Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_27.1094593592245380.0
Sklu_1752.285860917240.0
KLLA0F18612g81444715290.0
YBR059C (AKL1)110855615370.0
Scas_661.27109538015010.0
AGR027C96154914220.0
CAGL0H10208g102746713461e-170
CAGL0K11990g99139312981e-163
Kwal_27.115427913148432e-99
KLLA0E08371g7773187827e-91
Sklu_2226.77953167802e-90
Scas_601.66613127651e-89
CAGL0G02607g6883957644e-89
ADL217W7503117553e-87
YNL020C (ARK1)6383147463e-87
Scas_671.167233087463e-86
YIL095W (PRK1)8103547434e-85
CAGL0J03432g6223127201e-83
KLLA0C06138g7082832625e-23
YMR001C (CDC5)7052842411e-20
Sklu_2419.96952862402e-20
Scas_644.157262902367e-20
KLLA0F11319g8432892322e-19
Kwal_56.242743463342243e-19
CAGL0J11638g7462892279e-19
Sklu_2361.38843002261e-18
ACL006W7082812251e-18
YPL150W9012892261e-18
ACR133C8512932242e-18
Sklu_2419.105662212194e-18
AFL101C3672632146e-18
Kwal_56.224766972862161e-17
Scas_700.288962922171e-17
Kwal_55.215458652462125e-17
CAGL0M02299g8932962072e-16
ACL104C9472802054e-16
YPL236C3643381978e-16
CAGL0L11550g10722322021e-15
KLLA0E21780g10162372002e-15
AEL230W6083361982e-15
Kwal_26.87518481951992e-15
CAGL0M08910g6123001963e-15
ABL034W14253751965e-15
YDR477W (SNF1)6332931946e-15
YHR102W (KIC1)10802451931e-14
Scas_580.610152321931e-14
Scas_598.67902391921e-14
KLLA0A03806g6022931911e-14
Scas_660.286232511902e-14
Kwal_47.182335982881892e-14
Scas_707.369152911884e-14
Kwal_33.131125052511856e-14
Kwal_26.778812672601877e-14
YCR073C (SSK22)13312521851e-13
Scas_458.13673521801e-13
Kwal_23.632515422641851e-13
AER264C14832881851e-13
AFR335C10332171841e-13
YOL100W (PKH2)10812301822e-13
Sklu_1962.23641471773e-13
KLLA0B02332g3613511763e-13
KLLA0C08525g15512501814e-13
KLLA0F13552g12673671804e-13
Scas_629.169182951786e-13
Kwal_56.237178581931778e-13
AFR696C11422491778e-13
KLLA0C12485g9252281761e-12
Kwal_56.226939841901761e-12
KLLA0C00979g4833041722e-12
KLLA0C01650g11122491742e-12
Scas_627.73492531692e-12
CAGL0C03509g8952981733e-12
CAGL0M11396g11921931723e-12
CAGL0G04609g9651921714e-12
Kwal_23.52908193121714e-12
CAGL0J03872g6612321704e-12
Sklu_2323.34002491684e-12
KLLA0C18568g7742981697e-12
CAGL0M10153g8671761697e-12
YNL298W (CLA4)8422431698e-12
ABR014W9711761699e-12
YNR047W8933021689e-12
AGR058W10711911689e-12
KLLA0F14190g13382771681e-11
KLLA0A07403g8792401681e-11
Kwal_26.735514462851681e-11
Scas_564.712101931681e-11
AEL205W7932031671e-11
CAGL0K02673g9151761671e-11
CAGL0K05709g11032491671e-11
YDR122W (KIN1)10642041672e-11
Kwal_23.64588682941662e-11
Kwal_23.566816892321662e-11
Scas_693.1710492341652e-11
CAGL0E05720g3582341622e-11
YDR490C (PKH1)7662311652e-11
Scas_675.25271891642e-11
YDR507C (GIN4)11422491652e-11
KLLA0F19536g11041941652e-11
YJL095W (BCK1)14782961653e-11
Sklu_2437.1610712241643e-11
KLLA0E17127g8521901633e-11
KLLA0B13607g9891761634e-11
Sklu_2366.54662341605e-11
CAGL0I07513g10762271625e-11
AFR377C7262841615e-11
Scas_616.1014611841626e-11
Kwal_56.240913811961586e-11
CAGL0K08514g14893841626e-11
Scas_720.9416832611626e-11
YLR096W (KIN2)11471931617e-11
YKL101W (HSL1)15182481617e-11
CAGL0G09020g3611501577e-11
YDL159W (STE7)5152001581e-10
Kwal_26.78619551761601e-10
YDR523C (SPS1)4902071581e-10
ACR196C5301991571e-10
Scas_502.211161901591e-10
CAGL0M03729g8612031581e-10
KLLA0C16577g5041861572e-10
Scas_668.228931761582e-10
Scas_711.2515152621582e-10
AFR092W14232681582e-10
ADR167W8732921572e-10
YHL007C (STE20)9391761563e-10
CAGL0I03498g4512231534e-10
CAGL0B01925g9441921544e-10
Kwal_47.167617443111535e-10
AFR724C4402861516e-10
KLLA0B13112g7301811526e-10
YBR274W (CHK1)5271861517e-10
YGL179C (TOS3)5602051517e-10
YER129W (PAK1)11422811528e-10
YCL024W (KCC4)10372501529e-10
YAR019C (CDC15)9742461511e-09
YPL209C (IPL1)3671981471e-09
CAGL0L03520g14472711501e-09
CAGL0K04301g3552111471e-09
YNR031C (SSK2)15793131502e-09
CAGL0K02167g11622711492e-09
Scas_493.211172491482e-09
Sklu_1995.27291811482e-09
YOR233W (KIN4)8001431473e-09
ADL389W7113111463e-09
YMR139W (RIM11)3702021443e-09
YCR091W (KIN82)7202551463e-09
Scas_651.183712751443e-09
Kwal_26.87098291431464e-09
ADR300C8901911464e-09
KLLA0A02497g3621391434e-09
Scas_685.245151881454e-09
Kwal_47.1726311273221464e-09
Sklu_2255.43681191425e-09
AAR009W4532651436e-09
CAGL0F04741g4422971436e-09
Kwal_56.245844351991436e-09
YJL164C (TPK1)3972541426e-09
ACR117W5242511438e-09
YPL140C (MKK2)5061651428e-09
Kwal_55.203267502011439e-09
KLLA0D03190g3721071409e-09
CAGL0F03311g10451901431e-08
AAL083W16982121431e-08
AEL284C4792441411e-08
YPL203W (TPK2)3802391401e-08
Sklu_2186.45212491411e-08
KLLA0B07205g4552361411e-08
Scas_548.613821761421e-08
Scas_683.63771691391e-08
CAGL0M08404g4621421401e-08
Kwal_26.715412131241421e-08
ACR281C12591791421e-08
Scas_544.64892301401e-08
ABL011C7012441411e-08
CAGL0H00979g3993751391e-08
CAGL0J04290g3572371382e-08
Sklu_2086.42431771352e-08
YKL048C (ELM1)6401841402e-08
KLLA0B11902g4952501392e-08
CAGL0D02244g4872001382e-08
Scas_689.25*4091071382e-08
Sklu_2073.311822741402e-08
Scas_623.113781381373e-08
YOL016C (CMK2)4472561383e-08
AFL143C3612571373e-08
YPL141C8652391393e-08
AEL115C3861271373e-08
AFL090W3461071353e-08
Scas_633.297893201383e-08
ADR253W3802161363e-08
Scas_720.1038043041383e-08
YDR283C (GCN2)16591961384e-08
Sklu_1603.24882371374e-08
YJL187C (SWE1)8192271384e-08
Kwal_0.964272961364e-08
Kwal_14.14163651181354e-08
CAGL0J00539g4882461364e-08
CAGL0H01639g5212351364e-08
Kwal_47.183076211941374e-08
Scas_477.57031811375e-08
KLLA0F24618g5562991365e-08
ACL191C3651121345e-08
ACR191C11492781375e-08
YGR040W (KSS1)3681141345e-08
Kwal_17.26873621461346e-08
Kwal_56.240593531071336e-08
ADL168C3621821337e-08
Scas_700.348641761357e-08
Scas_584.1110741911357e-08
KLLA0E07414g3651821338e-08
KLLA0E03487g6472461348e-08
YHR082C (KSP1)10291601359e-08
Kwal_26.87034442061331e-07
KLLA0F07623g12291771341e-07
YFR014C (CMK1)4462661331e-07
YKL166C (TPK3)3982561321e-07
YOL113W (SKM1)6552051331e-07
YPR054W (SMK1)3882351321e-07
CAGL0I09504g5282641331e-07
YGR052W3692131311e-07
Scas_653.256661691331e-07
CAGL0K04169g3981171321e-07
Sklu_2429.54322911321e-07
YOL045W (PSK2)11011431341e-07
Sklu_2354.43631711311e-07
CAGL0C05005g10762491331e-07
Kwal_33.138463751271311e-07
Scas_640.14*7281951321e-07
Scas_602.1111863051331e-07
KLLA0F01276g5191801322e-07
KLLA0C04213g3942861312e-07
KLLA0A02717g4322011312e-07
Kwal_23.55765042491312e-07
Kwal_55.220013631821302e-07
KLLA0D07304g4651661312e-07
ACL053C11812361322e-07
KLLA0B07579g7222351312e-07
YLR362W (STE11)7171871312e-07
AER232C5692511302e-07
CAGL0I05390g4542091302e-07
ABR177C7532921312e-07
KLLA0B03586g7342881303e-07
AER222C4232601293e-07
YHR205W (SCH9)8243061303e-07
YAL017W (PSK1)13561241313e-07
Sklu_2436.147841791303e-07
Scas_703.57493111303e-07
CAGL0H06259g13361711303e-07
Sklu_1843.34861231293e-07
Kwal_55.201898121911293e-07
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10945
         (922 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10945                                                        1752   0.0  
Sklu_1752.2 YBR059C, Contig c1752 577-3153 reverse complement         668   0.0  
KLLA0F18612g 1711131..1713575 some similarities with sp|P38080 S...   593   0.0  
YBR059C (AKL1) [250] chr2 complement(356821..360147) Serine/thre...   596   0.0  
Scas_661.27                                                           582   0.0  
AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH] (763309..76...   552   0.0  
CAGL0H10208g complement(996853..999936) similar to sp|P38080 Sac...   523   e-170
CAGL0K11990g complement(1155395..1158370) some similarities with...   504   e-163
Kwal_27.11542                                                         329   2e-99
KLLA0E08371g complement(756205..758538) similar to sp|P40494 Sac...   305   7e-91
Sklu_2226.7 YIL095W, Contig c2226 8986-11373                          305   2e-90
Scas_601.6                                                            299   1e-89
CAGL0G02607g complement(240244..242310) similar to sp|P40494 Sac...   298   4e-89
ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C (...   295   3e-87
YNL020C (ARK1) [4567] chr14 complement(595621..597537) Serine/th...   291   3e-87
Scas_671.16                                                           291   3e-86
YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine pro...   290   4e-85
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...   281   1e-83
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...   105   5e-23
YMR001C (CDC5) [3966] chr13 complement(269019..271136) Serine/th...    97   1e-20
Sklu_2419.9 YMR001C, Contig c2419 14049-16136                          97   2e-20
Scas_644.15                                                            96   7e-20
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    94   2e-19
Kwal_56.24274                                                          91   3e-19
CAGL0J11638g complement(1128620..1130860) highly similar to sp|P...    92   9e-19
Sklu_2361.3 YPL150W, Contig c2361 3677-6331                            92   1e-18
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...    91   1e-18
YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine...    92   1e-18
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...    91   2e-18
Sklu_2419.10 , Contig c2419 14439-16135                                89   4e-18
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...    87   6e-18
Kwal_56.22476                                                          88   1e-17
Scas_700.28                                                            88   1e-17
Kwal_55.21545                                                          86   5e-17
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...    84   2e-16
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...    84   4e-16
YPL236C (YPL236C) [5213] chr16 complement(101608..102702) Serine...    80   8e-16
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    82   1e-15
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...    82   2e-15
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...    81   2e-15
Kwal_26.8751                                                           81   2e-15
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...    80   3e-15
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...    80   5e-15
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...    79   6e-15
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    79   1e-14
Scas_580.6                                                             79   1e-14
Scas_598.6                                                             79   1e-14
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....    78   1e-14
Scas_660.28                                                            78   2e-14
Kwal_47.18233                                                          77   2e-14
Scas_707.36                                                            77   4e-14
Kwal_33.13112                                                          76   6e-14
Kwal_26.7788                                                           77   7e-14
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    76   1e-13
Scas_458.1                                                             74   1e-13
Kwal_23.6325                                                           76   1e-13
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...    76   1e-13
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...    75   1e-13
YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine pr...    75   2e-13
Sklu_1962.2 YPL236C, Contig c1962 744-1838 reverse complement          73   3e-13
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...    72   3e-13
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...    74   4e-13
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...    74   4e-13
Scas_629.16                                                            73   6e-13
Kwal_56.23717                                                          73   8e-13
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...    73   8e-13
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...    72   1e-12
Kwal_56.22693                                                          72   1e-12
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...    71   2e-12
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...    72   2e-12
Scas_627.7                                                             70   2e-12
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...    71   3e-12
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...    71   3e-12
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...    70   4e-12
Kwal_23.5290                                                           70   4e-12
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...    70   4e-12
Sklu_2323.3 YPL209C, Contig c2323 5241-6443                            69   4e-12
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...    70   7e-12
CAGL0M10153g complement(1010688..1013291) some similarities with...    70   7e-12
YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine prot...    70   8e-12
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    70   9e-12
YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine...    69   9e-12
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...    69   9e-12
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    69   1e-11
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    69   1e-11
Kwal_26.7355                                                           69   1e-11
Scas_564.7                                                             69   1e-11
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    69   1e-11
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...    69   1e-11
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...    69   1e-11
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...    69   2e-11
Kwal_23.6458                                                           69   2e-11
Kwal_23.5668                                                           69   2e-11
Scas_693.17                                                            68   2e-11
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...    67   2e-11
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...    68   2e-11
Scas_675.2                                                             68   2e-11
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...    68   2e-11
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...    68   2e-11
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...    68   3e-11
Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement      68   3e-11
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    67   3e-11
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    67   4e-11
Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement       66   5e-11
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...    67   5e-11
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...    67   5e-11
Scas_616.10                                                            67   6e-11
Kwal_56.24091                                                          65   6e-11
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...    67   6e-11
Scas_720.94                                                            67   6e-11
YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine pr...    67   7e-11
YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine pr...    67   7e-11
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...    65   7e-11
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    65   1e-10
Kwal_26.7861                                                           66   1e-10
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...    65   1e-10
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    65   1e-10
Scas_502.2                                                             66   1e-10
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    65   1e-10
KLLA0C16577g complement(1451181..1452695) some similarities with...    65   2e-10
Scas_668.22                                                            65   2e-10
Scas_711.25                                                            65   2e-10
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    65   2e-10
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...    65   2e-10
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    65   3e-10
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    64   4e-10
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...    64   4e-10
Kwal_47.16761                                                          64   5e-10
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...    63   6e-10
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    63   6e-10
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    63   7e-10
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    63   7e-10
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    63   8e-10
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...    63   9e-10
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...    63   1e-09
YPL209C (IPL1) [5240] chr16 complement(156489..157592) Serine/th...    61   1e-09
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    62   1e-09
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    61   1e-09
YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinas...    62   2e-09
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    62   2e-09
Scas_493.2                                                             62   2e-09
Sklu_1995.2 YLR362W, Contig c1995 1578-3767                            62   2e-09
YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine pr...    61   3e-09
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...    61   3e-09
YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3...    60   3e-09
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...    61   3e-09
Scas_651.18                                                            60   3e-09
Kwal_26.8709                                                           61   4e-09
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    61   4e-09
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...    60   4e-09
Scas_685.24                                                            60   4e-09
Kwal_47.17263                                                          61   4e-09
Sklu_2255.4 YGR040W, Contig c2255 6834-7940 reverse complement         59   5e-09
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...    60   6e-09
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...    60   6e-09
Kwal_56.24584                                                          60   6e-09
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...    59   6e-09
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    60   8e-09
YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinas...    59   8e-09
Kwal_55.20326                                                          60   9e-09
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...    59   9e-09
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    60   1e-08
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    60   1e-08
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    59   1e-08
YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit o...    59   1e-08
Sklu_2186.4 YHR030C, Contig c2186 5713-7278 reverse complement         59   1e-08
KLLA0B07205g complement(624606..625973) some similarities with s...    59   1e-08
Scas_548.6                                                             59   1e-08
Scas_683.6                                                             58   1e-08
CAGL0M08404g complement(836791..838179) some similarities with s...    59   1e-08
Kwal_26.7154                                                           59   1e-08
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    59   1e-08
Scas_544.6                                                             59   1e-08
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    59   1e-08
CAGL0H00979g complement(94328..95527) similar to tr|Q12003 Sacch...    58   1e-08
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...    58   2e-08
Sklu_2086.4 , Contig c2086 6437-7168 reverse complement                57   2e-08
YKL048C (ELM1) [3211] chr11 complement(346859..348781) Serine/th...    59   2e-08
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    58   2e-08
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    58   2e-08
Scas_689.25*                                                           58   2e-08
Sklu_2073.3 YER129W, Contig c2073 2194-5742                            59   2e-08
Scas_623.11                                                            57   3e-08
YOL016C (CMK2) [4800] chr15 complement(294777..296120) Calcium/c...    58   3e-08
AFL143C [3052] [Homologous to ScYPL236C - SH] (164241..165326) [...    57   3e-08
YPL141C (YPL141C) [5305] chr16 complement(283463..286060) Serine...    58   3e-08
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...    57   3e-08
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...    57   3e-08
Scas_633.29                                                            58   3e-08
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...    57   3e-08
Scas_720.103                                                           58   3e-08
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    58   4e-08
Sklu_1603.2 YPR054W, Contig c1603 1858-3324 reverse complement         57   4e-08
YJL187C (SWE1) [2737] chr10 complement(76802..79261) Serine/tyro...    58   4e-08
Kwal_0.96                                                              57   4e-08
Kwal_14.1416                                                           57   4e-08
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...    57   4e-08
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...    57   4e-08
Kwal_47.18307                                                          57   4e-08
Scas_477.5                                                             57   5e-08
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...    57   5e-08
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...    56   5e-08
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...    57   5e-08
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...    56   5e-08
Kwal_17.2687                                                           56   6e-08
Kwal_56.24059                                                          56   6e-08
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    56   7e-08
Scas_700.34                                                            57   7e-08
Scas_584.11                                                            57   7e-08
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    56   8e-08
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...    56   8e-08
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    57   9e-08
Kwal_26.8703                                                           56   1e-07
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    56   1e-07
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...    56   1e-07
YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic...    55   1e-07
YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine pr...    56   1e-07
YPR054W (SMK1) [5484] chr16 (666275..667441) Sporulation-specifi...    55   1e-07
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...    56   1e-07
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    55   1e-07
Scas_653.25                                                            56   1e-07
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    55   1e-07
Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement        55   1e-07
YOL045W (PSK2) [4773] chr15 (243495..246800) Serine/threonine pr...    56   1e-07
Sklu_2354.4 YNL307C, Contig c2354 4429-5520 reverse complement         55   1e-07
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...    56   1e-07
Kwal_33.13846                                                          55   1e-07
Scas_640.14*                                                           55   1e-07
Scas_602.11                                                            56   1e-07
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    55   2e-07
KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces c...    55   2e-07
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    55   2e-07
Kwal_23.5576                                                           55   2e-07
Kwal_55.22001                                                          55   2e-07
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    55   2e-07
ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C (T...    55   2e-07
KLLA0B07579g 659591..661759 weakly similar to sp|P32944 Saccharo...    55   2e-07
YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase ...    55   2e-07
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    55   2e-07
CAGL0I05390g complement(508677..510041) similar to sp|Q12505 Sac...    55   2e-07
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...    55   2e-07
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...    55   3e-07
AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH] (1043479..1...    54   3e-07
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...    55   3e-07
YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine prote...    55   3e-07
Sklu_2436.14 YDR466W, Contig c2436 31299-33653                         55   3e-07
Scas_703.5                                                             55   3e-07
CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces c...    55   3e-07
Sklu_1843.3 YOR231W, Contig c1843 2632-4092 reverse complement         54   3e-07
Kwal_55.20189                                                          54   3e-07
Scas_688.14                                                            54   3e-07
Scas_643.20                                                            55   4e-07
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...    54   4e-07
Kwal_27.12559                                                          54   4e-07
YNL307C (MCK1) [4306] chr14 complement(56446..57573) Member of t...    54   4e-07
YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine pr...    54   4e-07
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    54   4e-07
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...    54   4e-07
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...    54   4e-07
Kwal_27.10004                                                          54   4e-07
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    54   4e-07
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...    53   5e-07
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...    54   5e-07
YPR161C (SGV1) [5576] chr16 complement(864443..866416) Serine/th...    54   5e-07
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...    54   5e-07
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...    54   6e-07
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    54   6e-07
Scas_640.16                                                            54   6e-07
Scas_678.24                                                            54   6e-07
Scas_673.20*                                                           54   6e-07
Scas_713.21                                                            54   6e-07
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    53   6e-07
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...    54   6e-07
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    54   6e-07
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...    54   6e-07
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    54   7e-07
Kwal_27.10581                                                          54   7e-07
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    54   7e-07
Kwal_47.17868                                                          52   8e-07
Scas_660.20                                                            53   8e-07
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    53   1e-06
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...    53   1e-06
YOR351C (MEK1) [5128] chr15 complement(995013..996506) Serine/th...    53   1e-06
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    52   1e-06
Scas_690.13                                                            52   1e-06
Kwal_26.8347                                                           53   1e-06
Scas_618.8                                                             52   1e-06
Scas_635.1                                                             52   1e-06
Scas_628.9                                                             53   1e-06
Scas_667.18                                                            52   1e-06
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...    53   1e-06
YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine pr...    52   1e-06
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    52   1e-06
Sklu_2211.5 YBL105C, Contig c2211 10237-13764                          53   1e-06
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...    52   2e-06
Scas_721.124                                                           52   2e-06
Scas_710.28                                                            51   2e-06
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....    52   2e-06
Scas_649.30                                                            52   2e-06
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    52   2e-06
Scas_717.69                                                            52   2e-06
KLLA0D09328g complement(788565..791705) some similarities with s...    52   2e-06
Scas_619.5*                                                            52   2e-06
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...    52   2e-06
KLLA0E15378g 1362851..1365025 some similarities with sp|P08018 S...    52   2e-06
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    51   2e-06
CAGL0K01617g complement(142479..144803) similar to sp|P54199 Sac...    52   2e-06
YKL161C (YKL161C) [3109] chr11 complement(149391..150692) Serine...    51   2e-06
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...    52   2e-06
Kwal_27.9763                                                           52   2e-06
Sklu_2104.1 YBR160W, Contig c2104 694-1593                             50   3e-06
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    52   3e-06
Kwal_14.2497                                                           51   3e-06
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    51   3e-06
Scas_704.50                                                            51   3e-06
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...    51   3e-06
AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..328...    51   3e-06
Kwal_33.14081                                                          51   3e-06
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    51   3e-06
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...    51   3e-06
AFR372W [3564] [Homologous to ScYJR059W (PTK2 ) - SH] complement...    51   3e-06
Kwal_33.14192                                                          51   3e-06
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    51   4e-06
YKL168C (KKQ8) [3102] chr11 complement(131293..133497) Serine/th...    51   4e-06
YPL031C (PHO85) [5407] chr16 complement(492014..492914,493017..4...    50   4e-06
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...    50   4e-06
Sklu_2430.5 YKL126W, Contig c2430 8144-10345                           51   4e-06
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    50   4e-06
YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine pr...    51   4e-06
Scas_683.12                                                            50   5e-06
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...    50   5e-06
Kwal_33.13681                                                          50   5e-06
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...    50   5e-06
Scas_336.1                                                             50   5e-06
CAGL0I05192g complement(493635..494756) highly similar to sp|P15...    50   6e-06
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...    50   6e-06
KLLA0B06501g complement(576636..579089) some similarities with s...    50   6e-06
Sklu_1477.2 YKL116C, Contig c1477 684-2414 reverse complement          50   6e-06
Scas_700.35                                                            50   7e-06
CAGL0M13167g complement(1291524..1293356) similar to sp|P32801 S...    50   7e-06
YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kin...    50   7e-06
Scas_713.7                                                             50   7e-06
Scas_610.7                                                             50   7e-06
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...    50   7e-06
Scas_593.14d                                                           50   7e-06
Scas_715.34                                                            50   8e-06
Kwal_26.7635                                                           50   8e-06
YOR267C (HRK1) [5054] chr15 complement(822585..824864) Serine/th...    50   8e-06
YMR104C (YPK2) [4061] chr13 complement(473419..475452) Serine/th...    50   8e-06
Sklu_1886.2 YDL025C, Contig c1886 2790-4733                            50   1e-05
AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH] (1005431..1...    49   1e-05
Kwal_33.14167                                                          50   1e-05
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....    50   1e-05
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    49   1e-05
YKL116C (PRR1) [3148] chr11 complement(220990..222546) Serine/th...    49   1e-05
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...    49   1e-05
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    49   1e-05
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...    49   1e-05
Kwal_56.22788                                                          49   1e-05
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...    49   1e-05
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...    49   1e-05
ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH] (503670..50...    49   1e-05
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    49   1e-05
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    49   1e-05
Kwal_56.23841                                                          49   1e-05
Kwal_0.307                                                             49   2e-05
Scas_654.12                                                            49   2e-05
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    49   2e-05
Scas_568.9*                                                            48   2e-05
Sklu_2385.2 YLR113W, Contig c2385 3805-5109 reverse complement         49   2e-05
Kwal_27.11919                                                          47   2e-05
Scas_680.20                                                            49   2e-05
KLLA0D12100g complement(1031728..1033161) some similarities with...    49   2e-05
YPL026C (SKS1) [5412] chr16 complement(500671..502179) Serine/th...    49   2e-05
Sklu_2066.2 YJL128C, Contig c2066 5081-7000                            49   2e-05
AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH] (348350..35...    49   2e-05
KLLA0C03938g complement(358851..360632) some similarities with s...    49   2e-05
Scas_713.38                                                            48   2e-05
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    48   2e-05
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    49   2e-05
Kwal_14.1273                                                           48   3e-05
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...    48   3e-05
CAGL0I06248g 600351..602792 similar to sp|P38970 Saccharomyces c...    48   3e-05
KLLA0F01507g 144356..145774 some similarities with sp|P47042 Sac...    48   3e-05
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    48   3e-05
Kwal_33.14434                                                          48   4e-05
YKL139W (CTK1) [3128] chr11 (182963..184549) C-terminal domain (...    48   4e-05
KLLA0E11979g complement(1060048..1061892) some similarities with...    48   4e-05
Scas_718.90                                                            48   4e-05
ADR163W [1905] [Homologous to ScYDR247W - SH; ScYPL026C (SKS1) -...    47   4e-05
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    47   4e-05
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...    47   4e-05
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...    48   4e-05
Kwal_33.14554                                                          47   4e-05
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    47   5e-05
YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine prot...    47   5e-05
Sklu_2277.8 YOR267C, Contig c2277 9591-11441 reverse complement        47   5e-05
Kwal_26.7552                                                           47   5e-05
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    47   5e-05
Kwal_26.8941                                                           47   5e-05
YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK), ...    47   5e-05
Scas_698.37                                                            47   6e-05
Scas_634.5                                                             47   6e-05
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...    47   6e-05
Scas_707.34                                                            47   7e-05
CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces c...    47   7e-05
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    46   7e-05
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    46   7e-05
Scas_692.24                                                            47   7e-05
Kwal_55.21900                                                          47   8e-05
Sklu_2392.6 YNL161W, Contig c2392 12867-15293 reverse complement       47   8e-05
Sklu_2417.13 YMR139W, Contig c2417 24824-25915 reverse complement      46   9e-05
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...    47   9e-05
CAGL0K01661g complement(146952..148400) some similarities with t...    46   9e-05
Sklu_2118.2 YAR018C, Contig c2118 1397-2677                            46   1e-04
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...    46   1e-04
AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C (...    46   1e-04
Kwal_27.9773                                                           46   1e-04
KLLA0F02838g 264329..266596 some similarities with sp|P32581 Sac...    46   1e-04
Scas_721.61                                                            46   1e-04
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...    46   1e-04
Scas_201.1*                                                            45   1e-04
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...    45   1e-04
YOR061W (CKA2) [4869] chr15 (441535..442554) Casein kinase II (P...    45   2e-04
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    46   2e-04
Sklu_2232.2 YOR061W, Contig c2232 1216-2340 reverse complement         45   2e-04
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....    45   2e-04
ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH] (1263082..1...    46   2e-04
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    46   2e-04
Sklu_2099.2 , Contig c2099 975-2237 reverse complement                 45   2e-04
Scas_573.10                                                            45   2e-04
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...    46   2e-04
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    45   2e-04
Scas_582.1                                                             45   2e-04
Kwal_47.17252                                                          45   2e-04
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...    45   3e-04
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...    45   3e-04
Sklu_1987.1 YBL016W, Contig c1987 623-1996                             45   3e-04
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    45   3e-04
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    44   3e-04
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    45   3e-04
CAGL0L07810g complement(857656..859446) similar to sp|P25333 Sac...    45   3e-04
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...    45   3e-04
Kwal_23.3590                                                           45   3e-04
CAGL0K00693g complement(74637..77267) similar to sp|P32944 Sacch...    45   3e-04
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    45   3e-04
Sklu_1436.3 YIL035C, Contig c1436 2418-3536 reverse complement         44   3e-04
Kwal_27.11777                                                          45   3e-04
YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinas...    45   3e-04
Kwal_14.1159                                                           45   3e-04
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    45   3e-04
Scas_651.19                                                            45   3e-04
Kwal_47.18098                                                          44   3e-04
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...    45   3e-04
Sklu_1722.2 YJL187C, Contig c1722 1158-3587 reverse complement         45   4e-04
Scas_22.1                                                              43   4e-04
Scas_655.2                                                             44   4e-04
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...    44   5e-04
Scas_721.46                                                            44   5e-04
CAGL0M08360g complement(833220..835520) some similarities with s...    44   5e-04
Kwal_26.7682                                                           44   6e-04
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...    43   6e-04
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    44   6e-04
Sklu_1436.2 , Contig c1436 2420-3329 reverse complement                43   6e-04
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    43   8e-04
Scas_707.3                                                             44   8e-04
Kwal_33.13831                                                          43   9e-04
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...    44   0.001
Scas_613.13*                                                           42   0.001
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...    43   0.001
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...    43   0.001
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...    43   0.001
YNL183C (NPR1) [4417] chr14 complement(293137..295509) Serine/th...    43   0.001
CAGL0B03509g complement(349638..351431) similar to sp|P38623 Sac...    43   0.001
Kwal_23.4276                                                           43   0.001
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...    43   0.001
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    43   0.001
Sklu_2389.4 YJL057C, Contig c2389 7783-9576                            43   0.001
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...    43   0.001
Sklu_2442.21 YLR248W, Contig c2442 39541-41052 reverse complement      42   0.002
Sklu_1484.2 YDL108W, Contig c1484 2977-3825 reverse complement         42   0.002
Kwal_27.11803                                                          41   0.002
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...    42   0.002
Sklu_2401.9 YGR092W, Contig c2401 17788-19521                          42   0.002
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...    42   0.002
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...    42   0.002
Kwal_55.20221                                                          42   0.002
Kwal_23.3992                                                           42   0.002
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...    42   0.002
Scas_721.110                                                           42   0.002
YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine pro...    42   0.002
YMR291W (YMR291W) [4245] chr13 (852629..854389) Serine/threonine...    42   0.002
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    42   0.002
Kwal_33.13222                                                          40   0.002
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...    42   0.003
Scas_705.23                                                            42   0.003
Scas_677.18                                                            42   0.003
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    42   0.003
KLLA0A06820g complement(615686..618004) some similarities with s...    42   0.003
Sklu_2307.1 YPL042C, Contig c2307 215-1945                             41   0.003

