIYRPTDEELSNGSFLEKVSNFGENLYWMYYIHLPYYLMTTGDA 60
          M+    +   + + GTM+Y PTD + + G   EKV  F E+LYWMYYIHLPYYLMT+ D+
Sbjct: 8  MSSKRADNCYKKDRGTMVYTPTDAQQATGKVHEKVYKFFESLYWMYYIHLPYYLMTSFDS 67

Query: 61 FCLHTFFLAMLTLGLFGLVKYI 82
          FCLH FFL + TL LFGL+K++
Sbjct: 68 FCLHVFFLVVFTLSLFGLLKWV 89

>Scas_718.48*
          Length = 88

 Score = 93.2 bits (230), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 55/81 (67%), Gaps = 8/81 (9%)

Query: 12 TNNGTMIYRPTDEELS--------NGSFLEKVSNFGENLYWMYYIHLPYYLMTTGDAFCL 63
           +  TMI+ PT++EL          GS +EKV    E LYWMYYIHLPYYLMT+ D+FCL
Sbjct: 8  ASQCTMIFVPTNKELKEKRRAANGRGSIMEKVEEIVEKLYWMYYIHLPYYLMTSFDSFCL 67

Query: 64 HTFFLAMLTLGLFGLVKYIFL 84
          H FFL + +L +F ++KYIFL
Sbjct: 68 HLFFLTIFSLSVFAVIKYIFL 88

>YBR058C-A (TSC3) [249] chr2 complement(356284..356526) Protein
          associated with serine palmitoyltransferase and
          required for optimal enzyme activity [243 bp, 80 aa]
          Length = 80

 Score = 70.5 bits (171), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 47/77 (61%), Gaps = 5/77 (6%)

Query: 13 NNGTMIYRPTDEELS--NGS---FLEKVSNFGENLYWMYYIHLPYYLMTTGDAFCLHTFF 67
          +  +M+Y PT +E    NG     L  +    E LYW YYIHLP+YLM + D+F LH FF
Sbjct: 4  HKSSMVYIPTTKEAKRRNGKSEGILNTIEEVVEKLYWTYYIHLPFYLMASFDSFFLHVFF 63

Query: 68 LAMLTLGLFGLVKYIFL 84
          L + +L  FG++KY FL
Sbjct: 64 LTIFSLSFFGILKYCFL 80

>Scas_721.85
          Length = 308

 Score = 28.1 bits (61), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 28/61 (45%)

Query: 20  RPTDEELSNGSFLEKVSNFGENLYWMYYIHLPYYLMTTGDAFCLHTFFLAMLTLGLFGLV 79
           R  DE   N  F+  V+  G  L   +   LPY+ +       L++ FL  +TL +FG  
Sbjct: 208 RGLDEPAENRQFISAVTIGGGYLLGGFVPLLPYFFVEHVQTGLLYSIFLMAITLFIFGYF 267

Query: 80  K 80
           K
Sbjct: 268 K 268

>CAGL0H09812g complement(955495..958446) some similarities with
           sp|P40317 Saccharomyces cerevisiae YDR006c SOK1,
           hypothetical start
          Length = 983

 Score = 27.7 bits (60), Expect = 1.00,   Method: Composition-based stats.
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%)

Query: 5   EVEKGQETNNGTMIYRPTDEELSNGSFLEKVSNFGE 40
           EV++ QE +N   I++P D  +  G FL   SN  E
Sbjct: 200 EVQQSQEQHNNKNIFKPFD--MKTGQFLRVDSNSNE 233

>CAGL0M01386g 155052..159335 similar to tr|Q06681 Saccharomyces
           cerevisiae YDR326c, hypothetical start
          Length = 1427

 Score = 25.4 bits (54), Expect = 6.7,   Method: Composition-based stats.
 Identities = 10/33 (30%), Positives = 22/33 (66%)

Query: 3   KNEVEKGQETNNGTMIYRPTDEELSNGSFLEKV 35
           ++++  G E +N T+++ P +EE  + SFL+ +
Sbjct: 323 EDDLLNGGEQHNDTVLHSPLNEENRSSSFLKHL 355

>AER295C [2797] [Homologous to ScYHR172W (SPC97) - SH]
           (1178536..1181046) [2511 bp, 836 aa]
          Length = 836

 Score = 25.4 bits (54), Expect = 7.5,   Method: Composition-based stats.
 Identities = 11/36 (30%), Positives = 19/36 (52%)

Query: 2   NKNEVEKGQETNNGTMIYRPTDEELSNGSFLEKVSN 37
           N N+V+ G  TN G+ +  PT + + +  F +   N
Sbjct: 519 NGNDVDHGDSTNGGSGVAGPTADGIDSLRFADTTVN 554

>CAGL0D01386g complement(155762..157459) similar to tr|Q12321
           Saccharomyces cerevisiae YPR070w MED1, hypothetical
           start
          Length = 565

 Score = 25.0 bits (53), Expect = 8.6,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 34/78 (43%)

Query: 4   NEVEKGQETNNGTMIYRPTDEELSNGSFLEKVSNFGENLYWMYYIHLPYYLMTTGDAFCL 63
           N +  G  TN  ++  +   + +S+G+ L+   N G+   + Y+  L  Y+ T     C 
Sbjct: 143 NNLGSGNGTNGSSLTNKTDKKSVSSGNGLDSKLNEGKLNLFKYFRELKKYINTFFKESCD 202

Query: 64  HTFFLAMLTLGLFGLVKY 81
           + F +       FGL  Y
Sbjct: 203 NRFKVVANVDNRFGLYIY 220

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.141    0.437 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,185,160
Number of extensions: 130530
Number of successful extensions: 255
Number of sequences better than 10.0: 13
Number of HSP's gapped: 255
Number of HSP's successfully gapped: 13
Length of query: 84
Length of database: 16,596,109
Length adjustment: 56
Effective length of query: 28
Effective length of database: 14,657,501
Effective search space: 410410028
Effective search space used: 410410028
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 54 (25.4 bits)