>Kwal_27.10945
          Length = 935

 Score = 1752 bits (4538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 855/922 (92%), Positives = 855/922 (92%)

Query: 1   MITGFVGTFRVKLRSNQPKRPLLKENAQHTPVLVVRSTNHLRMSKSETSSHHVVSGLNSS 60
           MITGFVGTFRVKLRSNQPKRPLLKENAQHTPVLVVRSTNHLRMSKSETSSHHVVSGLNSS
Sbjct: 1   MITGFVGTFRVKLRSNQPKRPLLKENAQHTPVLVVRSTNHLRMSKSETSSHHVVSGLNSS 60

Query: 61  RSGTLPVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEV 120
           RSGTLPVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEV
Sbjct: 61  RSGTLPVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEV 120

Query: 121 GDLACLKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLM 180
           GDLACLKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLM
Sbjct: 121 GDLACLKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLM 180

Query: 181 ELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDA 240
           ELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDA
Sbjct: 181 ELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDA 240

Query: 241 NHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDI 300
           NHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDI
Sbjct: 241 NHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDI 300

Query: 301 WALGIFLYKLLFYTTPFELTGQFAILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIY 360
           WALGIFLYKLLFYTTPFELTGQFAILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIY
Sbjct: 301 WALGIFLYKLLFYTTPFELTGQFAILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIY 360

Query: 361 QVMDNLCSILKVKNPLEDKYQLGSYSFEKYSQYQAKLQKVQYQMYLAYENKQQIDTLNDM 420
           QVMDNLCSILKVKNPLEDKYQLGSYSFEKYSQYQAKLQKVQYQMYLAYENKQQIDTLNDM
Sbjct: 361 QVMDNLCSILKVKNPLEDKYQLGSYSFEKYSQYQAKLQKVQYQMYLAYENKQQIDTLNDM 420

Query: 421 FINCFEVAPKQPVDISDKKWASGPSSYKTRENKTVPEVNPDVTLAGEEDIGLVQQQFPSV 480
           FINCFEVAPKQPVDISDKKWASGPSSYKTRENKTVPEVNPDVTLAGEEDIGLVQQQFPSV
Sbjct: 421 FINCFEVAPKQPVDISDKKWASGPSSYKTRENKTVPEVNPDVTLAGEEDIGLVQQQFPSV 480

Query: 481 EDLDHYLDGENKRDTNKSSSNGAFSTEHXXXXXXKTDLSAIQHAPSVPLEELPSSKPTQN 540
           EDLDHYLDGENKRDTNKSSSNGAFSTEH      KTDLSAIQHAPSVPLEELPSSKPTQN
Sbjct: 481 EDLDHYLDGENKRDTNKSSSNGAFSTEHSSGSSSKTDLSAIQHAPSVPLEELPSSKPTQN 540

Query: 541 VQAVATSKNMVRDTTARSTNSVKQHKPTNPFPYIQPEKEIYGVDNDSNSIFHGEGSKSDP 600
           VQAVATSKNMVRDTTARSTNSVKQHKPTNPFPYIQPEKEIYGVDNDSNSIFHGEGSKSDP
Sbjct: 541 VQAVATSKNMVRDTTARSTNSVKQHKPTNPFPYIQPEKEIYGVDNDSNSIFHGEGSKSDP 600

Query: 601 EQQYFAQDATAVPQPPIKTEQPAQKQVGPALPTTEAAKSSLKQFRAQPQEPGGENKISYD 660
           EQQYFAQDATAVPQPPIKTEQPAQKQVGPALPTTEAAKSSLKQFRAQPQEPGGENKISYD
Sbjct: 601 EQQYFAQDATAVPQPPIKTEQPAQKQVGPALPTTEAAKSSLKQFRAQPQEPGGENKISYD 660

Query: 661 QYFSEAPNPTAQRVREPVNTETPQYYAYPGLQPVSMQKPQQTTEHLQVQQHHNTPIXXXX 720
           QYFSEAPNPTAQRVREPVNTETPQYYAYPGLQPVSMQKPQQTTEHLQVQQHHNTPI    
Sbjct: 661 QYFSEAPNPTAQRVREPVNTETPQYYAYPGLQPVSMQKPQQTTEHLQVQQHHNTPIQQQP 720

Query: 721 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSHNIEEELLVDFSPPL 780
                                                       SHNIEEELLVDFSPPL
Sbjct: 721 QQQQQPQQQQQQQQQQPQPQPQPQPQPQQQQQQRQQQQQQQQQQSHNIEEELLVDFSPPL 780

Query: 781 KREPQKLDLTYDSVDLSTLSKGEYKDETDIXXXXXXXXXXXXXDLRQNERLSAKTRGQNV 840
           KREPQKLDLTYDSVDLSTLSKGEYKDETDI             DLRQNERLSAKTRGQNV
Sbjct: 781 KREPQKLDLTYDSVDLSTLSKGEYKDETDISEQSMASSESVSVDLRQNERLSAKTRGQNV 840

Query: 841 DDSVSAVKPSPRGRRSLDLKFQEMDFSNSPSPDIKLQKTKTVSHQQRKSNVAAEPKKSFS 900
           DDSVSAVKPSPRGRRSLDLKFQEMDFSNSPSPDIKLQKTKTVSHQQRKSNVAAEPKKSFS
Sbjct: 841 DDSVSAVKPSPRGRRSLDLKFQEMDFSNSPSPDIKLQKTKTVSHQQRKSNVAAEPKKSFS 900

Query: 901 RARKSLDLERTKRDTPSNGENT 922
           RARKSLDLERTKRDTPSNGENT
Sbjct: 901 RARKSLDLERTKRDTPSNGENT 922

>Sklu_1752.2 YBR059C, Contig c1752 577-3153 reverse complement
          Length = 858

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/609 (56%), Positives = 425/609 (69%), Gaps = 26/609 (4%)

Query: 66  PVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLAC 125
           P LE+L  G+ +IVG+H+VEIVKYLAEGGFAHIYVV+F+E++NELE  P+  L+ GDLAC
Sbjct: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELE-TPSSSLKEGDLAC 85

Query: 126 LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPN 185
           LKRVLVTDENGLNE+RNEV VMKQL    NIVQYYDS+ASR RDGS G+EV LLMELCPN
Sbjct: 86  LKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPN 145

Query: 186 NSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245
            SLLDYMNQRLATKLSE+E+LKIM+DVT+A+AQMH+LP PLIHRD+KIENVLVD+ +NFK
Sbjct: 146 KSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFK 205

Query: 246 LCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 305
           LCDFGSTS+CFP+  THQ+IA+LTNNIYVHTTPQYR+PEMIDLYRCLPI+EKSDIWALGI
Sbjct: 206 LCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGI 265

Query: 306 FLYKLLFYTTPFELTGQFAILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQVMDN 365
           FLYKLLFYTTPFELTGQFAILHSKY+ P NNYSSKLINLIIIMLAENPNLRPNIYQV+  
Sbjct: 266 FLYKLLFYTTPFELTGQFAILHSKYDIPANNYSSKLINLIIIMLAENPNLRPNIYQVIYQ 325

Query: 366 LCSILKVKNPLEDKYQLGSYSFEKYSQYQAKLQKVQYQMYLAYENKQQIDTLNDMFINCF 425
           +C+I+KV  P EDKYQ G Y F+KYS+YQ KLQ  QYQ+Y++Y  KQ +DTLND+FINCF
Sbjct: 326 VCAIMKVDVPFEDKYQTGPYDFDKYSKYQEKLQAFQYQLYISYHQKQDVDTLNDLFINCF 385

Query: 426 EVAPKQPVDISDKKWASGPSSYKTRENKTVPEVNPDVTLAGEEDIGLVQQQFPSVEDLDH 485
           E+APKQP+D+  +  A  P + +  +N+   +    + +  EEDI +VQQ FPSVEDL+ 
Sbjct: 386 EIAPKQPMDMGKRDLAEKPENLEKIQNQQ--DSRKQIPIRDEEDIKMVQQHFPSVEDLEI 443

Query: 486 YLDGENKRDTNKSSSNGAFSTEHXXXXXXKTDLSAIQHAPSVPLEELPSSKPTQNVQAVA 545
           YL  E     NKS    + +  +      K+  S+   +    L     + P +    V 
Sbjct: 444 YLHSEATHFENKSDRLSSLAVPNRS----KSLGSSSHASSVTDLSNGSGNSPEEVSPGVM 499

Query: 546 TSKNMVRDTTARSTNSVKQHKPTNPFPYIQPEKEIYGVDNDSN----SIFHGEGSKSDPE 601
           +S     + TA+ST S+KQHK  NPFP +Q +++               FH    ++   
Sbjct: 500 SS-----NPTAKSTASIKQHKSNNPFPKMQQQQQPQQQQPQFYQQNIDYFHDTSKEAANP 554

Query: 602 QQYFAQDATAVPQPPIKTEQPAQK------QVGPALPTTEAAKSSLKQFRAQPQEPGGEN 655
               AQ        P +     Q+       +  A  T +        +  +P EP  + 
Sbjct: 555 LALNAQQIGYFHSIPTEAASKTQEIAYSPDNLIRAQKTHDQHPQDTANYLPEPVEPPEQ- 613

Query: 656 KISYDQYFS 664
              Y QY+ 
Sbjct: 614 ---YLQYYQ 619

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 84/162 (51%), Gaps = 9/162 (5%)

Query: 769 EEELLVDFSPPLKR----EPQKLDLTYDSVDLSTLSKGEYKDETDIXXXXXXXXXXXXXD 824
           +EELL+D SP  K      P KL++T D VDLS   + +  DE  +             D
Sbjct: 686 QEELLIDLSPEKKETSSVSPPKLNITIDQVDLSYRDEDK-TDEASVADESIASSESIAMD 744

Query: 825 LRQNERLSAKTRGQNVDDSVSAVKPSPRGRRSLDLKFQEMDFSNSPSPDIKLQ----KTK 880
           L++ E+ +      +     +  + S   RRSLDLKFQE++FS SPSP    Q    K  
Sbjct: 745 LKKKEKDTKPKYSSDASFVTAPPQSSRPSRRSLDLKFQEINFSKSPSPKESSQRHQHKES 804

Query: 881 TVSHQQRKSNVAAEPKKSFSRARKSLDLERTKRDTPSNGENT 922
           +  HQ +K   ++E +KS SRARKSLDLE  KR++    + T
Sbjct: 805 SQRHQHKKIPSSSEMRKSLSRARKSLDLEGVKRESAGGSDTT 846

>KLLA0F18612g 1711131..1713575 some similarities with sp|P38080
           Saccharomyces cerevisiae YBR059c AKL1 Ark-family
           Kinase-Like protein, hypothetical start
          Length = 814

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/447 (65%), Positives = 344/447 (76%), Gaps = 22/447 (4%)

Query: 43  MSKSETSSHHVVSGLNSSRSGTLPVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVR 102
           MSKS+T S        ++ S  +P    L   +QV+VG HR EI+++LAEGGFA+IY V+
Sbjct: 1   MSKSDTISRPNSVAHTAATSAMIPNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVK 60

Query: 103 FIEYANELEQ-VPTIKLEVGDLACLKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYD 161
           F+E  NE++  + +  L+ GD+ACLKRV+V DENGLNE+RNEV  MKQL G PNIVQYYD
Sbjct: 61  FLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYD 120

Query: 162 SHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHY 221
           S+ASR  DGS GFE+ LLMELCP  SLLDYMN +LATKL+E EILKIM+DV+ A+AQMHY
Sbjct: 121 SNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHY 180

Query: 222 LPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYR 281
           LP PLIHRD+KIENVLVD + NFKLCDFGSTS CFP+ +THQ+IAVLTNNIYVHTTPQYR
Sbjct: 181 LPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYR 240

Query: 282 SPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEFPVNNYSSKL 341
           SPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYE P N YSSKL
Sbjct: 241 SPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPQNGYSSKL 300

Query: 342 INLIIIMLAENPNLRPNIYQVMDNLCSILKVKNPLEDKYQLGSYSFEKYSQYQAKLQKVQ 401
           INLIIIMLAENP+LRPNIYQVM ++CSILK   P  DKY+LG Y F KYSQY  KLQ++Q
Sbjct: 301 INLIIIMLAENPSLRPNIYQVMHHVCSILKCDVPFTDKYELGPYDFAKYSQYHLKLQQIQ 360

Query: 402 YQMYLAYENKQ----QIDTLNDMFINCFEVAPKQPVDISDKKWASGPSSYKTRENKTVPE 457
           YQM+  Y+N++     +D LND+FI  FE+APKQP+D        G  S   +E    PE
Sbjct: 361 YQMFELYKNEKVTSGDVDKLNDLFIQNFEIAPKQPID-------KGIGSVDQQE---APE 410

Query: 458 VNPDVTLAGEEDIGLVQQQFPSVEDLD 484
              D+    E DI  + + +P+VE L+
Sbjct: 411 ---DL----ETDIAKMDECYPTVEKLE 430

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 67/140 (47%), Gaps = 29/140 (20%)

Query: 786 KLDLTYDSVDLSTLSKGEYKDETDIXXXXXXXXXXXXXDLRQNERLSAKTRGQNV----D 841
           +LDLT+D +DLS  S     D T++             DL+Q +     T+ +       
Sbjct: 673 RLDLTFDQLDLSKNSLTRQSD-TELEESIISDESISL-DLKQPKLKEPVTQPRQTTSPGS 730

Query: 842 DSVSAVKPS--PRGRRSLDLKFQEMDFSNSPSPDIKLQKTKTVSHQQRKSNVAAEPKKSF 899
           +S   +KP+  P+ RRSLDLK+QE++ SN                 QRK     + K SF
Sbjct: 731 ESKEFLKPAKVPK-RRSLDLKYQEINLSND---------------DQRKHR---KNKTSF 771

Query: 900 SR--ARKSLDLERTKRDTPS 917
           SR   R+S+++ER K D+ S
Sbjct: 772 SRTSVRRSVEMERMKHDSNS 791

>YBR059C (AKL1) [250] chr2 complement(356821..360147)
           Serine/threonine protein kinase of unknown function
           [3327 bp, 1108 aa]
          Length = 1108

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/556 (55%), Positives = 370/556 (66%), Gaps = 55/556 (9%)

Query: 66  PVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLAC 125
           P +E+   G  V VG H+VE+V YLAEGGFA IYVV+F+EY NE +   ++ L++GD+AC
Sbjct: 17  PAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVAC 76

Query: 126 LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPN 185
           LKRVLV DENGLNEMRNEV VMK+L G PNIVQY+DS+ASR RDG  GFEV LLMELCPN
Sbjct: 77  LKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPN 136

Query: 186 NSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245
            SLLDYMNQRL+TKL+E EI+KIM+DV  +++QMHYLPV LIHRD+KIENVLVDA +NFK
Sbjct: 137 KSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFK 196

Query: 246 LCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 305
           L DFGSTSTCFP+  THQ+IA+LT NIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG+
Sbjct: 197 LADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGV 256

Query: 306 FLYKLLFYTTPFELTGQFAILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQVMDN 365
           FLYKLLF+TTPFE+TGQFAILHSKYEFPVN YSSKLINLIIIMLAENPNLRPNIYQV+ +
Sbjct: 257 FLYKLLFFTTPFEMTGQFAILHSKYEFPVNKYSSKLINLIIIMLAENPNLRPNIYQVLYH 316

Query: 366 LCSILKVKNPLEDKYQLGSYSFEKYSQYQAKLQKVQYQMYLAYENK---------QQIDT 416
           LC IL V+ P+EDKY  G+Y+F KY+Q+Q KLQ VQ QMY   + K          + + 
Sbjct: 317 LCEILNVEVPIEDKYAEGAYNFSKYTQFQNKLQNVQLQMYQLQQKKIMQNNKLSDSEENL 376

Query: 417 LNDMFINCFEVAPKQPVDISDKKWASG--PSSYKTRE---------------------NK 453
           LNDMF++ FE++ K P++ SD   A    PS    +E                     ++
Sbjct: 377 LNDMFLSSFEISSKLPMNASDGHAAVSRIPSQNVGQELEEEKESQSDQRKSTLSEDKSSR 436

Query: 454 TVPEVNPDVTLAGEEDIGLVQQ-----------------QFPSVEDLDHYLDGENKRDTN 496
           T    N   T    ++I  +Q                   +PSV +LD YLD    ++  
Sbjct: 437 TTSNANSSGTANNPQEINTIQSPGIEDKSIFENKTPGELYYPSVSELDTYLD----KELV 492

Query: 497 KSSSNGAFSTEHXXXXXXKTDLSAIQHAPSVPLEELPSSKPTQNVQAVATSKNMVRDTTA 556
           K SS+   S +          L   Q + S       S K T    A   S   + +   
Sbjct: 493 KQSSDPTISEQSPRLNTQS--LPQRQKSTSSYSSGGRSMKSTSYGAATIGSDEALANEKT 550

Query: 557 RSTNSVKQHKPTNPFP 572
              N +KQHK  NPFP
Sbjct: 551 AGINKMKQHKSNNPFP 566

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 14/21 (66%), Positives = 19/21 (90%)

Query: 894  EPKKSFSRARKSLDLERTKRD 914
            E +KSF+RAR+SLDLER +R+
Sbjct: 1061 EMRKSFARARQSLDLERVRRE 1081

>Scas_661.27
          Length = 1095

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/380 (72%), Positives = 314/380 (82%), Gaps = 10/380 (2%)

Query: 66  PVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTI-KLEVGDLA 124
           P  E+   G+QV VG H+VEI+KY+AEGGFA IY V+FIE+ NE E      KL++GD+A
Sbjct: 17  PNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVA 76

Query: 125 CLKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCP 184
           CLKRVLV DENGLNEMRNEV VMKQL G PNIVQYYDS+ASR  +G  GFEV LLMELCP
Sbjct: 77  CLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCP 136

Query: 185 NNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNF 244
           N SLLDYMNQRLATKL+E+EILKIM+DVT A++QMHYLP PL+HRD+KIENVLVDA +NF
Sbjct: 137 NKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNF 196

Query: 245 KLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 304
           KLCDFGSTST FP+  THQ+IAVLT NIYVHTTPQYRSPEMIDLYRCLPI+EKSDIWALG
Sbjct: 197 KLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALG 256

Query: 305 IFLYKLLFYTTPFELTGQFAILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQVMD 364
           IFLYKLLF+TTPFELTGQFAILHSKYEFP NNYSSKLINLIIIMLAENPNLRPNIYQV+ 
Sbjct: 257 IFLYKLLFFTTPFELTGQFAILHSKYEFPKNNYSSKLINLIIIMLAENPNLRPNIYQVLH 316

Query: 365 NLCSILKVKNPLEDKYQLGSYSFEKYSQYQAKLQKVQYQMYLAYENK---------QQID 415
           N+CSI  +K P+ED+Y  G Y FEKY+ +Q K+Q VQYQ+YL  E K           I+
Sbjct: 317 NICSISGMKVPIEDQYAEGPYDFEKYTHFQNKVQSVQYQLYLLQEKKFKTNGKLPQADIN 376

Query: 416 TLNDMFINCFEVAPKQPVDI 435
            LND+F+  F++A K P ++
Sbjct: 377 LLNDLFVTSFDIASKVPFEL 396

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 41/82 (50%), Gaps = 13/82 (15%)

Query: 842  DSVSAVKPSPRG--RRSLDLKFQEMDFSNSPSPDIKLQKTKTVSHQQRKSNVAAEPKKSF 899
            +S  A + S RG  R   DL+  +    N+ +  I +  T T            E KKSF
Sbjct: 1010 NSKGANRSSSRGNIRGKQDLESYKHSTKNNSNSSIPISTTNT-----------NEMKKSF 1058

Query: 900  SRARKSLDLERTKRDTPSNGEN 921
            ++AR+SLDLER +R+   N +N
Sbjct: 1059 AKARQSLDLERVRREALLNSDN 1080

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 22/29 (75%), Gaps = 4/29 (13%)

Query: 853 GRRSLDLKFQEMDFSNSPSPDIKLQKTKT 881
           GRRSLDL++QE++F    SPD++  K+ +
Sbjct: 935 GRRSLDLRYQEINF----SPDLRKDKSNS 959

>AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH]
           (763309..766194) [2886 bp, 961 aa]
          Length = 961

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/549 (53%), Positives = 362/549 (65%), Gaps = 34/549 (6%)

Query: 68  LEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLK 127
           LE L+ GS V+VG H+VE+++YLAEGGFAHIY V F+ Y NEL++   I L+ GD  CLK
Sbjct: 26  LEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRI-LQPGDTVCLK 84

Query: 128 RVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNS 187
           RV V+DENGLNE+RNEV VMK+L  C NIVQYYDS+ASR  DG  G+EV LLMELCPN S
Sbjct: 85  RVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGS 144

Query: 188 LLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLC 247
           LLDYMNQRLATKLSE E+LKIM+D+T  L+ MHY   PLIHRD+KIENVLVDA++NFKLC
Sbjct: 145 LLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLC 204

Query: 248 DFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFL 307
           DFGSTS C P   +HQEIA+L NNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFL
Sbjct: 205 DFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFL 264

Query: 308 YKLLFYTTPFELTGQFAILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQVMDNLC 367
           YKLLFYTTPFELTGQFAILHSKYE P N++SSKLINL+IIMLAENP LRPN+YQVM ++C
Sbjct: 265 YKLLFYTTPFELTGQFAILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVMYHIC 324

Query: 368 SILKVKNPLEDKYQLGSYSFEKYSQYQAKLQKVQYQMYLAYENKQQ----IDTLNDMFIN 423
           S+++ +  ++D Y  G Y+F+ Y +YQ KLQ++QY M ++++  Q+     D +ND+FI+
Sbjct: 325 SMMECEVKIDDLYGQGPYNFDMYGRYQEKLQRLQYDMLMSHQLAQRGIINTDKVNDLFIS 384

Query: 424 CFEVAPKQPVDISDKKWAS-----GPSSYKTRENKTVPEVNPD-VTLAGEEDIGLVQ--Q 475
            FE APKQP+ +     A       P S  T     + +  P  +   G    G +   Q
Sbjct: 385 TFECAPKQPMVMGQNAVAQQQIFVAPPSTNTSMPVDMQQSLPKPLDHNGPNAHGGLDSLQ 444

Query: 476 QFPSVEDLDHYLDGENKRDTNKSSSNGAFSTEHXXXXXXKTDLSAIQ----HAPSVPLEE 531
           + P   D+ +Y   E        +                TD S +     +  S P   
Sbjct: 445 KLPKSADVGNYPVAETHMHMYADAQKNYIQVPRKEVMMQHTDRSVLSDHSGNGTSTP--S 502

Query: 532 LPSSKPTQNVQAVATSKNMVRDTTARSTNSVKQHKPTNPFPYIQPEKEIYGVDNDSNSIF 591
           LP S P Q+ Q   T K+             KQ+K  NPFP +  +  ++   ++S+   
Sbjct: 503 LPGSCPVQHEQLANTPKS-------------KQYKKNNPFPKMAKQDFVHDTYDESDE-- 547

Query: 592 HGEGSKSDP 600
           H  G    P
Sbjct: 548 HSPGDDPAP 556

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (60%), Gaps = 13/74 (17%)

Query: 854 RRSLDLKFQEMDFSNSPSPDIKLQKTKTVSH-QQRKSNVA-----------AEPKKSFSR 901
           RRSL+L FQE+D S+SP+P +   KT + +H Q  +S  A           +  +KSF R
Sbjct: 868 RRSLELDFQEIDLSSSPTP-VSASKTSSKAHLQPNRSGTANCGTSNSSSVVSGVRKSFHR 926

Query: 902 ARKSLDLERTKRDT 915
            RKS+DL+ +K+++
Sbjct: 927 GRKSVDLDVSKKES 940

>CAGL0H10208g complement(996853..999936) similar to sp|P38080
           Saccharomyces cerevisiae YBR059c AKL1 Ark-family
           Kinase-Like protein, hypothetical start
          Length = 1027

 Score =  523 bits (1346), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 266/467 (56%), Positives = 332/467 (71%), Gaps = 40/467 (8%)

Query: 66  PVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPT-IKLEVGDLA 124
           P  E+   G  + VG HRVEIV YLAEGGFA IYVV+F+EY NE E + +   + VGD+A
Sbjct: 15  PNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIA 74

Query: 125 CLKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCP 184
           CLKRV+V DE GLNEMRNEV VMK+L   PNIVQY+DS+ASR  DG  GFEV LLMELCP
Sbjct: 75  CLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCP 134

Query: 185 NNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNF 244
           N SLLDYMNQRL TKLSE EILKIM+DV+  ++ MHYL  PLIHRD+KIENVLVDAN+NF
Sbjct: 135 NKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNF 194

Query: 245 KLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 304
           KLCD GSTS C P   ++Q+IA++T NIYVHTTPQYR+PEMIDLYR LPINEKSDIWALG
Sbjct: 195 KLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALG 254

Query: 305 IFLYKLLFYTTPFELTGQFAILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQVMD 364
           IFLYKLLFYTTPFE+TGQ AILHSKY+FP N YSSK+INLIIIMLAENPNLRPNI+QV+ 
Sbjct: 255 IFLYKLLFYTTPFEITGQMAILHSKYDFPPNKYSSKIINLIIIMLAENPNLRPNIFQVVY 314

Query: 365 NLCSILKVKNPLEDKYQLGSYSFEKYSQYQAKLQKVQYQM-YLAYE--------NKQQID 415
           ++CSI+ +  P+ED+Y LG Y+F+ Y+++Q+K+Q +Q Q+ YL  +        +K+   
Sbjct: 315 HICSIMNLPVPIEDRYGLGPYNFDLYTKFQSKVQTIQNQINYLQNKVVSSKSKLSKEDGL 374

Query: 416 TLNDMFINCFEVAPKQPVDISDKKWASGPSSYKTRENKTVPEVNPDVTLAGEEDIGLVQQ 475
            L++++I  FE+ PK P                   N  + E  P +      +IGL   
Sbjct: 375 VLDELYIKTFEMIPKIP-------------------NPRLSEKQPTL------EIGL--- 406

Query: 476 QFPSVEDLDHYLDGENKRDTNKSSSNGAFSTEHXXXXXXKTDLSAIQ 522
             PS++  D +LD  NKR +   S N   ++++      +T  + I+
Sbjct: 407 NSPSIQ--DQHLDVNNKRRSMHESINSRQASDNISQKSVRTSSNTIE 451

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/24 (62%), Positives = 20/24 (83%)

Query: 894  EPKKSFSRARKSLDLERTKRDTPS 917
            E K+SF++AR+SLDLER +RD  S
Sbjct: 985  EMKRSFAKARQSLDLERARRDAMS 1008

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 48/125 (38%), Gaps = 30/125 (24%)

Query: 770 EELLVDFSPP--LKR--------------EPQKLDLTYDSVDLSTLSKGEYKDETDIXXX 813
           E+LL+D SPP  +KR               PQ LDL  + +D+S  S  +  +  D+   
Sbjct: 760 EQLLIDISPPRDIKRTSSPQKELSNVKTHAPQVLDLQLNEMDISEASIADSSNGNDVDSS 819

Query: 814 XXXXXXXXXXDLRQNERLSAKTRGQNVDDSVSAVKP-----------SPRGRRSLDLKFQ 862
                     DL    RL       N   +  A KP              GRRSLDL  Q
Sbjct: 820 LLSSESV---DLDVTNRLKMHYPFGNQRQTKLAQKPIQSKVKDTDKQQKNGRRSLDLSVQ 876

Query: 863 EMDFS 867
           E+ F+
Sbjct: 877 EVHFN 881

>CAGL0K11990g complement(1155395..1158370) some similarities with
           sp|P38080 Saccharomyces cerevisiae YBR059c AKL1
           Ark-family Kinase-Like protein, hypothetical start
          Length = 991

 Score =  504 bits (1298), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 246/393 (62%), Positives = 301/393 (76%), Gaps = 22/393 (5%)

Query: 67  VLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELE----QVPTIKLEVGD 122
           + E+   G  V VG+HRVE+V YLAEGGFA IYVV+F+EY NE E    +     L+ G 
Sbjct: 92  IEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGS 151

Query: 123 LACLKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSS----GFEVTL 178
            ACLKRVLV DE GLN+MR+EV VMK+L G PNIVQY+DS+ASR RD S     GFEV L
Sbjct: 152 PACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLL 211

Query: 179 LMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLV 238
           LMELCPN SLLDYMNQRLATKL+EQEI KIM+D+T A+AQMHYLPVPLIHRD+KIENVLV
Sbjct: 212 LMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLV 271

Query: 239 DANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKS 298
           DAN+NFKLCDFGSTSTCFP   + Q+IA+L+ ++Y+HTTPQYRSPEMIDL++ +PINEKS
Sbjct: 272 DANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKS 331

Query: 299 DIWALGIFLYKLLFYTTPFELTGQFAILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPN 358
           DIWALG+FLYKLLF+TTPFE TGQFA+LHSK+EFP N+YSSKLINLII+MLAENP+LRPN
Sbjct: 332 DIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPNSYSSKLINLIIVMLAENPSLRPN 391

Query: 359 IYQVMDNLCSILKVKNP---LEDKYQLGSYSFEKYSQYQAKLQKVQYQMYL--------- 406
           IYQV+  L  +   + P   L DKY  G Y+FEKY+++Q + Q+VQ Q+           
Sbjct: 392 IYQVLYYLSEVTNREVPPTVLSDKYGQGPYNFEKYTRFQKESQQVQLQLSTLQAKINDPN 451

Query: 407 AYENKQQIDTLNDMFINCFEVAPKQPVDISDKK 439
           +       +  + M+++ F + P+ PV  SD+K
Sbjct: 452 STMQPADWELYDRMYMSAFTIVPQLPV--SDRK 482

>Kwal_27.11542
          Length = 791

 Score =  329 bits (843), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 165/314 (52%), Positives = 209/314 (66%), Gaps = 14/314 (4%)

Query: 74  GSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTD 133
           G+ + VG+H+  I+KYL  GGFAHIY           E  P     +G++ACLKRVLV D
Sbjct: 12  GTALTVGSHQARIIKYLTSGGFAHIY---------SAEISPADPNSIGNVACLKRVLVPD 62

Query: 134 ENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASR--ARDGSSGFEVTLLMELCPNNSLLDY 191
           +  LN +R EV  MK L G  ++V Y DSHA++  A+DGS  +EV LLME C    L+D+
Sbjct: 63  KQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGS--YEVFLLMEYCSAGGLIDF 120

Query: 192 MNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGS 251
           MN RL  +L+E E+LKIM D+T+ +A MH L  PLIHRD+KIENVL+  +  FK+CDFGS
Sbjct: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180

Query: 252 TSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLL 311
                      QE + + N+I  +TT QYRSPEMIDLYR  PINEKSDIWALG+FLYKL 
Sbjct: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240

Query: 312 FYTTPFELTGQFAILHSKYEFPVN-NYSSKLINLIIIMLAENPNLRPNIYQVMDNLCSIL 370
           +YTTPFE  G  AILHS+++FP    YS +L NLI +ML+ENPN RPNI QV++ +  I 
Sbjct: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300

Query: 371 KVKNPLEDKYQLGS 384
            V  PL + Y L S
Sbjct: 301 NVPCPLRNFYLLRS 314

>KLLA0E08371g complement(756205..758538) similar to sp|P40494
           Saccharomyces cerevisiae YIL095w PRK1 serine/threonine
           protein kinase involved in regulation of actin
           cytoskeleton organization, start by similarity
          Length = 777

 Score =  305 bits (782), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 156/318 (49%), Positives = 205/318 (64%), Gaps = 10/318 (3%)

Query: 66  PVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLAC 125
           P +E+  +G+ + VG+H+V+++KYLA GGFAH+Y V         E  P   +   ++AC
Sbjct: 4   PQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSV---------EISPPDPVCPDNVAC 54

Query: 126 LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPN 185
           LKRV+V D+  LN +R EV  MK L G   IV Y DSHA+++      +EV LLME C  
Sbjct: 55  LKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSG 114

Query: 186 NSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245
             L+D+MN RL  +L E EIL IM  V++ +A MH L  PLIHRD+KIENVL+  NH FK
Sbjct: 115 GGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFK 174

Query: 246 LCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 305
           LCDFGS S         +E   +  +I  +TT QYR PEMIDLYR LPI+EKSDIWALG+
Sbjct: 175 LCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGV 234

Query: 306 FLYKLLFYTTPFELTGQFAILHSKYEFPVN-NYSSKLINLIIIMLAENPNLRPNIYQVMD 364
           FLYK  +YTTPFE  G+ AIL SK+EFP    YS ++ NLI +ML  +P  RPNI QV++
Sbjct: 235 FLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVE 294

Query: 365 NLCSILKVKNPLEDKYQL 382
            +  I  +  P+++ Y L
Sbjct: 295 EVSRIQGIPCPIKNFYLL 312

>Sklu_2226.7 YIL095W, Contig c2226 8986-11373
          Length = 795

 Score =  305 bits (780), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 153/316 (48%), Positives = 201/316 (63%), Gaps = 11/316 (3%)

Query: 66  PVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLAC 125
           P LE   +G+ + VG+H+  I+KYL  GGFAHIY            ++         +AC
Sbjct: 4   PPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSA----------EISPPDPNSSSIAC 53

Query: 126 LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPN 185
           LKRVLV D+  LN +R EV  MK L     +V Y DSHA+++   +  +EV LLME C  
Sbjct: 54  LKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCAR 113

Query: 186 NSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245
             L+D+MN RL  +L E E+LKIM  V++ +A MH L  PLIHRD+KIENVL+  + NFK
Sbjct: 114 GGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFK 173

Query: 246 LCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 305
           +CDFGS           QE+  + ++I  +TT QYRSPEMIDLYR LP++EKSDIWALG+
Sbjct: 174 VCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGV 233

Query: 306 FLYKLLFYTTPFELTGQFAILHSKYEFPVN-NYSSKLINLIIIMLAENPNLRPNIYQVMD 364
           FLYKL +YTTPFE  G+ AILHSK++FP    YS +L NLI  +L ENP  RPNI Q++ 
Sbjct: 234 FLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLA 293

Query: 365 NLCSILKVKNPLEDKY 380
            +  I  V  P+++ Y
Sbjct: 294 EVSRIQGVPCPVKNFY 309

>Scas_601.6
          Length = 661

 Score =  299 bits (765), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 148/312 (47%), Positives = 202/312 (64%), Gaps = 10/312 (3%)

Query: 74  GSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTD 133
           G+ + VG+H+V++VKYL  GGFA IY V+           P  K    ++ACLKRV+V D
Sbjct: 12  GTLLTVGSHKVQVVKYLTSGGFAQIYTVQI---------SPPDKFTNTNVACLKRVIVPD 62

Query: 134 ENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMN 193
           +  LN +R EV  MK L    ++V Y DSHA++       +EV LLME C    L+D+MN
Sbjct: 63  KPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMN 122

Query: 194 QRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTS 253
            RL  +L E EIL IM  VT+ +A MH L  PL+HRD+KIENVL+ +   +K+CDFGS  
Sbjct: 123 TRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVC 182

Query: 254 TCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFY 313
                 +  QE++ + ++I  +TT QYR+PEMIDLYR LPI+EKSDIWALG+FLYKL +Y
Sbjct: 183 GIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYY 242

Query: 314 TTPFELTGQFAILHSKYEFP-VNNYSSKLINLIIIMLAENPNLRPNIYQVMDNLCSILKV 372
           TTPFE  G+ AILH+ ++FP    YS +L  LI  ML E P+ RPN YQV++ + S+  V
Sbjct: 243 TTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQNV 302

Query: 373 KNPLEDKYQLGS 384
           + P+ + Y + +
Sbjct: 303 QCPIPNFYLMNN 314

>CAGL0G02607g complement(240244..242310) similar to sp|P40494
           Saccharomyces cerevisiae YIL095w PRK1, start by
           similarity
          Length = 688

 Score =  298 bits (764), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 166/395 (42%), Positives = 233/395 (58%), Gaps = 27/395 (6%)

Query: 66  PVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLAC 125
           P L+++  G+Q+ VG H V+I+KYL  GGFA IY V  +                 ++AC
Sbjct: 4   PELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMG---------LFNGSNVAC 54

Query: 126 LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPN 185
           LKRV V D+  LN +R EV  MK L+   ++V Y DSHA+R+      +EV LLME C  
Sbjct: 55  LKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEG 114

Query: 186 NSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245
             L+D+MN RL  +L+E EIL IM   T+ +A MH L  PL+HRD+KIENVL+     +K
Sbjct: 115 GGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYK 174

Query: 246 LCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 305
           +CDFGS S         QE+  + ++I  +TT QYR PEM+DLYR LPI+EK+DIWALG+
Sbjct: 175 VCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGV 234

Query: 306 FLYKLLFYTTPFELTGQFAILHSKYEFP-VNNYSSKLINLIIIMLAENPNLRPNIYQVMD 364
           FLYKL +YTTPFE  G+ AILH++++FP   NYS +L NLI  ML E+P+ RPN+ QV++
Sbjct: 235 FLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLE 294

Query: 365 NLCSILKVKNPLEDKYQLGSYSFEKYSQYQAKLQKVQY-QMYLAYENKQQIDTLNDMFIN 423
            +  +  V  P+ + Y L +    K S       ++ Y Q+ L      Q D L++  I 
Sbjct: 295 EVSRMQNVPCPIRNFYLLRAMEKVKLS------TEIDYPQLQLQKLRNAQADNLSNPMI- 347

Query: 424 CFEVAPKQPVDISDKKWASGPSSYKTRENKTVPEV 458
                  +P+ I+ +   SG  +     N+T+P V
Sbjct: 348 -------KPMPIAQRPTFSG--NGMVNNNRTLPTV 373

>ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C
           (ARK1) - SH] complement(321493..323745) [2253 bp, 750
           aa]
          Length = 750

 Score =  295 bits (755), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 150/311 (48%), Positives = 199/311 (63%), Gaps = 11/311 (3%)

Query: 71  LKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVL 130
           L+ G  + VG+H V+I++YL  GGFA IY          L   P      G LACLKRV 
Sbjct: 9   LQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEV------LSPGPI----QGSLACLKRVH 58

Query: 131 VTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLD 190
           V D+  LN +R EV  MK L G  ++V Y DSHA+++      +EV LLME C    L+D
Sbjct: 59  VPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLID 118

Query: 191 YMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFG 250
           +MN RL T+LSE E+LKIM  V + +  MH L  PLIHRD+KIENVL+  + +FK+CDFG
Sbjct: 119 FMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFG 178

Query: 251 STSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 310
           S S          E   + ++I  +TT QYR+PEMIDLYR LP++EKSDIWALG+FLYK+
Sbjct: 179 SVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKV 238

Query: 311 LFYTTPFELTGQFAILHSKYEFP-VNNYSSKLINLIIIMLAENPNLRPNIYQVMDNLCSI 369
            ++TTPFE  G+ AIL +K++FP    Y+ +L NLI +ML+E+P  RPNI QV++ +  I
Sbjct: 239 CYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRI 298

Query: 370 LKVKNPLEDKY 380
             V  PL + Y
Sbjct: 299 QGVPCPLPNFY 309

>YNL020C (ARK1) [4567] chr14 complement(595621..597537)
           Serine/threonine protein kinase associated with cortical
           actin cytoskeleton [1917 bp, 638 aa]
          Length = 638

 Score =  291 bits (746), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 149/314 (47%), Positives = 197/314 (62%), Gaps = 10/314 (3%)

Query: 66  PVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLAC 125
           P +     G+Q+ VG+H+VEI+KYL  GGFA +Y              P        +AC
Sbjct: 4   PQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALI---------NPPDPHSNSSVAC 54

Query: 126 LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPN 185
           LKRV+V D+  LN +R EV  M+ L     +V Y DSHA++A   +  +EV +LME C  
Sbjct: 55  LKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCER 114

Query: 186 NSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245
             L+D+MN RL  +L E EIL+IM  VT+ +A MH L  PLIHRD+KIENVL+ AN+ +K
Sbjct: 115 GGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYK 174

Query: 246 LCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 305
           LCDFGS           QE++ +  +I  +TT QYRSPEMID +R LPI+EKSDIWALGI
Sbjct: 175 LCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGI 234

Query: 306 FLYKLLFYTTPFELTGQFAILHSKYEFPVN-NYSSKLINLIIIMLAENPNLRPNIYQVMD 364
           FLYKL +YTTPFE  G  AIL  K+EFP+  NYS +L  LI  +L ++P  RPN+YQ++ 
Sbjct: 235 FLYKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLK 294

Query: 365 NLCSILKVKNPLED 378
            +  +  V  P+ D
Sbjct: 295 RISIMQNVPCPIND 308

>Scas_671.16
          Length = 723

 Score =  291 bits (746), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 145/308 (47%), Positives = 196/308 (63%), Gaps = 10/308 (3%)

Query: 74  GSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTD 133
           G+ + VG+H  +I+KYL  GGFA IY           E  P         ACLKRV+V D
Sbjct: 12  GTLLTVGSHYCKIIKYLTSGGFAQIYTT---------EISPINPYNNSQTACLKRVIVPD 62

Query: 134 ENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMN 193
           + GLN +R EV  MK L    ++V Y DSHA+R+   +  +EV LLME C    L+D+MN
Sbjct: 63  KAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMN 122

Query: 194 QRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTS 253
            RL  +L+E+EIL I+    + ++ MH L   LIHRD+KIENVL+ A   FK+CDFGS  
Sbjct: 123 TRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVC 182

Query: 254 TCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFY 313
           +        QE+A + +++  +TT QYR+PEM+DLYR LPINEKSDIWALG+FLYKL +Y
Sbjct: 183 SYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYY 242

Query: 314 TTPFELTGQFAILHSKYEFPVNN-YSSKLINLIIIMLAENPNLRPNIYQVMDNLCSILKV 372
           TTPFE  G+ AILHS+Y++P    Y+ KL NLI   L E+P+ RPNI Q+++ +  I  +
Sbjct: 243 TTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQGI 302

Query: 373 KNPLEDKY 380
             P+ + Y
Sbjct: 303 PCPINNFY 310

>YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine
           protein kinase involved in regulation of actin
           cytoskeleton organization [2433 bp, 810 aa]
          Length = 810

 Score =  290 bits (743), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 150/354 (42%), Positives = 214/354 (60%), Gaps = 14/354 (3%)

Query: 66  PVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLAC 125
           P +   + G+ + VG+H  +I+KYL  GGFA +Y           E  P       ++AC
Sbjct: 4   PQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTA---------EISPPDPYSNANIAC 54

Query: 126 LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPN 185
           LKRV+V  + GLN +R EV  MK L    ++V Y DSHA+R+ +G + +EV +LME C  
Sbjct: 55  LKRVIVPHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARSVNGIA-YEVFVLMEFCER 113

Query: 186 NSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245
             L+D+MN RL  +L E EIL+IM    + +  MH L  PLIHRD+KIENVL+  +  +K
Sbjct: 114 GGLIDFMNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYK 173

Query: 246 LCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 305
           +CDFGS S         QE   + ++I  +TT QYRSPEMIDLYR LPI+EKSDIWALG+
Sbjct: 174 VCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGV 233

Query: 306 FLYKLLFYTTPFELTGQFAILHSKYEFP-VNNYSSKLINLIIIMLAENPNLRPNIYQVMD 364
           FLYK+ +YTTPFE +G+  ILH++Y++P    YS +L NLI +ML E P+ RPNI QV++
Sbjct: 234 FLYKICYYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLE 293

Query: 365 NLCSILKVKNPLEDKYQLGSYSFEKYSQYQAKLQKVQY---QMYLAYENKQQID 415
            +  +     P+ + Y L + +    +Q   +     Y   Q ++  ++ Q I+
Sbjct: 294 EVSRLQNKPCPIRNFYLLRAMNQNANTQLAGEPSSTTYVPTQKFIPVQSLQSIN 347

>CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces
           cerevisiae YNL020c ARK1 or sp|P40494 Saccharomyces
           cerevisiae YIL095w PRK1, start by similarity
          Length = 622

 Score =  281 bits (720), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 140/312 (44%), Positives = 200/312 (64%), Gaps = 10/312 (3%)

Query: 66  PVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLAC 125
           P + + + G+ V VG+H V I+KYL  GG+A IY  + +         P  +    ++A 
Sbjct: 4   PHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIM---------PADQFLGTNMAV 54

Query: 126 LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPN 185
           LKRV+V D++ LN +R EV  MK+L     IV Y DSHA++++     +EV L+ME C  
Sbjct: 55  LKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSR 114

Query: 186 NSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245
             L+D+MN RL  +L+E EIL I   +++ +A MH L  PLIHRD+KIENVL+  +H +K
Sbjct: 115 GGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYK 174

Query: 246 LCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 305
           LCDFGS S       T +E+A + ++I + TT QYR+PEM+DL +   +N+KSDIWALG+
Sbjct: 175 LCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGV 234

Query: 306 FLYKLLFYTTPFELTGQFAILHSKYEF-PVNNYSSKLINLIIIMLAENPNLRPNIYQVMD 364
           FLYKL +YTTPFE TG+  IL+   EF P  +YS  +  LI+ MLA+NP  RPNI+Q++ 
Sbjct: 235 FLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294

Query: 365 NLCSILKVKNPL 376
            +  +L V  P+
Sbjct: 295 TVSKLLNVNCPI 306

>KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication, start by similarity
          Length = 708

 Score =  105 bits (262), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 82/283 (28%), Positives = 135/283 (47%), Gaps = 39/283 (13%)

Query: 89  YLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNEMRNEVSVMK 148
           +L EGGFA  +            Q+   K +V     + ++ +  E    ++ +E+ + K
Sbjct: 95  FLGEGGFARCF------------QMKDDKGKVFAAKTVAKLSIKSEKTRRKLLSEIQIHK 142

Query: 149 QLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQEILKI 208
            +   PNIVQ+ D              V +L+E+CPN S+++ + QR    L+E E+   
Sbjct: 143 SMKH-PNIVQFTDCFEDDT-------NVYILLEICPNGSVMELLRQR--KHLTEPEVRFC 192

Query: 209 MFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVL 268
           M  +  A+  MH   V  IHRD+K+ N+  D  +N K+ DFG  +    +AN  +    +
Sbjct: 193 MIQIIGAIRYMHSRRV--IHRDLKLGNIFFDKEYNLKIGDFGLAAV---LANDKERKYTI 247

Query: 269 TNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFEL----TGQFA 324
                   TP Y +PE++   +    + + DIW++G+ LY LLF   PF+     T    
Sbjct: 248 CG------TPNYIAPEVLT-GKHTGHSYEVDIWSIGVMLYALLFGKPPFQAKEVETIYER 300

Query: 325 ILHSKYEFPVNN-YSSKLINLIIIMLAENPNLRPNIYQVMDNL 366
           I    + FP +   SS   NLI  +L  NP  RP++Y++ DN+
Sbjct: 301 IKCRDFIFPADKPVSSDAKNLISHLLQLNPAARPSLYEITDNV 343

>YMR001C (CDC5) [3966] chr13 complement(269019..271136)
           Serine/threonine protein kinase required for exit from
           mitosis and for inactivation of the Rad53p checkpoint
           kinase during adaptation to unrepaired DNA damage,
           member of the polo family of protein kinases [2118 bp,
           705 aa]
          Length = 705

 Score = 97.4 bits (241), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 82/284 (28%), Positives = 137/284 (48%), Gaps = 45/284 (15%)

Query: 89  YLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVL---VTDENGLNEMRNEVS 145
           +L EGGFA  +                IK + G++   K V    +  E    ++ +E+ 
Sbjct: 87  FLGEGGFARCF---------------QIKDDSGEIFAAKTVAKASIKSEKTRKKLLSEIQ 131

Query: 146 VMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQEI 205
           + K +S  PNIVQ+ D       D S+   V +L+E+CPN SL++ + +R    L+E E+
Sbjct: 132 IHKSMSH-PNIVQFIDCF----EDDSN---VYILLEICPNGSLMELLKRRKV--LTEPEV 181

Query: 206 LKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEI 265
                 +  A+  MH   V  IHRD+K+ N+  D+N+N K+ DFG  +    +AN  +  
Sbjct: 182 RFFTTQICGAIKYMHSRRV--IHRDLKLGNIFFDSNYNLKIGDFGLAAV---LANESERK 236

Query: 266 AVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAI 325
             +        TP Y +PE++ + +    + + DIW+LG+ LY LL    PF+      I
Sbjct: 237 YTICG------TPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTI 289

Query: 326 LH----SKYEFPVNN-YSSKLINLIIIMLAENPNLRPNIYQVMD 364
                   + FP +   S +   LI  +L+ +P  RP++ ++MD
Sbjct: 290 YERIKCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIMD 333

>Sklu_2419.9 YMR001C, Contig c2419 14049-16136
          Length = 695

 Score = 97.1 bits (240), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 80/286 (27%), Positives = 138/286 (48%), Gaps = 49/286 (17%)

Query: 89  YLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNEMRNEVSVMK 148
           +L EGGFA  + ++  + + ++    T+           ++ +  E    ++ +E+ + K
Sbjct: 82  FLGEGGFARCFQMK--DDSGKIFAAKTVA----------KISIKSEKTRKKLLSEIQIHK 129

Query: 149 QLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQEILKI 208
            +   PNIVQ+ D              V +L+E+CPN SL+D + +R    L+E E+   
Sbjct: 130 SMKH-PNIVQFIDCFEDDT-------NVYILLEICPNGSLMDLLKKRKV--LTEPEVRYF 179

Query: 209 MFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVL 268
              +  A+  MH   V  IHRD+K+ N+  D+N+N K+ DFG               AVL
Sbjct: 180 TTQIVGAIKYMHNRRV--IHRDLKLGNIFFDSNYNLKIGDFGLA-------------AVL 224

Query: 269 TNN----IYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFA 324
            N+      V  TP Y +PE++         E  DIW++G+ +Y LL    PF+   +  
Sbjct: 225 ANDRERKYTVCGTPNYIAPEVLAGKHSGHSYE-VDIWSIGVMIYALLIGKPPFQ-AKEVN 282

Query: 325 ILHSK-----YEFPVNNYSSK-LINLIIIMLAENPNLRPNIYQVMD 364
           I++ +     Y FP    +SK ++ LI  +L+ +P  RP++ ++MD
Sbjct: 283 IIYERIKSGDYIFPREKPTSKEVMVLIQDILSIDPIERPSLDEIMD 328

>Scas_644.15
          Length = 726

 Score = 95.5 bits (236), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 82/290 (28%), Positives = 134/290 (46%), Gaps = 53/290 (18%)

Query: 89  YLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLK---RVLVTDENGLNEMRNEVS 145
           +L EGGFA  +                IK E G +   K   ++ +  E    ++ +E+ 
Sbjct: 97  FLGEGGFARCF---------------QIKDESGKIFAAKTVAKISIKTEKTKKKLLSEIQ 141

Query: 146 VMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQEI 205
           + K +   PNIV + D              V +L+E+C N SL+D M +R    L+E E+
Sbjct: 142 IHKSMKH-PNIVHFVDCFEDDT-------NVYILLEICSNGSLMDLMKKR--KTLTEPEV 191

Query: 206 LKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEI 265
                 +  A+  MH   V  IHRD+K+ N+  D ++N K+ DFG               
Sbjct: 192 RFFTTQICGAVKYMHSRRV--IHRDLKLGNIFFDKDYNLKVGDFGLA------------- 236

Query: 266 AVLTNN----IYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTG 321
           AVL NN      V  TP Y +PE++ + +    + + DIW++G+ +Y LL    PF+   
Sbjct: 237 AVLANNRERKYTVCGTPNYIAPEVL-MGKHAGHSFEVDIWSIGVMIYALLVGKPPFQAKD 295

Query: 322 QFAILH----SKYEFPVNNY-SSKLINLIIIMLAENPNLRPNIYQVMDNL 366
              I       +Y +P + Y SS+   LI  +L  +P  RP+I +++D++
Sbjct: 296 VNVIYDRIKACQYGYPKDKYVSSEAKTLIADILCVDPVERPSIREIIDDV 345

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score = 94.0 bits (232), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 81/289 (28%), Positives = 134/289 (46%), Gaps = 48/289 (16%)

Query: 79  VGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLN 138
           +GN++  I K++ EG F  +Y                  L    L   K VL T      
Sbjct: 34  IGNYK--ISKFIGEGSFGKVY------------------LATHRLTHQKVVLKTGNKRDP 73

Query: 139 EMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLAT 198
            +  EV   +Q    P I + Y+   + +R       V +++E C  + L +++ +    
Sbjct: 74  NVVREVFYHRQFD-FPYITKLYEVIVTESR-------VWMVLEYCSGHELYEHLLKE--Q 123

Query: 199 KLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPV 258
           +LS +E  K+   +  A+   H L    +HRD+K+ENVL+D N + KL DFG T      
Sbjct: 124 RLSLEESKKLFSQIASAVYYAHELKC--VHRDLKLENVLLDGNGHAKLTDFGFT------ 175

Query: 259 ANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF- 317
               +E+A  +    +  T  Y +PE+I+  +C     K DIW+LGI LY ++    PF 
Sbjct: 176 ----REMATRSQLETICGTTVYMAPELIE-RKCYD-GFKVDIWSLGIILYTMINGYMPFD 229

Query: 318 ---ELTGQFAILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQVM 363
              ++  +  I++ + +F     S   I+LI  ML +NPN R ++ QV+
Sbjct: 230 EDDDIKTKLKIVNDELDFNQEWISDDAIDLIQGMLRKNPNERISLAQVL 278

>Kwal_56.24274
          Length = 346

 Score = 90.9 bits (224), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 88/334 (26%), Positives = 140/334 (41%), Gaps = 61/334 (18%)

Query: 75  SQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDE 134
           S V +   +  I K L EGG + +Y+V   E   EL  +   +   G +           
Sbjct: 17  SFVSINGRKYRIQKLLGEGGLSFVYLVESKE--GELFALKKTRCPFGSIG---------- 64

Query: 135 NGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQ 194
             ++    EV+  ++ S  P I Q  DS   + +DGS    V +L+      SL D +N+
Sbjct: 65  -SISPAMKEVANYQRFSS-PYIAQIVDSQVVQEKDGSK--TVYVLLPYFAKGSLQDLINR 120

Query: 195 RL--ATKLSEQEILKIMFDVTRALAQMH-------------YLPVPLI------------ 227
            L   T++SE +IL++   + R L  +H              +  P              
Sbjct: 121 HLLDCTQMSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELD 180

Query: 228 ----------HRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTT 277
                     HRDVK  N+++       + D GS S      N+ Q +         + T
Sbjct: 181 TFGESQQSYAHRDVKPSNIMISPEDLPVISDLGSCSRARIDINSRQALLRFQEWSSDNCT 240

Query: 278 PQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE----LTGQ---FAILHSKY 330
             Y +PE++D+     I EK DIW+ G  +Y + F  +PFE    ++G    +AI   KY
Sbjct: 241 LSYAAPEILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKY 300

Query: 331 EFPVN-NYSSKLINLIIIMLAENPNLRPNIYQVM 363
             P   +YSS LI LI   L+ NP  RP++ +++
Sbjct: 301 TVPRGTSYSSSLIELIGKCLSVNPEQRPSVNELI 334

>CAGL0J11638g complement(1128620..1130860) highly similar to
           sp|P32562 Saccharomyces cerevisiae YMR001c CDC5 involved
           in regulation of DNA replication, hypothetical start
          Length = 746

 Score = 92.0 bits (227), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 79/289 (27%), Positives = 134/289 (46%), Gaps = 53/289 (18%)

Query: 88  KYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLK---RVLVTDENGLNEMRNEV 144
           ++L EGGFA  +                IK + G +   K   ++ +  E    ++ +E+
Sbjct: 85  QFLGEGGFARCF---------------QIKDDSGKIFAAKTVAKISIKSEKTRKKLLSEI 129

Query: 145 SVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQE 204
            + K +S   NIVQ+ D              V +L+E+CPN SL++ + +R    ++E E
Sbjct: 130 QIHKSMSHT-NIVQFIDCFEDNV-------NVYILLEICPNGSLMELIKKR--KTITEPE 179

Query: 205 ILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQE 264
           +   M  +   +  MH   V  IHRD+K+ N+  D ++N K+ DFG              
Sbjct: 180 VRFFMTQICGGIQYMHSNRV--IHRDLKLGNIFFDEHYNLKIGDFGLA------------ 225

Query: 265 IAVLTNN----IYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFEL- 319
            AVL N+      +  TP Y +PE++ + +    + + DIW++G+ LY LL    PF+  
Sbjct: 226 -AVLANDRERKFTICGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAK 283

Query: 320 ---TGQFAILHSKYEFPVNNYSSKLIN-LIIIMLAENPNLRPNIYQVMD 364
              T    I    + +P +   S+    LI  +L+ NP  RP+I ++MD
Sbjct: 284 DVNTIYERIKQRNFAYPKDKKISQDAKYLIDDILSLNPMERPSIQEIMD 332

>Sklu_2361.3 YPL150W, Contig c2361 3677-6331
          Length = 884

 Score = 91.7 bits (226), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 81/300 (27%), Positives = 138/300 (46%), Gaps = 52/300 (17%)

Query: 70  QLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRV 129
           Q  +   V +GN++  IVK + EG F  +Y+      AN       + L+ G+       
Sbjct: 25  QFSSNELVDIGNYK--IVKLIGEGSFGKVYL------ANHRLTHQKVVLKTGN------- 69

Query: 130 LVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLL 189
               +N  N +R EV   +Q    P+I + Y+   + ++       V + +E CP   L 
Sbjct: 70  ----KNDPNVVR-EVFYHRQFD-FPHITKLYEVIVTESK-------VWMALEYCPGKELY 116

Query: 190 DYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDF 249
           +Y+   +  ++S +E  K+   +  A+   H L    +HRD+K+EN+L+D     K+ DF
Sbjct: 117 EYL--LMQHRISLEESGKLFAQIVSAVYYAHSLQC--VHRDLKLENILLDKKGRAKITDF 172

Query: 250 GSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDL--YRCLPINEKSDIWALGIFL 307
           G T  C          A  T    V  T  Y +PE+I+   Y    I    DIW+LG+ L
Sbjct: 173 GFTREC----------ATKTMLETVCGTTVYMAPELIERKSYDGFKI----DIWSLGVIL 218

Query: 308 YKLLFYTTPF----ELTGQFAILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQVM 363
           Y ++  T PF    E   ++ I++ +  +  +  S    +LI  +L ++P+ RP + QV+
Sbjct: 219 YTMIHGTMPFDEEDETKTKWKIINEEPFYNDDVVSKDAKDLISQLLCKDPSQRPQLSQVL 278

>ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH]
           complement(344395..346521) [2127 bp, 708 aa]
          Length = 708

 Score = 91.3 bits (225), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 74/281 (26%), Positives = 131/281 (46%), Gaps = 39/281 (13%)

Query: 89  YLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNEMRNEVSVMK 148
           +L EGGFA  +            Q+     +V     + ++ +  E    ++ +E+ + K
Sbjct: 78  FLGEGGFARCF------------QMKDDSGKVFAAKTVAKISIKSEKTRKKLLSEIQIHK 125

Query: 149 QLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQEILKI 208
            +   PNIVQ+ D              V +L+E+CPN SL+D + QR   +L+E E+   
Sbjct: 126 SMKH-PNIVQFTDCFEDDT-------NVYILLEICPNGSLMDLLKQR--KQLTEPEVRFF 175

Query: 209 MFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVL 268
              +  A+  MH   +  IHRD+K+ N+  D + N K+ DFG  +    +AN  +    +
Sbjct: 176 TTQIVGAIKYMHSRRI--IHRDLKLGNIFFDKHFNLKIGDFGLAAV---LANDRERKYTI 230

Query: 269 TNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILH- 327
                   TP Y +PE++   +    + + DIW++G+ +Y LL    PF+      I   
Sbjct: 231 CG------TPNYIAPEVLT-GKHTGHSFEVDIWSIGVMIYALLIGKPPFQAKEVNTIYER 283

Query: 328 ---SKYEFPVNN-YSSKLINLIIIMLAENPNLRPNIYQVMD 364
                + FP +   SS+   LI  +L+ +P  RP++ ++M+
Sbjct: 284 IKVCDFSFPKDKPISSEAKVLIKDILSLDPLERPSLAEIME 324

>YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine
           protein kinase with unknown role [2706 bp, 901 aa]
          Length = 901

 Score = 91.7 bits (226), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 83/289 (28%), Positives = 136/289 (47%), Gaps = 48/289 (16%)

Query: 79  VGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLN 138
           VGN++  I+K + EG F  +Y+             PT +       CLK    +D+N  N
Sbjct: 38  VGNYK--ILKQIGEGSFGKVYLAL---------HRPTHRK-----VCLK---TSDKNDPN 78

Query: 139 EMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLAT 198
            +R EV   +Q    P I + Y+   + ++       V + +E CP   L D++      
Sbjct: 79  IVR-EVFYHRQFD-FPYITKLYEVIVTESK-------VWMALEYCPGKELYDHLLS--LR 127

Query: 199 KLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPV 258
           ++S  E  ++   ++ A+   H +    +HRD+K+EN+L+D N N KL DFG T  C  +
Sbjct: 128 RISLLECGELFAQISGAVYYAHSMHC--VHRDLKLENILLDKNGNAKLTDFGFTREC--M 183

Query: 259 ANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF- 317
             T  E         V  T  Y +PE+I+  R      K DIW+LG+ LY L+    PF 
Sbjct: 184 TKTTLET--------VCGTTVYMAPELIE--RRTYDGFKIDIWSLGVILYTLITGYLPFD 233

Query: 318 ---ELTGQFAILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQVM 363
              E   ++ I++ + ++          +LI  +LA+NP  RP++ QV+
Sbjct: 234 DDDEAKTKWKIVNEEPKYDAKVIPDDARDLISRLLAKNPGERPSLSQVL 282

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score = 90.9 bits (224), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 87/293 (29%), Positives = 127/293 (43%), Gaps = 56/293 (19%)

Query: 79  VGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLN 138
           VGN+R  IVK + EG F  +Y                  L    L   K VL T      
Sbjct: 34  VGNYR--IVKQVGEGSFGKVY------------------LATHKLTHQKVVLKTGAKSDP 73

Query: 139 EMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLAT 198
            +  EV   +Q    P I + Y+   +  R       V + +E CP N L DY+   L  
Sbjct: 74  NVVREVFYHRQFE-YPFITKLYEVIVTETR-------VWMALEYCPGNELYDYL--LLKQ 123

Query: 199 KLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPV 258
           ++   E  ++   +  A+   H L    +HRD+K+EN+L+D N    L DFG T  C   
Sbjct: 124 RIPLDETRRLFAQIVSAVFYAHSLQC--VHRDLKLENILLDKNGYAMLTDFGFTREC--- 178

Query: 259 ANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 318
           A   Q   V    +Y+   P+    E  D Y       K D W+LGI LY +L    PF+
Sbjct: 179 ATKTQLETVCGTTVYM--APELIKREAYDGY-------KVDTWSLGIILYTMLHGYMPFD 229

Query: 319 -----LTGQFAILHSKYEFP--VNNYSS-KLINLIIIMLAENPNLRPNIYQVM 363
                 TG   I+H   E P  ++ Y+S +  +LI+ +L +N   RPN+ +V+
Sbjct: 230 EDDTVRTG-LKIMH---EEPAVLDEYTSPQAKDLIVRLLDKNAAQRPNLNEVL 278

>Sklu_2419.10 , Contig c2419 14439-16135
          Length = 566

 Score = 89.0 bits (219), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 70/221 (31%), Positives = 110/221 (49%), Gaps = 36/221 (16%)

Query: 154 PNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVT 213
           PNIVQ+ D              V +L+E+CPN SL+D + +R    L+E E+      + 
Sbjct: 4   PNIVQFIDCFEDDT-------NVYILLEICPNGSLMDLLKKRKV--LTEPEVRYFTTQIV 54

Query: 214 RALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNN-- 271
            A+  MH   V  IHRD+K+ N+  D+N+N K+ DFG               AVL N+  
Sbjct: 55  GAIKYMHNRRV--IHRDLKLGNIFFDSNYNLKIGDFGLA-------------AVLANDRE 99

Query: 272 --IYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSK 329
               V  TP Y +PE++         E  DIW++G+ +Y LL    PF+   +  I++ +
Sbjct: 100 RKYTVCGTPNYIAPEVLAGKHSGHSYE-VDIWSIGVMIYALLIGKPPFQ-AKEVNIIYER 157

Query: 330 -----YEFPVNNYSSK-LINLIIIMLAENPNLRPNIYQVMD 364
                Y FP    +SK ++ LI  +L+ +P  RP++ ++MD
Sbjct: 158 IKSGDYIFPREKPTSKEVMVLIQDILSIDPIERPSLDEIMD 198

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score = 87.0 bits (214), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 76/263 (28%), Positives = 113/263 (42%), Gaps = 46/263 (17%)

Query: 58  NSSRSGTLPV--LEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPT 115
             +R+G +P+  L+ LK            EI K L +G F  +Y VR IE          
Sbjct: 89  GKARAGGVPLSKLQNLKLAD--------FEIGKVLGKGKFGRVYCVRHIESGF------- 133

Query: 116 IKLEVGDLACLKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFE 175
               V  L  +++  +   N   + R EV +   L   PN+ Q Y       R       
Sbjct: 134 ----VCALKAMEKKDIIQYNIEKQFRREVEIQSSLRH-PNLTQLYGYFHDEKR------- 181

Query: 176 VTLLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIEN 235
           V LLME   N  L  ++  R  +  ++      ++ +  AL  MH   +  +HRD+K EN
Sbjct: 182 VYLLMEYLVNGELYKHLKGR--SHFNDVVASYYVYQMADALDYMHERNI--LHRDIKPEN 237

Query: 236 VLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPIN 295
           +++  N+  KL DFG  S   P  +  + +           T  Y SPE+I   R    N
Sbjct: 238 IIIGFNNTIKLTDFG-WSVITPKGSKRKTLC---------GTVDYLSPELI---RSREYN 284

Query: 296 EKSDIWALGIFLYKLLFYTTPFE 318
           EK D+WALG+  Y+LL  + PFE
Sbjct: 285 EKVDVWALGVLTYELLVGSPPFE 307

>Kwal_56.22476
          Length = 697

 Score = 87.8 bits (216), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/286 (25%), Positives = 136/286 (47%), Gaps = 49/286 (17%)

Query: 89  YLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNEMRNEVSVMK 148
           +L EGGFA  + ++  +   ++    T+           ++ +  E    ++ +E+ + K
Sbjct: 84  FLGEGGFARCFQIK--DDGGKIFAAKTVA----------KISIKSEKTRKKLLSEIQIHK 131

Query: 149 QLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQEILKI 208
            +    NIVQ+ D              V +L+E+CPN SL+D + +R    L+E E+   
Sbjct: 132 SMRHT-NIVQFVDCFEDDT-------NVYILLEICPNGSLMDLLKRR--KMLTEPEVRFF 181

Query: 209 MFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVL 268
              +  A+  MH   V  IHRD+K+ N+  D ++N K+ DFG               AVL
Sbjct: 182 TTQIVGAVKYMHSRRV--IHRDLKLGNIFFDKHYNLKVGDFGLA-------------AVL 226

Query: 269 TNN----IYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFA 324
            N+      V  TP Y +PE++   +    + + DIW+ G+ +Y LL    PF+   +  
Sbjct: 227 ANDRERKYTVCGTPNYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLIGKPPFQ-AKEVN 284

Query: 325 ILHSK-----YEFPVNNYSS-KLINLIIIMLAENPNLRPNIYQVMD 364
           I++ +     + FP + + S + + LI  +L+ +P  RP++ +++D
Sbjct: 285 IIYERIKCGDFVFPKDKFISPEALVLIKDILSIDPLERPSLDEIID 330

>Scas_700.28
          Length = 896

 Score = 88.2 bits (217), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 81/292 (27%), Positives = 134/292 (45%), Gaps = 54/292 (18%)

Query: 79  VGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVL-VTDENGL 137
           VGN++  I+  + EG F  +Y+          +  PT           K VL  +D+N  
Sbjct: 35  VGNYK--ILDQIGEGSFGKVYLA---------QHRPT---------HTKVVLKSSDKNDP 74

Query: 138 NEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYM--NQR 195
           N +R EV   +Q    P I + Y+   +  +       V + +E CP   L D +    R
Sbjct: 75  NIVR-EVFYHRQFD-YPYITKLYEVIITETK-------VWMALEYCPGKELYDRVLSMHR 125

Query: 196 LATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTC 255
           + T     E +++   +   +   H L    +HRD+K+EN+L+D + + KL DFG T  C
Sbjct: 126 VPT----DECVQLFAQIVGGVHYAHSLNC--VHRDLKLENILLDKSGDAKLTDFGFTREC 179

Query: 256 FPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTT 315
                T + I           T  Y +PE+I+  R      K DIW+LG+ LY ++  + 
Sbjct: 180 M-TKTTLETIC---------GTTVYMAPELIE--RKSYDGFKIDIWSLGVILYTMINGSM 227

Query: 316 PF----ELTGQFAILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQVM 363
           PF    E   ++ I+H   +   N  ++   +LI+ +LA+NPN RP + Q++
Sbjct: 228 PFDEDDETKTEWKIVHQTPQLNENIVTADAKDLILRLLAKNPNDRPTVEQIL 279

>Kwal_55.21545
          Length = 865

 Score = 86.3 bits (212), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 117/246 (47%), Gaps = 30/246 (12%)

Query: 125 CLKRVLVTD--ENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMEL 182
           C  +VL  D  ++ + +++ E+  +  L   PNI  YY S+ +  +       + ++ME 
Sbjct: 45  CAIKVLNLDSADDEVEDVQKEIQFLSSLKQVPNITHYYGSYLNDTK-------LWVIMEY 97

Query: 183 CPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANH 242
           C   SL   +      K+ EQ I  IM ++  AL  +H   V  IHRD+K  NVL+  + 
Sbjct: 98  CAGGSLRTLLR---PGKIGEQYIGVIMRELLTALMHIHKDGV--IHRDIKAANVLITNDG 152

Query: 243 NFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 302
           + KLCDFG  +         Q +A          TP + +PE+I     +  + K DIW+
Sbjct: 153 HIKLCDFGVAAQLSQTKIRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWS 201

Query: 303 LGIFLYKLLFYTTPF-ELTGQFAI-LHSKYEFP---VNNYSSKLINLIIIMLAENPNLRP 357
           LGI  Y++     P+ E+    A+ L +K + P      +SS L  +I + L E+P  RP
Sbjct: 202 LGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEGRQHSSALKEIIALCLDEDPKERP 261

Query: 358 NIYQVM 363
           +   ++
Sbjct: 262 SAEDLL 267

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 85/296 (28%), Positives = 130/296 (43%), Gaps = 62/296 (20%)

Query: 79  VGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLN 138
           VGN++++  K + EG F  +Y+             PT +         K VL T +    
Sbjct: 39  VGNYKIQ--KQIGEGSFGKVYLA---------THRPTKQ---------KVVLKTGDKSDP 78

Query: 139 EMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLAT 198
            +  EV   +Q    P I + Y+   +  +       V + +E CP   L D++  +  +
Sbjct: 79  NVVREVFYHRQFD-YPYITKLYEVIVTETK-------VWMALEYCPGKELYDHLLSK--S 128

Query: 199 KLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPV 258
           +L   E  ++   +T A+   H L    +HRD+K+ENVL+D N N KL DFG T      
Sbjct: 129 RLPTLECAELFAQITGAVHYAHTLNC--VHRDLKLENVLLDKNGNAKLTDFGFTRESMTK 186

Query: 259 ANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINE-KSDIWALGIFLYKLLFYTTPF 317
                  AVL     V  T  Y +PEMI   +  P +  K DIW+LG+ LY LL    PF
Sbjct: 187 -------AVLET---VCGTTVYMAPEMI---QHKPYDGFKVDIWSLGVILYTLLCGCLPF 233

Query: 318 E-----LTGQFAI-----LHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQVM 363
           +     LT Q  I     +  +   P      +  NLI  +L+++P  RPN   ++
Sbjct: 234 DEDDDLLTKQKIINDTPVIDERITIP------EAQNLIEQLLSKDPTERPNTSAIL 283

>ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH]
           (157357..160200) [2844 bp, 947 aa]
          Length = 947

 Score = 83.6 bits (205), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 78/280 (27%), Positives = 122/280 (43%), Gaps = 44/280 (15%)

Query: 83  RVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNEMRN 142
           R E++     G F  +Y      Y  + +QV  +K  V +L C        E+ + +++ 
Sbjct: 27  RTEVI---GRGKFGVVYKA----YHAKTKQVYAVK--VLNLDC-------PEDEVEDVQK 70

Query: 143 EVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSE 202
           E+  +  L   PNI +YY S+    +       + ++ME C   SL   +      K+ E
Sbjct: 71  EIQFLASLKQVPNITRYYGSYLYDTK-------LWVIMEYCAGGSLRTLLR---PGKIDE 120

Query: 203 QEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTH 262
           + +  I+  +  AL  +H   V  IHRD+K  NVL+    + KLCDFG  +      +  
Sbjct: 121 KYLGVIVRKLLIALVYIHKDNV--IHRDIKAANVLITNEGHVKLCDFGVAAQLTAANHKR 178

Query: 263 QEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF----E 318
           Q +A          TP + +PE+I     +  N K+DIW+LGI  Y++     P+     
Sbjct: 179 QTMA---------GTPYWMAPEVI--MEGVYYNTKADIWSLGITAYEIATGNPPYCDVEA 227

Query: 319 LTGQFAILHSK-YEFPVNNYSSKLINLIIIMLAENPNLRP 357
           L     I  SK       NYS  L   I + L E+P  RP
Sbjct: 228 LRAMQLITKSKPPRLEGRNYSPLLKEFIALCLDEDPEERP 267

>YPL236C (YPL236C) [5213] chr16 complement(101608..102702)
           Serine/threonine protein kinase of unknown function
           [1095 bp, 364 aa]
          Length = 364

 Score = 80.5 bits (197), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 84/338 (24%), Positives = 145/338 (42%), Gaps = 71/338 (21%)

Query: 79  VGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLV----TDE 134
           V + R  I + L EGG + +Y+V+  + +  ++      +   +L  LK+++     +  
Sbjct: 25  VNDKRYRIQRLLGEGGMSFVYLVQLSKNSLIIDN----GIATPELYALKKIICPSVESIS 80

Query: 135 NGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQ 194
           NG+ E+ N     K+    P +++  DS   + +DGS    + +++      SL D +N+
Sbjct: 81  NGMREIEN----YKRFQS-PYVIKSIDSQVMQEKDGSK--TIYIVLPYYSLGSLQDSINR 133

Query: 195 RL--ATKLSEQEILKIMFDVTRALAQMH-------------------------------- 220
           RL   T +SE E ++IM  VTR L  +H                                
Sbjct: 134 RLLEGTFVSEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLED 193

Query: 221 ------------YLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTC-FPVANTHQEIAV 267
                          +   HRD+   N+L  ++    + D GS S     + N HQ ++ 
Sbjct: 194 TPLEMDMLSSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQ-LSE 252

Query: 268 LTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQ----- 322
           L   +  + T  Y  PE+++L     ++ K DIW+LG   Y L+F  +PFE   Q     
Sbjct: 253 LQEWVNDNCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGAS 312

Query: 323 --FAILHSKYEFPVNN-YSSKLINLIIIMLAENPNLRP 357
             +AI   KY FP N+ +S  L+++I   +  +P  RP
Sbjct: 313 LTYAINTGKYSFPRNSRFSEGLLSVIKKCIQVDPIQRP 350

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 67/232 (28%), Positives = 105/232 (45%), Gaps = 28/232 (12%)

Query: 130 LVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLL 189
           L + E+ + +++ E+  +  L   PNI +YY S+         G  + ++ME C   SL 
Sbjct: 49  LDSSEDEVEDVQREIQFLASLKQIPNITRYYGSYLR-------GTSLWIIMEYCAGGSLR 101

Query: 190 DYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDF 249
             +      K+ E+ I  IM ++  AL  +H   V  IHRD+K  NVL+      KLCDF
Sbjct: 102 SLLR---PGKIDEKYIGVIMRELLVALKVIHKDNV--IHRDIKAANVLITNEGQVKLCDF 156

Query: 250 GSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYK 309
           G  +     +   Q +A          TP + +PE+I     +  + K DIW+LGI  Y+
Sbjct: 157 GVAAQLNQTSLRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYE 205

Query: 310 LLFYTTPF----ELTGQFAILHSK-YEFPVNNYSSKLINLIIIMLAENPNLR 356
           +     P+     L     I+ SK       NY+ +L   I + L E+P  R
Sbjct: 206 IATGNPPYCDVEALRAMQLIIKSKPPRLEERNYTPQLKEFIALCLDEDPQER 257

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 68/237 (28%), Positives = 105/237 (44%), Gaps = 30/237 (12%)

Query: 128 RVLVTD--ENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPN 185
           +VL  D  E+ + ++R E+  +  L   PNI  YY S+    +       + ++ME C  
Sbjct: 45  KVLNLDNTEDEVEDIRKEIQFLSSLKQTPNITHYYGSYLIDTK-------LWVIMEYCAG 97

Query: 186 NSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245
            SL   +   +   + E+ I  IM ++  AL  +H   V  IHRD+K  N+L+  N + K
Sbjct: 98  GSLRTLLRPGI---IEEKYIGVIMREILVALISIHRDNV--IHRDIKAANILIANNGSVK 152

Query: 246 LCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 305
           LCDFG  +         Q +A          TP + +PE+I     +  + K DIW+LGI
Sbjct: 153 LCDFGVAAQLSQSMLKRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGI 201

Query: 306 FLYKLLFYTTPF----ELTGQFAILHSK-YEFPVNNYSSKLINLIIIMLAENPNLRP 357
             Y++     P+     +     I  SK        YS  L   I + L E+P  RP
Sbjct: 202 TAYEIATGNPPYCHMEAIRAMQMITKSKPPRLEGREYSQPLKEFIALCLDEDPKERP 258

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 79/336 (23%), Positives = 153/336 (45%), Gaps = 59/336 (17%)

Query: 37  STNHLRMSKSETSSHHVVSGLNSSRSGTLPVLEQLKTGSQVIVGNHRVEIVKYLAEGGFA 96
           + +H +  K  T   ++  G++  R G++P+ +++           + +++K L EG F 
Sbjct: 4   ANHHHQQQKMYTGGRNMPHGMH--RPGSIPIGQRIG----------KYQVIKTLGEGSFG 51

Query: 97  HIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNEMRNEVSVMKQLSGCPNI 156
            + +   +    ++            L  + + ++   +    +  E+S ++ L   P+I
Sbjct: 52  KVKLAHHVSTGQKVA-----------LKIINKKVLAKSDMQGRIEREISYLRLLR-HPHI 99

Query: 157 VQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRAL 216
           ++ YD   S+        E+ +++E    N L DY+ QR   K+SE E  +    +  A+
Sbjct: 100 IKLYDVIKSKD-------EIIMVIEYA-GNELFDYIVQR--DKMSENEARRFFQQIISAV 149

Query: 217 AQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHT 276
              H   +  +HRD+K EN+L+D + N K+ DFG ++             ++T+  ++ T
Sbjct: 150 EYCHRHKI--VHRDLKPENLLLDEHLNVKIADFGLSN-------------IMTDGNFLKT 194

Query: 277 ---TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE---LTGQFA-ILHSK 329
              +P Y +PE+I     L    + D+W+ G+ LY +L    PF+   +   F  I +  
Sbjct: 195 SCGSPNYAAPEVIS--GKLYAGPEVDVWSSGVILYVMLCRRLPFDDESIPVLFKNISNGV 252

Query: 330 YEFPVNNYSSKLINLIIIMLAENPNLRPNIYQVMDN 365
           Y  P    S    NLI  ML  NP  R  I+++M++
Sbjct: 253 YSIP-KFLSQGAANLIKRMLIVNPLNRITIHEIMED 287

>Kwal_26.8751
          Length = 848

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 95/195 (48%), Gaps = 26/195 (13%)

Query: 176 VTLLMELCPNNSLLDYMNQRLATK-LSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIE 234
           V + +E CP   L +Y+   LA K +  +E  ++   +  A+   H +    +HRD+K+E
Sbjct: 103 VWMALEYCPGKELYEYL---LAKKHIPLEECSELFSQIVGAVYYAHSMKC--VHRDLKLE 157

Query: 235 NVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIY--VHTTPQYRSPEMIDLYRCL 292
           N+L+D   + KL DFG T  C             T  I   +  T  Y +PE+I+  R  
Sbjct: 158 NILLDKKGHAKLTDFGFTREC------------ATKGILETICGTTVYMAPELIE--RKP 203

Query: 293 PINEKSDIWALGIFLYKLLFYTTPF----ELTGQFAILHSKYEFPVNNYSSKLINLIIIM 348
               K D W+LGI LY ++  T PF    E+  ++ I+H    +  +   S    LI  +
Sbjct: 204 YEGYKIDTWSLGIILYTMIHGTMPFDEVDEVKTKYKIVHYNPTYDNDYIDSNGKELISQL 263

Query: 349 LAENPNLRPNIYQVM 363
           L ++PN RP++ QV+
Sbjct: 264 LEKDPNQRPSLTQVL 278

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score = 80.1 bits (196), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 80/300 (26%), Positives = 140/300 (46%), Gaps = 51/300 (17%)

Query: 71  LKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVL 130
           L  GS+V  GN+  +IVK L EG F  + +   +    ++            L  + + +
Sbjct: 30  LADGSRV--GNY--QIVKTLGEGSFGKVKLAYHVTTGQKVA-----------LKIINKKV 74

Query: 131 VTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLD 190
           +   +    +  E+S ++ L   P+I++ YD   S+        E+ +++E    N L D
Sbjct: 75  LAKSDMQGRIEREISYLRLLRH-PHIIKLYDVIKSKD-------EIIMVIEYA-GNELFD 125

Query: 191 YMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFG 250
           Y+ QR   K+SEQE  +    +  A+   H   +  +HRD+K EN+L+D + N K+ DFG
Sbjct: 126 YIVQR--NKMSEQEARRFFQQIISAVEYCHRHKI--VHRDLKPENLLLDEHLNVKIADFG 181

Query: 251 STSTCFPVANTHQEIAVLTNNIYVHT---TPQYRSPEMIDLYRCLPINEKSDIWALGIFL 307
            ++             ++T+  ++ T   +P Y +PE+I     L    + D+W+ G+ L
Sbjct: 182 LSN-------------IMTDGNFLKTSCGSPNYAAPEVIS--GKLYAGPEVDVWSCGVIL 226

Query: 308 YKLLFYTTPFE---LTGQFA-ILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQVM 363
           Y +L    PF+   +   F  I +  Y  P    S    +LI  ML  NP  R +I+++M
Sbjct: 227 YVMLCRRLPFDDESIPVLFKNISNGVYTLP-KFLSPGASDLIKRMLIVNPLNRISIHEIM 285

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score = 80.1 bits (196), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 94/375 (25%), Positives = 161/375 (42%), Gaps = 68/375 (18%)

Query: 14  RSNQPKRPLLKENAQHTPVLVVRSTNHL-RMSK-SETSSHHVVSGLNSSRSGTLPVLEQL 71
           R  +P R    E  +H   +V   ++   R+S+ S +S+ H  +G   +R    P     
Sbjct: 6   RDERPDREGGSERDEHLNRVVQSVSDATKRLSQISNSSTAHTKTGKRKNRDTVGP----W 61

Query: 72  KTGSQVIVGNH-RVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVL 130
           K G  +  G+  RV + K +  G  A I +V      +  +QV  +   +          
Sbjct: 62  KLGKTLGKGSSGRVRLAKNMQSGKLAAIKIVPKRNVRHNQKQVTALPYGI---------- 111

Query: 131 VTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLD 190
                       E+ +MK ++  PNI+  Y+   +++       E+ L++E      L D
Sbjct: 112 ----------EREIIIMKLITH-PNIMALYEVWENKS-------ELYLVLEYVEGGELFD 153

Query: 191 YMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDA-NHNFKLCDF 249
           Y+  R   KL EQE +     + + ++  H   +   HRD+K EN+L+D  N   K+ DF
Sbjct: 154 YLIAR--GKLPEQEAIHYFKQIVQGVSYCHNFNI--CHRDLKPENLLLDKKNKTVKIADF 209

Query: 250 GSTSTCFPVANTHQEIAVLTNNIYVHTT---PQYRSPEMI--DLYRCLPINEKSDIWALG 304
           G               A+ T N  + T+   P Y SPE++    Y   P    SD+W+ G
Sbjct: 210 GMA-------------ALETTNRLLETSCGSPHYASPEIVMGQKYHGSP----SDVWSCG 252

Query: 305 IFLYKLLFYTTPFELTGQFAIL----HSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIY 360
           I L+ LL    PF       +L    H +Y+ P +N S +  +LI  +L  +P  R  + 
Sbjct: 253 IILFALLTGHLPFNDDNVRKLLLKVQHGRYQMP-SNVSKEAKDLISKILVVDPEKRITVD 311

Query: 361 QVMDNLCSILKVKNP 375
           +++++   ++K  NP
Sbjct: 312 KILEHPL-LVKYDNP 325

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score = 79.3 bits (194), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 83/293 (28%), Positives = 140/293 (47%), Gaps = 51/293 (17%)

Query: 79  VGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLV-TDENGL 137
           +GN+  +IVK L EG F  + +     Y     Q   +K+        K+VL  +D  G 
Sbjct: 52  IGNY--QIVKTLGEGSFGKVKLA----YHTTTGQKVALKI------INKKVLAKSDMQG- 98

Query: 138 NEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLA 197
             +  E+S ++ L   P+I++ YD    +++D     E+ +++E    N L DY+ QR  
Sbjct: 99  -RIEREISYLRLLRH-PHIIKLYD--VIKSKD-----EIIMVIEYA-GNELFDYIVQR-- 146

Query: 198 TKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFP 257
            K+SEQE  +    +  A+   H   +  +HRD+K EN+L+D + N K+ DFG ++    
Sbjct: 147 DKMSEQEARRFFQQIISAVEYCHRHKI--VHRDLKPENLLLDEHLNVKIADFGLSN---- 200

Query: 258 VANTHQEIAVLTNNIYVHT---TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYT 314
                    ++T+  ++ T   +P Y +PE+I     L    + D+W+ G+ LY +L   
Sbjct: 201 ---------IMTDGNFLKTSCGSPNYAAPEVIS--GKLYAGPEVDVWSCGVILYVMLCRR 249

Query: 315 TPFE---LTGQFA-ILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQVM 363
            PF+   +   F  I +  Y  P    S     LI  ML  NP  R +I+++M
Sbjct: 250 LPFDDESIPVLFKNISNGVYTLP-KFLSPGAAGLIKRMLIVNPLNRISIHEIM 301

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/245 (28%), Positives = 114/245 (46%), Gaps = 29/245 (11%)

Query: 118 LEVGDLACLKRV-LVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEV 176
           ++ G +  +K + L +D + + +++ E+  +  L    NI +YY S+    +D S    +
Sbjct: 43  VKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQISNITRYYGSYL---KDTS----L 95

Query: 177 TLLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENV 236
            ++ME C   SL   +      K+ E+ I  IM ++  AL  +H   V  IHRD+K  NV
Sbjct: 96  WIIMEHCAGGSLRSLLR---PGKIDEKYIGVIMRELLVALKCIHKDNV--IHRDIKAANV 150

Query: 237 LVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINE 296
           L+    N KLCDFG  +     +   Q +A          TP + +PE+I     +  + 
Sbjct: 151 LITNEGNVKLCDFGVAAQVNQTSLRRQTMA---------GTPYWMAPEVI--MEGVYYDT 199

Query: 297 KSDIWALGIFLYKLLFYTTPF----ELTGQFAILHSK-YEFPVNNYSSKLINLIIIMLAE 351
           K DIW+LGI  Y++     P+     L     I+ SK       +YS+ L   I + L E
Sbjct: 200 KVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEDRSYSTSLKEFIALCLDE 259

Query: 352 NPNLR 356
           +P  R
Sbjct: 260 DPKER 264

>Scas_580.6
          Length = 1015

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/232 (30%), Positives = 111/232 (47%), Gaps = 28/232 (12%)

Query: 130 LVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLL 189
           L +DE+ + +++ EV  +  L   PNI +YY S+    +D S    + ++ME C   SL 
Sbjct: 70  LDSDEDEVEDVQREVQFLSSLKQIPNITRYYGSYL---KDTS----LWIIMEYCAGGSLR 122

Query: 190 DYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDF 249
             +      K+ E+ I  IM ++  AL  +H   V  IHRD+K  NVL+    + KLCDF
Sbjct: 123 SLLR---PGKIDEKYIGVIMRELLVALKYIHKDNV--IHRDIKAANVLITNEGSVKLCDF 177

Query: 250 GSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYK 309
           G  +         Q +A          TP + +PE+I     +  + K DIW+LGI  Y+
Sbjct: 178 GVAAQLNQSTLRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYE 226

Query: 310 LLFYTTPF-ELTGQFAI-LHSKYEFP---VNNYSSKLINLIIIMLAENPNLR 356
           +     P+ E+    A+ L +K + P     +Y+  L   I + L E+P  R
Sbjct: 227 IATGNPPYCEVEALRAMQLITKSKPPRLESRSYTPLLKEFIALCLDEDPKER 278

>Scas_598.6
          Length = 790

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 113/239 (47%), Gaps = 31/239 (12%)

Query: 85  EIVKYLAEGGFAHIYVVRFIEYA-NELEQVPTIKLEVGDLACLKRVLVTDENGLNEMRNE 143
           ++++   +G    +Y+   I     E ++ P    EVGD   +K+++++ +     + NE
Sbjct: 503 QMIEKAGQGASGSVYLAERIAIPPGEFDETP----EVGDKVAIKQMILSKQPRKELIVNE 558

Query: 144 VSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATK---- 199
           + VMK  S   NIV + +++     D      + ++ME     SL D +    AT     
Sbjct: 559 ILVMKD-SRHKNIVNFLEAYLKTEDD------LWVVMEFMEGGSLTDIIENSPATGSSSS 611

Query: 200 -LSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPV 258
            L+E +I  I+ +  + L  +H   +  IHRD+K +NVL+D N   K+ DFG    C  +
Sbjct: 612 PLTEPQIAYIVRETCQGLKFLHDKHI--IHRDIKSDNVLLDNNARVKITDFG---FCAKL 666

Query: 259 ANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 317
            +   + A +        TP + +PE++        +EK D+W+LGI   ++L    P+
Sbjct: 667 TDQRSKRATMVG------TPYWMAPEVVKQRE---YDEKVDVWSLGIMTIEMLESEPPY 716

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/293 (25%), Positives = 136/293 (46%), Gaps = 49/293 (16%)

Query: 80  GNH--RVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGL 137
           G H  + +I+K L EG F  + +   I    ++            L  + + ++   +  
Sbjct: 29  GQHIGKYQIIKTLGEGSFGKVKLAYHISTGQKVA-----------LKIINKKVLAKSDMQ 77

Query: 138 NEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLA 197
             +  E+S ++ L   P+I++ YD    +++D     E+ +++E    N L DY+ QR  
Sbjct: 78  GRIEREISYLRLLR-HPHIIKLYD--VIKSKD-----EIIMVIEYA-GNELFDYIVQR-- 126

Query: 198 TKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFP 257
            K+ EQE  +    +  A+   H   +  +HRD+K EN+L+D + N K+ DFG ++    
Sbjct: 127 DKMPEQEARRFFQQIISAVDYCHRHKI--VHRDLKPENLLLDEHLNVKIADFGLSN---- 180

Query: 258 VANTHQEIAVLTNNIYVHT---TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYT 314
                    ++T+  ++ T   +P Y +PE+I     L    + D+W+ G+ LY +L   
Sbjct: 181 ---------IMTDGNFLKTSCGSPNYAAPEVIS--GKLYAGPEVDVWSSGVILYVMLCRR 229

Query: 315 TPFE---LTGQFA-ILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQVM 363
            PF+   +   F  I +  Y  P N  S    +LI  ML  NP  R  ++++M
Sbjct: 230 LPFDDESIPVLFKNISNGVYTIP-NFLSQGAASLIKKMLIVNPVNRITVHEIM 281

>Scas_660.28
          Length = 623

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 65/251 (25%), Positives = 117/251 (46%), Gaps = 46/251 (18%)

Query: 71  LKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVL 130
           L  GS +  GN+  +IVK L EG F  + +   +    ++            L  + + +
Sbjct: 37  LSDGSHI--GNY--QIVKTLGEGSFGKVKLAYHMTTGQKVA-----------LKIINKKV 81

Query: 131 VTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLD 190
           +   +    +  E+S ++ L   P+I++ YD   S+        E+ ++ME    N L D
Sbjct: 82  LAKSDMQGRIEREISYLRLLR-HPHIIKLYDVIKSKD-------EIIMVMEYA-GNELFD 132

Query: 191 YMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFG 250
           Y+ QR   K+SE E  +    +  A+   H   +  +HRD+K EN+L+D + N K+ DFG
Sbjct: 133 YIVQR--DKMSEDEARRFFQQIISAVEYCHRHKI--VHRDLKPENLLLDEHLNVKIADFG 188

Query: 251 STSTCFPVANTHQEIAVLTNNIYVHT---TPQYRSPEMIDLYRCLPINEKSDIWALGIFL 307
            ++             ++T+  ++ T   +P Y +PE+I     L    + D+W+ G+ L
Sbjct: 189 LSN-------------IMTDGNFLKTSCGSPNYAAPEVIS--GKLYAGPEVDVWSCGVIL 233

Query: 308 YKLLFYTTPFE 318
           Y +L    PF+
Sbjct: 234 YVMLCRRLPFD 244

>Kwal_47.18233
          Length = 598

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/288 (25%), Positives = 133/288 (46%), Gaps = 47/288 (16%)

Query: 83  RVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNEMRN 142
           + +I+K L EG F  + +   +    ++            L  + + ++   +    +  
Sbjct: 30  KYQIIKTLGEGSFGKVKLAYHVTTGQKVA-----------LKIINKKVLAKSDMQGRIER 78

Query: 143 EVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSE 202
           E+S ++ L   P+I++ YD    +++D     E+ +++E    N L DY+ QR   K+SE
Sbjct: 79  EISYLRLLR-HPHIIKLYD--VVKSKD-----EIVMVIEYA-GNELFDYIVQR--DKMSE 127

Query: 203 QEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTH 262
            E  +    +  A+   H   +  +HRD+K EN+L+D + N K+ DFG ++         
Sbjct: 128 NEARRFFQQIISAVEYCHRHKI--VHRDLKPENLLLDEHLNVKIADFGLSN--------- 176

Query: 263 QEIAVLTNNIYVHT---TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE- 318
               ++T+  ++ T   +P Y +PE+I     L    + D+W+ G+ LY +L    PF+ 
Sbjct: 177 ----IMTDGNFLRTSCGSPNYAAPEVIS--GKLYAGPEVDVWSSGVILYVMLCRRLPFDD 230

Query: 319 --LTGQFA-ILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQVM 363
             +   F  I +  Y  P    S    NLI  ML  NP  R  I+++M
Sbjct: 231 ESIPVLFKNISNGIYTLP-KFLSPGAANLIKRMLIVNPLNRITIHEIM 277

>Scas_707.36
          Length = 915

 Score = 77.0 bits (188), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 81/291 (27%), Positives = 131/291 (45%), Gaps = 55/291 (18%)

Query: 75  SQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKL--EVGDLACLKRVLVT 132
           S+  + NH  EIVK L  G    + + + I  AN+L  +  +    +    A  KR    
Sbjct: 85  SKTQILNH-YEIVKELGNGQHGKVKLAKDIR-ANQLVAIKMVNRYEKKTYFAGPKR---- 138

Query: 133 DENGLNEMRNEVSVMKQLSGCPN-----IVQYYDSHASRARDGSSGFEVTLLMELCPNNS 187
             N  N+++ E+++MK+   C N     +++  D  +SR        ++ L++E C    
Sbjct: 139 --NDPNKIKKEIAIMKK---CNNKHVVKLIEILDDLSSR--------KIYLVLEYCEKGP 185

Query: 188 LLDY------MNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDAN 241
           +L        ++ R   +LS Q   +I  DV   L  +H   +  IHRD+K  N+L+D N
Sbjct: 186 ILWCPRDQLEIDSRGPPQLSFQRAREIFRDVILGLEYLHSQGI--IHRDIKPANLLMDKN 243

Query: 242 HNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMI--------------D 287
              K+ DFG +       +T+ +   LT  +    TP + +PE+               +
Sbjct: 244 GVVKISDFGVSLAANGNIDTNDDELELTKTV---GTPVFYAPEICLGAAAMERFNLDKDE 300

Query: 288 LYRCLPINEKSDIWALGIFLYKLLF----YTTPFELTGQFAILHSKYEFPV 334
           L+    I+ K DIWALGI LY LLF    + + FEL     I++ K  FP 
Sbjct: 301 LFNGSCISFKIDIWALGITLYCLLFGMLPFVSEFELKLFEKIVNEKLRFPT 351

>Kwal_33.13112
          Length = 505

 Score = 75.9 bits (185), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 65/251 (25%), Positives = 112/251 (44%), Gaps = 33/251 (13%)

Query: 115 TIKLEVGDLACLKRV-LVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSG 173
            I  E G++  +K + L   ++ ++ +  E+  + +L   P +  YY ++          
Sbjct: 53  AIDKETGEMVAVKIINLEETQDDIDVLAQEIYFLSELR-APFVTTYYKTYVEDV------ 105

Query: 174 FEVTLLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKI 233
             + ++ME C   S  D +      +L E ++  I+ +V   L  +H      IHRDVK 
Sbjct: 106 -SMWIVMEFCGGGSCADLLKHLPEHRLPENKVAYIIREVLYGLEYLH--SQRKIHRDVKA 162

Query: 234 ENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLP 293
            N+L+      KL DFG +          Q +A L  N +V  TP + +PE+I   R   
Sbjct: 163 ANILLTDEGEVKLGDFGVSG---------QIMATLKRNTFV-GTPYWMAPEIIA--RDNG 210

Query: 294 INEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEFPV-------NNYSSKLINLII 346
            +EK+DIW+LGI   +LL    P+       +L +    P+         ++S   + I 
Sbjct: 211 YDEKADIWSLGITAMELLTGQPPYAKYDPMKVLMN---IPLRKPPRLQGRFTSSARDFIA 267

Query: 347 IMLAENPNLRP 357
           + L ++P LRP
Sbjct: 268 LCLTKDPALRP 278

>Kwal_26.7788
          Length = 1267

 Score = 76.6 bits (187), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 72/260 (27%), Positives = 117/260 (45%), Gaps = 44/260 (16%)

Query: 118 LEVGDLACLKRVLVTDENGLNEM----RNEVSVMKQLSGCPNIVQYYDSHASRARDGSSG 173
           +E G LA +K V  T  +    +      E+ +MK +S  PN++  Y+   ++       
Sbjct: 78  METGKLAAIKIVPKTKSSRTGSLPYGIEREIIIMKLISH-PNVMGLYEVWENK------- 129

Query: 174 FEVTLLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKI 233
            E+ L++E      L DY+  R   +L E+E +     +    A  H   +   HRD+K 
Sbjct: 130 LELFLVLEYVDGGELFDYLVSR--GRLPEKEAIHYFRQIIEGTAYCHGFNI--CHRDLKP 185

Query: 234 ENVLVDA-NHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTT---PQYRSPEMI--D 287
           EN+L+D  N   K+ DFG               A+ T+N  + T+   P Y SPE++   
Sbjct: 186 ENLLLDKKNKRIKIADFGMA-------------ALQTSNKLLETSCGSPHYASPEIVMGK 232

Query: 288 LYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAIL----HSKYEFPVNNYSSKLIN 343
            Y   P    SD+W+ GI L+ LL    PF       +L      KY+ P  + SS   +
Sbjct: 233 NYNGGP----SDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMP-QSVSSGAQD 287

Query: 344 LIIIMLAENPNLRPNIYQVM 363
           LI  +L  +P+ R +I +++
Sbjct: 288 LISRILVVDPDKRISINEIL 307

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 65/252 (25%), Positives = 115/252 (45%), Gaps = 40/252 (15%)

Query: 89   YLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNEM----RNEV 144
            ++  G F  +Y                I LE G++  +K + + D   + ++    + E+
Sbjct: 1039 FIGGGTFGQVY--------------SAINLENGEILAVKEIKIHDTTTMKKIFPLIKEEM 1084

Query: 145  SVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQE 204
            +V++ L+  PNIVQYY     R +       V + ME C   SL   ++     ++ ++ 
Sbjct: 1085 TVLEMLNH-PNIVQYYGVEVHRDK-------VNIFMEYCEGGSLASLLDH---GRIEDEM 1133

Query: 205  ILKI-MFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCF-----PV 258
            + ++  F++   LA +H   V  +HRD+K EN+L+D N   K  DFG+  T        V
Sbjct: 1134 VTQVYTFELLEGLAYLHQSGV--VHRDIKPENILLDFNGIIKYVDFGTARTVVGSRTRTV 1191

Query: 259  ANTH-QEIAVLTNNI-YVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 316
             N   Q+  V T ++  +  TP Y +PE I            D+WALG  + ++     P
Sbjct: 1192 RNAAVQDFGVETKSLNEMMGTPMYMAPETISGSAVKGKLGADDVWALGCVVLEMATGRRP 1251

Query: 317  FE-LTGQFAILH 327
            +  L  ++AI++
Sbjct: 1252 WSNLDNEWAIMY 1263

>Scas_458.1
          Length = 367

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 86/352 (24%), Positives = 146/352 (41%), Gaps = 70/352 (19%)

Query: 73  TGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLV- 131
           T S + +     +I K L +   ++ Y+VR       L+  P    E G L  LKR+   
Sbjct: 19  TNSIISINARDYKIEKLLQDENLSYSYLVR------TLDSEP--PFENGPLFVLKRIYCP 70

Query: 132 -TDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLD 190
             D   ++   NE+S  K+ +G  +I+   D    +  DGS   ++ +L       S+ D
Sbjct: 71  FGDIESVSAAMNEISYYKKFAGNSHIISCLDYQLHQKYDGSK--QIDVLFPFYHYGSVQD 128

Query: 191 YMNQRL-------ATKLSEQEILKIMFDVTRALAQMHYLPV------------------P 225
            +N+ L        T + E++ +KIM  + R L  +H   +                  P
Sbjct: 129 DINRHLLSSSTALGTVIPEKDCIKIMIGLCRGLLPLHDPKLREQGSPDDMAIMSYSENAP 188

Query: 226 LIHRDVKIENVLVDANHNFKLC-------------------DFGSTSTCF---PVANTHQ 263
           L+  D+ +E  L   N N  +C                         +CF      +T  
Sbjct: 189 LLLNDLPME--LSKDNENENVCFAYYNLRPDLILLSEQGNAIIADLQSCFRTNITISTEI 246

Query: 264 EIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE----L 319
           ++      I  H T Q+ +PE++ L     I  K DIW+LG  LY ++F  +PFE    L
Sbjct: 247 QLNRFQQWIEEHCTLQFSAPELLTLKMGDKITAKVDIWSLGCVLYSMMFGISPFEREEQL 306

Query: 320 TG---QFAILHSKYEFP--VNNYSSKLINLIIIMLAENPNLRPNIYQVMDNL 366
            G   ++ I   KY  P     YS ++I+++   L  +P+ RP++  +++NL
Sbjct: 307 NGGVVKYCIKMGKYSIPDTKGTYSQEIIDILNTCLKVDPSERPSLNGILNNL 358

>Kwal_23.6325
          Length = 1542

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 65/264 (24%), Positives = 119/264 (45%), Gaps = 29/264 (10%)

Query: 115  TIKLEVGDLACLKRVLVTDENGLNE----MRNEVSVMKQLSGCPNIVQYYDSHASRARDG 170
             + L+ G++  +K + + D   + +    ++ E+SV++ L+  PN+VQYY     R +  
Sbjct: 1266 AVNLDTGEILAVKEIKIQDRKSMKQVFPAIKEEMSVLEMLNH-PNVVQYYGVEVHRDK-- 1322

Query: 171  SSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQEILKI-MFDVTRALAQMHYLPVPLIHR 229
                 V L ME C   SL   +      ++ ++ + +I    +   LA +H   V  +HR
Sbjct: 1323 -----VNLFMEYCEGGSLAQLLEH---GRIEDEMVTQIYALQMLEGLAYLHQSSV--VHR 1372

Query: 230  DVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHT---TPQYRSPEMI 286
            D+K EN+L+D N   K  DFG+  +          +        V++   TP Y SPE I
Sbjct: 1373 DIKPENILLDFNGVIKYVDFGAARSLAANGTKAPNVGAEGKADGVNSMMGTPMYMSPESI 1432

Query: 287  DLYRCLPINEKSDIWALGIFLYKLLFYTTP-FELTGQFAILHSKYEFPV------NNYSS 339
               +        DIW+LG  + +++    P F L  ++AI++      V         S 
Sbjct: 1433 TGAKKGKFG-SGDIWSLGCVILEMVTGRRPWFNLDNEWAIMYHVAAGHVPQLPTKEELSP 1491

Query: 340  KLINLIIIMLAENPNLRPNIYQVM 363
            + I+ ++  L ++PN R    +++
Sbjct: 1492 QGIDFLLRCLKQDPNKRSTAMELL 1515

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 122/288 (42%), Gaps = 42/288 (14%)

Query: 89   YLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNE----MRNEV 144
            ++  G F  +Y                + L+ GD+  +K +   D   + +    +R+E+
Sbjct: 1196 FIGGGSFGSVY--------------SAVNLDTGDILAVKEIKFNDRKTIKQVFPSIRDEM 1241

Query: 145  SVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQE 204
            +V++ L+  PN+VQYY     R R       V + ME C   SL       LA    E E
Sbjct: 1242 TVLEMLNH-PNVVQYYGVEVHRDR-------VNIFMEYCEGGSLASL----LAHGRIEDE 1289

Query: 205  ILKIMFDV--TRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTH 262
            ++  ++ +     LA +H   V   HRD+K EN+L+D N   K  DFG+        +  
Sbjct: 1290 MVTQVYSLQMLEGLAYLHESGVD--HRDIKPENILLDFNGIIKYVDFGAAKVLASNGSKK 1347

Query: 263  QEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF-ELTG 321
              +        +  TP Y SPE I            DIW+LG  + +++    P+  L  
Sbjct: 1348 LNLEQHMEGEKMIGTPMYMSPEAISGTGYGKFG-SDDIWSLGCVILEMVTGRRPWANLDN 1406

Query: 322  QFAILH--SKYEFPV----NNYSSKLINLIIIMLAENPNLRPNIYQVM 363
            Q+AI++  +  + P+    N  S   I  +   L ++PN R    +++
Sbjct: 1407 QWAIIYQVAAGQIPMFPSKNEMSQAGIKFLSRCLIQDPNQRSTAVELL 1454

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/217 (27%), Positives = 101/217 (46%), Gaps = 22/217 (10%)

Query: 151 SGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQEILKIMF 210
           S  P +++ Y +    A        +  L+E  PN   L  M +R  T LSE+       
Sbjct: 258 SRVPGVIKLYFTFQDEA-------NLYFLLEYAPNGDFLSVM-KRFGT-LSEECTKYYGA 308

Query: 211 DVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTN 270
            +  A+  +H   +  IHRDVK EN+L+D     KL DFG T+      + ++   + T 
Sbjct: 309 QILDAIHHLHKQGI--IHRDVKPENILLDKTMKIKLTDFG-TAKLIGREDENKPYDLNTR 365

Query: 271 NIYVHTTPQYRSPEMI-DLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQF----AI 325
           +     T +Y SPE++ D Y    ++ + DIWA G  L++++    PF+ T ++     +
Sbjct: 366 SKSFVGTAEYVSPELLNDNY----VDSRCDIWAFGCILFQMVAGKPPFKATNEYLTFQKV 421

Query: 326 LHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQV 362
           +  +Y F    +   L +LI  +L + P  R  I Q+
Sbjct: 422 MRVQYAFTA-GFPMILRDLIKQLLVKKPEQRLTILQI 457

>YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine
           protein kinase with similarity to mammalian
           3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk2p, required for
           endocytosis [3246 bp, 1081 aa]
          Length = 1081

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 108/230 (46%), Gaps = 29/230 (12%)

Query: 143 EVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSE 202
           E + +++L+  P++V+ +    S  +D SS +    L+E  PN   L  M +  +  L E
Sbjct: 227 EKTALQKLNNSPSVVRLF----STFQDESSLY---FLLEYAPNGDFLSLMKKYGS--LDE 277

Query: 203 QEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVAN-- 260
                    +  A+  +H     +IHRD+K EN+L+D     KL DFG+     P  N  
Sbjct: 278 TCARYYAAQIIDAIDYLH--SNGIIHRDIKPENILLDGEMKIKLTDFGTAKLLNPTNNSV 335

Query: 261 THQEIAVLTNNIYVHTTPQYRSPEMID----LYRCLPINEKSDIWALGIFLYKLLFYTTP 316
           +  E  + T +     T +Y SPE+++     YRC       DIWA G  L++++    P
Sbjct: 336 SKPEYDLSTRSKSFVGTAEYVSPELLNDSFTDYRC-------DIWAFGCILFQMIAGKPP 388

Query: 317 FELTGQF----AILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQV 362
           F+ T ++     ++  +Y F    +   + +L+  +L +N + R  I Q+
Sbjct: 389 FKATNEYLTFQKVMKVQYAF-TPGFPLIIRDLVKKILVKNLDRRLTISQI 437

>Sklu_1962.2 YPL236C, Contig c1962 744-1838 reverse complement
          Length = 364

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 77/147 (52%), Gaps = 8/147 (5%)

Query: 228 HRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMID 287
           H+D+K  N++  ++    +CD GS S      ++  ++         H T  +RSPE+++
Sbjct: 212 HKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRSQLVEFQEWCNEHCTLPFRSPELLN 271

Query: 288 LYRCLPINEKSDIWALGIFLYKLLFYTTPFE----LTGQ---FAILHSKYEFPVN-NYSS 339
           +     I+EK DIW+LG  LY + F  +PFE    L+G    +AI   K+  P N NYS 
Sbjct: 272 VTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQLSGASMTYAIATGKFSIPPNTNYSP 331

Query: 340 KLINLIIIMLAENPNLRPNIYQVMDNL 366
           +LI +I   +  +   RP+I +++  L
Sbjct: 332 ELIKIIKDCIEVDSKKRPSIDELLARL 358

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 76/166 (45%), Gaps = 20/166 (12%)

Query: 57  LNSSRSGTLPVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTI 116
           ++S   G  P   +    S V++      I + L EGGF+ +Y+V+  E  N+L  +  I
Sbjct: 4   ISSVLCGCFPCCGR---NSSVLINGQHYAIQRLLGEGGFSFVYLVQSRE-NNDLFALKKI 59

Query: 117 KLEVGDLACLKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEV 176
               G++             ++E   EV+  K+    P I     S   + +DGS    V
Sbjct: 60  HCPFGNI-----------ESVSEAMREVNSYKKFRS-PYITHCVSSQVLQEQDGSK--TV 105

Query: 177 TLLMELCPNNSLLDYMNQRL--ATKLSEQEILKIMFDVTRALAQMH 220
            +L+   P  SLLD +N  L   T +SE+EI++I+  V R L  MH
Sbjct: 106 FILLPYFPTGSLLDKINTHLLDGTTISEEEIVRILVSVARGLRTMH 151

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 96/351 (27%), Positives = 143/351 (40%), Gaps = 62/351 (17%)

Query: 26  NAQHTPVLVVRSTNHLRMSKSETSSHHVVSGL---NSSRSGTLPVLEQLKTGSQV-IVGN 81
           NA   P L   S  H     S TSSHH +S     N+ R   +        G++V I+ +
Sbjct: 31  NAGKRPSL---SRGHAHEKDSITSSHHRLSTGPVNNNPRRSLMVKKPNTAHGTRVPILND 87

Query: 82  HR----------VEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLV 131
           H            EI K L +G F  +Y V+  E              +  L  +++  +
Sbjct: 88  HNDKFENMTLQDFEIGKILGKGKFGKVYCVKHRETG-----------LICALKAMEKKEI 136

Query: 132 TDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDY 191
                  + R EV +        N+ Q Y       R       V LLME      L  +
Sbjct: 137 VQYTIQKQFRREVEIQGSFKH-KNLTQLYGFFYDEKR-------VYLLMEYVYYGELYKF 188

Query: 192 MNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGS 251
           +       L+E      ++ +  AL  MH     ++HRD+K EN+L+  N+  KL DFG 
Sbjct: 189 LKNN--GPLNETLASYFVYQMANALDYMH--SKNILHRDIKPENILIGFNNTIKLTDFG- 243

Query: 252 TSTCFPVANTH-QEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 310
               + V N   Q+   L   I       Y SPE+I   +    N K D+WALG+  Y+L
Sbjct: 244 ----WSVYNEDGQKRKTLCGTI------DYLSPELI---KSREYNNKVDVWALGVLTYEL 290

Query: 311 LFYTTPF-----ELTGQFAILHSKYEFPVNNYSSKLINLIIIMLAENPNLR 356
           L  + PF     E+T +  IL    +FP+ N S +  +LI+ +L   P+ R
Sbjct: 291 LVGSPPFEEDTKEMTYR-RILRCDLKFPL-NVSPQARDLIVRLLQFEPSKR 339

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 110/250 (44%), Gaps = 41/250 (16%)

Query: 89   YLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNE----MRNEV 144
            ++  G F  +Y                + L+ GD+  +K + + D   + +    ++ E+
Sbjct: 1264 FIGSGSFGTVY--------------SAVNLDTGDILAVKEIKIQDAKSMKQIFPSLKEEM 1309

Query: 145  SVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQE 204
             VM+ L+  PNIVQYY     R +       V + ME C  +SL   +      ++ ++ 
Sbjct: 1310 RVMEILNH-PNIVQYYGVEVHRDK-------VNIFMEFCEGSSLASLLEH---GRIEDEM 1358

Query: 205  ILKI-MFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQ 263
            + ++    +   LA +H   V  +HRD+K EN+L+D N   K  DFG+        N  +
Sbjct: 1359 VTQVYTLQLLEGLACLHQSGV--VHRDIKPENILLDRNGVIKYVDFGAAK--LIAKNGSK 1414

Query: 264  EIAVLTNNIYVH-----TTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF- 317
             I++  NN          TP Y +PE +            DIW+LG  + +++    P+ 
Sbjct: 1415 RISLDANNKSTGGKDMIGTPMYMAPETVTGQGHGKFG-SDDIWSLGCVVLEMVTGRRPWA 1473

Query: 318  ELTGQFAILH 327
             L  ++AI++
Sbjct: 1474 NLDNEWAIMY 1483

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score = 73.9 bits (180), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 90/367 (24%), Positives = 159/367 (43%), Gaps = 80/367 (21%)

Query: 23  LKENAQHTPVLVVRSTNHL------------RMSKSETSSHHV-VSGLNSSRSGTLPVLE 69
           +K+N+ H  V    +  HL            R+S+  T+S +  V+   +S+      + 
Sbjct: 12  MKDNSSHGQVPYRANNEHLNRVVQSVTDATKRLSQISTASSNANVNNTKTSKRRNRDTVG 71

Query: 70  QLKTGSQVIVGNH-RVEIVKYLAEGGFAHIYVV--RFIEYANELEQVPTIKLEVGDLACL 126
             K G  +  G+  RV + K +  G  + I +V  +F++ +N+++Q+P            
Sbjct: 72  PWKLGKTLGKGSSGRVRLAKNMETGKLSAIKIVPKKFVK-SNQIKQLPY----------- 119

Query: 127 KRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNN 186
                        +  E+ +MK +S  PN++  Y+   +++       E+ L++E     
Sbjct: 120 ------------GIEREIIIMKLISH-PNVMGLYEVWENKS-------ELYLVLEYVEGG 159

Query: 187 SLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDAN-HNFK 245
            L DY+  +   KL E E +     + +A+A  H   +   HRD+K EN+L+D    + K
Sbjct: 160 ELFDYLVSK--GKLPESEAIHYFKQIVQAVAYCHGFNI--CHRDLKPENLLLDKKKRSIK 215

Query: 246 LCDFGSTSTCFPVANTHQEIAVLTNNIYVHTT---PQYRSPEMI--DLYRCLPINEKSDI 300
           + DFG               A+ T++  + T+   P Y SPE++    Y   P    SD+
Sbjct: 216 IADFGMA-------------ALETSDKLLETSCGSPHYASPEIVLGRKYHGSP----SDV 258

Query: 301 WALGIFLYKLLFYTTPFELTGQFAIL----HSKYEFPVNNYSSKLINLIIIMLAENPNLR 356
           W+ GI L+ LL    PF       +L      KY+ P    S +  +LI  +L  +PN R
Sbjct: 259 WSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMP-QWLSVEAKDLISRILVVDPNRR 317

Query: 357 PNIYQVM 363
             I Q++
Sbjct: 318 ITIDQIL 324

>Scas_629.16
          Length = 918

 Score = 73.2 bits (178), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 80/295 (27%), Positives = 123/295 (41%), Gaps = 45/295 (15%)

Query: 77  VIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTI-KLEVGDLACLKRVLVTDEN 135
           + VG    E +K L +G    +Y+VR  +  N L  +    K E+     +KR+L   E 
Sbjct: 512 ITVGPQSFEKIKLLGQGDVGKVYLVR-EKKTNRLYALKIFSKSEMIKRKKIKRILAEQE- 569

Query: 136 GLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQR 195
                      +   S  P +V  Y  H+ ++ D      +   ME C        +  R
Sbjct: 570 -----------ILATSNHPFVVTLY--HSFQSED-----YLYFCMEYCMGGEFFRALQTR 611

Query: 196 LATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFG----S 251
               +SE +      +VT AL  +H L    I+RD+K EN+L+  + +  L DF     +
Sbjct: 612 RTKCISEDDARFYASEVTAALEYLHLLG--FIYRDLKPENILLHKSGHIMLSDFDLSVQA 669

Query: 252 TSTCFPVANTHQEIAVLTNNI---------YVHTTPQYRSPEMIDLYRCLPINEKSDIWA 302
                PV     E  V+   I         +V T  +Y +PE+I   R        D W 
Sbjct: 670 KDAKVPVMKGSAESTVVDTKICSDGFRTNSFVGTE-EYIAPEVI---RGNGHTAAVDWWT 725

Query: 303 LGIFLYKLLFYTTPFELTGQ---FA-ILHSKYEFPVNN-YSSKLINLIIIMLAEN 352
           LGI +Y++LF  TPF+ +     F+ IL +   FP NN  S    +LI  +L +N
Sbjct: 726 LGILIYEMLFGFTPFKGSSSNETFSNILKNDVSFPNNNDISRNCKDLIKKLLCKN 780

>Kwal_56.23717
          Length = 858

 Score = 72.8 bits (177), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 96/193 (49%), Gaps = 23/193 (11%)

Query: 178 LLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVL 237
           +L E      LLDY+ Q     L E+   K    +  AL  +H   +  +HRD+KIEN++
Sbjct: 10  MLFEYVSGGQLLDYIIQH--GSLRERSARKFARGIASALQYLHMNNI--VHRDLKIENIM 65

Query: 238 VDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEK 297
           +  +   K+ DFG ++    + N  +++     ++Y      + +PE+  L  C     +
Sbjct: 66  ISTSGEIKIIDFGLSN----MYNPKKQLHTFCGSLY------FAAPEL--LKACPYTGPE 113

Query: 298 SDIWALGIFLYKLLFYTTPFELTGQFAILH-----SKYEFPVNNYSSKLINLIIIMLAEN 352
            D+W+ G+ L+ L+    PF+     ++LH      K E+P  + S ++I+L+  ML  +
Sbjct: 114 VDVWSFGVVLFVLVCGKVPFDDENS-SVLHEKIKQGKVEYP-QHLSIEVISLLSKMLVVD 171

Query: 353 PNLRPNIYQVMDN 365
           P  R ++ QV+++
Sbjct: 172 PTKRASLKQVVNH 184

>AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W
           (KCC4) - SH] (1721689..1725117) [3429 bp, 1142 aa]
          Length = 1142

 Score = 72.8 bits (177), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 116/249 (46%), Gaps = 42/249 (16%)

Query: 140 MRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATK 199
           +  E+ +MK L+  PN+++ YD   + A+D      + +++E      L + + QR    
Sbjct: 75  IEREIIIMKLLNH-PNVLRLYDVWET-AQD------LYMVLEYVEKGELFNLLVQR--GP 124

Query: 200 LSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVA 259
           L E E ++    +   ++  H L +  +HRD+K EN+L+D   N KL DFG       +A
Sbjct: 125 LPENEAVRFFRQIIIGISYCHALGI--VHRDLKPENLLLDHKFNIKLADFG-------MA 175

Query: 260 NTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINE-KSDIWALGIFLYKLLFYTTPF- 317
               +  +L  +     +P Y +PE++     LP +  +SD+W+ G+ LY LL    PF 
Sbjct: 176 ALESKDKLLETSC---GSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRLPFD 229

Query: 318 ELTGQ-----FAILHSKYEFPV-NNYSSKLINLIIIMLAENPNLRPNIYQVMDNLCSILK 371
           E  G        +   KYE P  +  S +  +LI+ +L   P  R    +++        
Sbjct: 230 EEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREIL-------- 281

Query: 372 VKNPLEDKY 380
            K+PL  KY
Sbjct: 282 -KHPLLQKY 289

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 105/228 (46%), Gaps = 27/228 (11%)

Query: 143 EVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSE 202
           E + +++L     I+  Y +     +D SS +    L+E  PN  LL  M  R    ++E
Sbjct: 203 EKNTLQRLKNTKGIISLYFTF----QDESSLY---FLLEYAPNGDLLSLM--RKHGSVNE 253

Query: 203 QEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTH 262
           +        +  AL  MH   V  IHRD+K EN+L+D +   KL DFG+       +   
Sbjct: 254 KCTQYYAAQIIDALGFMHDKGV--IHRDLKPENILLDVDMKVKLTDFGTARLLDSTSEDD 311

Query: 263 QEIAVLTNNIYVHTTPQYRSPEMID----LYRCLPINEKSDIWALGIFLYKLLFYTTPFE 318
            +  +LT +     T +Y SPE+++     +RC       DIWA G  L++++    PF+
Sbjct: 312 LKYDLLTRSNSFVGTAEYVSPELLNDNYVDFRC-------DIWAFGCILFQMIAGKPPFK 364

Query: 319 LTGQF----AILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQV 362
              ++     ++  ++ F    +   + +L+  +L +NP  R  I Q+
Sbjct: 365 ANNEYLTFQKVMKVQFAFTA-GFPMTVRDLVKNILIKNPERRLLINQI 411

>Kwal_56.22693
          Length = 984

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 93/190 (48%), Gaps = 15/190 (7%)

Query: 178 LLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVL 237
            L+E  PN   L  + +     LS++  +     +  A+  +H+  +  +HRD+K EN+L
Sbjct: 234 FLLEYAPNGDFLSVIKK--FGSLSQECAVYYSAQILDAIDYLHHKGI--VHRDIKPENIL 289

Query: 238 VDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMI-DLYRCLPINE 296
           +D +   KL DFG T+       T Q   +L  +     T +Y SPE++ D Y    ++ 
Sbjct: 290 LDKDMKVKLTDFG-TARILEKDETTQTFNLLERSKSFVGTAEYVSPELLNDNY----VDY 344

Query: 297 KSDIWALGIFLYKLLFYTTPFELTGQF----AILHSKYEFPVNNYSSKLINLIIIMLAEN 352
           K DIWA G  L++++    PF+ T ++     ++  +Y F    +   + +LI  +L ++
Sbjct: 345 KCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAF-TAGFPLVIRDLIKKILVKS 403

Query: 353 PNLRPNIYQV 362
           P  R +  Q+
Sbjct: 404 PEQRLDASQI 413

>KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 483

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 77/304 (25%), Positives = 133/304 (43%), Gaps = 39/304 (12%)

Query: 83  RVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVG-DLACLKRVLVTDENGLNEMR 141
           + ++++ + +G F  +Y+  ++  +N+    P I   V   + C+   L      ++ + 
Sbjct: 6   QFQLLECVGKGNFGDVYLAHYLG-SNQEPTDPKIPKNVPLAIKCIN--LEHSNEPIDLLL 62

Query: 142 NEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLS 201
            E+  +  L  CP I  YY +             + ++ME C N SLL+ +  R  ++L+
Sbjct: 63  KEIYFLSTLH-CPYITHYYGTFTGDC-------NLYIVMEYCSNGSLLNLL--RYYSRLT 112

Query: 202 EQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANT 261
           EQ    I+  V  AL  +H     LIHRD+K  N+L++ +   +L D G T      +  
Sbjct: 113 EQTTCFIILQVCHALEYLH--EKRLIHRDLKAANILLNDDGEVRLADLGVTGQLKFNSTR 170

Query: 262 HQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTG 321
           H    +   N +V  TP + +PE+I   +    + K DIW+LGI   +LL    P     
Sbjct: 171 HGGKNL---NTFV-GTPFWMAPEII---KNQSYDGKCDIWSLGITTLELLNGKPPM---S 220

Query: 322 QFAILHSKYEFPVNNYSSKLINL---------IIIMLAENPNLRPNIYQVMDN----LCS 368
               + +    P  N  S L N+         I   L ++PN RP   Q++ +     CS
Sbjct: 221 HLDSMKALMRIPKLNADSILRNMDISPLGKDFIRSCLQQDPNQRPTCKQLLQHKWLKKCS 280

Query: 369 ILKV 372
           I  +
Sbjct: 281 ITNI 284

>KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces
           cerevisiae YDR507c GIN4 ser/thr protein kinase, start by
           similarity
          Length = 1112

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 116/249 (46%), Gaps = 42/249 (16%)

Query: 140 MRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATK 199
           +  E+ +MK L+  PN+++ YD   +         ++ +++E      L + + +R    
Sbjct: 73  IEREIIIMKLLN-HPNVLRLYDVWETSK-------DLYMVLEYVEKGELFNLLVER--GP 122

Query: 200 LSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVA 259
           L E E ++    +   ++  H L +  +HRD+K EN+L+D   N KL DFG       +A
Sbjct: 123 LPENEAVRFFRQIIIGISYCHALGI--VHRDLKPENLLLDHKFNVKLADFG-------MA 173

Query: 260 NTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINE-KSDIWALGIFLYKLLFYTTPF- 317
               +  +L  +     +P Y +PE++     LP +  +SD+W+ G+ LY LL    PF 
Sbjct: 174 ALESKDKLLETSC---GSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRLPFD 227

Query: 318 ELTGQ-----FAILHSKYEFPVNN-YSSKLINLIIIMLAENPNLRPNIYQVMDNLCSILK 371
           E  G        +   K+E P ++  SS+  +LI  +L  +P  R    +++        
Sbjct: 228 EEDGNIRNLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREIL-------- 279

Query: 372 VKNPLEDKY 380
            K+PL  KY
Sbjct: 280 -KHPLLRKY 287

>Scas_627.7
          Length = 349

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 75/253 (29%), Positives = 112/253 (44%), Gaps = 35/253 (13%)

Query: 119 EVGDLACLK---RVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFE 175
           E G +  LK   +  +   N   + R EV +   L+  PN+ + Y       R       
Sbjct: 112 ETGFICALKVMDKAEIVQYNLQKQFRREVEIQTSLNH-PNLTKLYGHFHDEKR------- 163

Query: 176 VTLLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIEN 235
           V LLME      L  Y   R     ++    + +F +  AL  +H     +IHRD+K EN
Sbjct: 164 VYLLMEYLVYGEL--YKLLRSHGPFNDVIASRFVFQIADALNYLH--DKQIIHRDLKPEN 219

Query: 236 VLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPIN 295
           +L+  N+  KL DFG  S   P     + +           T  Y SPEMI   R    +
Sbjct: 220 ILIGFNNVIKLTDFG-WSIINPRGVKRKTLC---------GTIDYLSPEMI---RSREYD 266

Query: 296 EKSDIWALGIFLYKLLFYTTPF-----ELTGQFAILHSKYEFPVNNYSSKLINLIIIMLA 350
           +K D+WALG+  Y+L+  + PF     ELT +  IL +  +FP    S  + +LI  +L 
Sbjct: 267 DKVDVWALGVLTYELIVGSPPFEEDTKELTYK-RILKNDIKFP-ETVSHDVKDLISKLLK 324

Query: 351 ENPNLRPNIYQVM 363
            NP+ R ++  VM
Sbjct: 325 YNPSERISMRDVM 337

>CAGL0C03509g complement(350846..353533) similar to sp|P53739
           Saccharomyces cerevisiae YNR047w or sp|P25341
           Saccharomyces cerevisiae YCR091w KIN82, hypothetical
           start
          Length = 895

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 80/298 (26%), Positives = 128/298 (42%), Gaps = 43/298 (14%)

Query: 77  VIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTI-KLEVGDLACLKRVLVTDEN 135
           + VG    E ++ L +G    +Y+V+  +  N L  +    K E+     +KR+L   E 
Sbjct: 490 ITVGPQSFEKIRLLGQGDVGKVYLVK-EKRTNRLYALKIFSKSEMIKRKKIKRILAEQE- 547

Query: 136 GLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQR 195
                      +   S  P +V  Y  H+ ++ D      + L ME C        +  R
Sbjct: 548 -----------ILATSNHPFVVTLY--HSFQSED-----YLYLCMEYCMGGEFFRALQTR 589

Query: 196 LATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFG----S 251
            +  +SE++      +VT AL  +H L    I+RD+K EN+L+  + +  L DF     +
Sbjct: 590 KSKCISEEDAKFYASEVTAALEYLHLLG--FIYRDLKPENILLHQSGHIMLSDFDLSIQA 647

Query: 252 TSTCFPVANTHQEIAVLTNNIYVHT--------TPQYRSPEMIDLYRCLPINEKSDIWAL 303
                PV   + +  V+   I            T +Y +PE+I   R        D W L
Sbjct: 648 KDAKVPVVKGNAQSTVVDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTAAVDWWTL 704

Query: 304 GIFLYKLLFYTTPF--ELTGQ-FA-ILHSKYEFPVNNYSSK-LINLIIIMLAENPNLR 356
           GI +Y++LF  TPF  E T + F+ IL     FP NN  S+   +LI  +L +N + R
Sbjct: 705 GILIYEMLFGFTPFKGENTNETFSNILKKDVTFPNNNEVSRNCKDLIKKLLIKNESKR 762

>CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase,
           hypothetical start
          Length = 1192

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 97/193 (50%), Gaps = 23/193 (11%)

Query: 178 LLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVL 237
           +L E      LLDY+ Q     L E    K    V  AL  +H   +  +HRD+KIEN++
Sbjct: 209 MLFEYVAGGQLLDYIIQH--GSLREHHARKFARGVASALQYLHANNI--VHRDLKIENIM 264

Query: 238 VDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEK 297
           +  +   K+ DFG ++    V +T +++     ++Y      + +PE++  +       +
Sbjct: 265 ISNSGEIKIIDFGLSN----VYDTRKQLHTFCGSLY------FAAPELLKAHPY--TGPE 312

Query: 298 SDIWALGIFLYKLLFYTTPFELTGQFAILH-----SKYEFPVNNYSSKLINLIIIMLAEN 352
            D+W+ G+ LY L+    PF+     ++LH      K E+P  + S ++++L+  ML  +
Sbjct: 313 VDVWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKRGKVEYP-QHLSIEVMSLLSKMLVVD 370

Query: 353 PNLRPNIYQVMDN 365
           P+ R ++ QV+++
Sbjct: 371 PSRRASLKQVVEH 383

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score = 70.5 bits (171), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 53/192 (27%), Positives = 93/192 (48%), Gaps = 16/192 (8%)

Query: 178 LLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVL 237
            L+E  PN   L  + ++  T L+E+  +     +  A+  MH   +  IHRD+K EN+L
Sbjct: 195 FLLEYAPNGDFLSLI-KKFGT-LNEECTIYYSAQIIDAIGSMHSHGI--IHRDIKPENIL 250

Query: 238 VDANHNFKLCDFGSTSTCFPVA--NTHQEIAVLTNNIYVHTTPQYRSPEMI-DLYRCLPI 294
           +D N   KL DFG+       +  N      +LT +     T +Y SPE++ D Y     
Sbjct: 251 LDGNMKIKLTDFGTAKLLQKKSDKNGKPHYNLLTRSSSFVGTAEYVSPELLSDNY----T 306

Query: 295 NEKSDIWALGIFLYKLLFYTTPFELTGQF----AILHSKYEFPVNNYSSKLINLIIIMLA 350
           + K DIWA G  +Y+++    PF+ T ++     ++  ++ F    + + + +L+  +L 
Sbjct: 307 DYKCDIWAFGCLVYQMIAGKPPFKATNEYLTFQKVMKVQFAFTA-GFPTIIRDLVKNILV 365

Query: 351 ENPNLRPNIYQV 362
           + P  R  I Q+
Sbjct: 366 KQPEKRLTIPQI 377

>Kwal_23.5290
          Length = 819

 Score = 70.5 bits (171), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 79/312 (25%), Positives = 135/312 (43%), Gaps = 50/312 (16%)

Query: 17  QPKRPLLKENAQHTPVLVVRSTNHLRMSKSETSSHHVVSGLNSSRSGT--LPVLEQLKTG 74
           QP R   K+   H P   V  T   + SK   S+  +++ L S    T   P  + ++  
Sbjct: 473 QPTREAPKKPDTH-PKKDVGVTKQRKPSKPTMSNAEIMAKLKSVTFNTDPTPFFQMMEKA 531

Query: 75  SQVIVGN----HRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVL 130
            Q   G+     R ++  Y  EGG             NE    P    E+GD   +K+++
Sbjct: 532 GQGASGSVYLAQRTQLPAY-GEGGL------------NEQIGEP----EIGDKVAIKQMI 574

Query: 131 VTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLD 190
           ++ +     + NE+ VMK  S   NIV + +++     D      + ++ME     SL D
Sbjct: 575 LSKQPRKELIVNEILVMKD-SQHKNIVNFLEAYLKTEDD------LWVVMEYMEGGSLTD 627

Query: 191 YMNQRLA-----TKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245
            +    A     + L+E +I  I+ +  + L  +H   +  IHRD+K +NVL+D     K
Sbjct: 628 LIENSPANGSSHSPLTEPQIAYIVRETCQGLKFLHDKHI--IHRDIKSDNVLLDNRARVK 685

Query: 246 LCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 305
           + DFG    C  + +   + A +        TP + +PE++        +EK D+W+LGI
Sbjct: 686 ITDFG---FCAKLTDKRSKRATMVG------TPYWMAPEVVKQRE---YDEKVDVWSLGI 733

Query: 306 FLYKLLFYTTPF 317
              ++L    P+
Sbjct: 734 MTIEMLEGEPPY 745

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score = 70.1 bits (170), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 103/232 (44%), Gaps = 28/232 (12%)

Query: 90  LAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNEMRNEVSVMKQ 149
           L EG F  + +      +   EQ P +  +V      +  +V +     ++  E++ +K 
Sbjct: 50  LGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRDTIVKNSEKEIKIYREINALKH 109

Query: 150 LSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQEILKIM 209
           L+  PN+V+  +   +    G       +++E         Y+ ++   +L E    ++ 
Sbjct: 110 LTH-PNVVRLEEVLQNSKYIG-------IVLEYASGGEFYKYIQRK--RRLKESTACRLF 159

Query: 210 FDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLT 269
             +   +  MH     L+HRD+K+EN+L+D N N  + DFG  +   P            
Sbjct: 160 AQLISGVTYMH--SKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLP------------ 205

Query: 270 NNIYVHT---TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 318
           +N Y+ T   +P Y +PE++   R   +  K+D+W+ GI LY +L    P++
Sbjct: 206 DNEYMKTSCGSPCYAAPELVISTRPY-VARKADVWSCGIILYAMLAGYLPWD 256

>Sklu_2323.3 YPL209C, Contig c2323 5241-6443
          Length = 400

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 72/249 (28%), Positives = 112/249 (44%), Gaps = 32/249 (12%)

Query: 120 VGDLACLKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLL 179
           +  L  +++  +T  N   + R EV +   L   PN+ Q Y       R       V LL
Sbjct: 165 ICALKAMEKKEITQYNVQKQFRREVEIQASLRH-PNLTQLYGYFYDDKR-------VYLL 216

Query: 180 MELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVD 239
           ME   N  L  Y + R+    ++      +  +  AL  MH   V  +HRD+K EN+L+ 
Sbjct: 217 MEYLVNGEL--YRHLRVNGPFNDILASYYVNQMADALNYMHDRNV--LHRDIKPENILIG 272

Query: 240 ANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSD 299
             +  KL DFG +     ++ T  +   L   +       Y SPE++  YR    +EK D
Sbjct: 273 FQNTLKLTDFGWSV----ISTTGAKRKTLCGTL------DYLSPELVK-YR--EYDEKVD 319

Query: 300 IWALGIFLYKLLFYTTPF-----ELTGQFAILHSKYEFPVNNYSSKLINLIIIMLAENPN 354
           +WALG+  Y+LL  T PF     ELT +  I+     FP +  S    +LI  +L  +P+
Sbjct: 320 VWALGVLAYELLVGTPPFEEASKELTYK-RIVRRDLRFP-DQMSIDARDLIGRLLENDPS 377

Query: 355 LRPNIYQVM 363
            R ++  V+
Sbjct: 378 TRISLKDVL 386

>KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1
           Kluyveromyces lactis MUP1 protein, hypothetical start
          Length = 774

 Score = 69.7 bits (169), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 79/298 (26%), Positives = 130/298 (43%), Gaps = 43/298 (14%)

Query: 77  VIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTI-KLEVGDLACLKRVLVTDEN 135
           ++VG    E ++ L +G    +Y+VR  +  N L  +    K E+     +KR+L   E 
Sbjct: 372 ILVGPQSFEKIRLLGQGDVGRVYLVR-EKQTNRLYALKIFSKPEMIKRKKIKRILTEQE- 429

Query: 136 GLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQR 195
                      +   S  P IV  Y  H+ +  D      + L ME C        +  R
Sbjct: 430 -----------ILATSNHPFIVTLY--HSFQTED-----YLYLCMEYCMGGEFFRALQTR 471

Query: 196 LATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTC 255
               +SE +      +VT AL  +H +    I+RD+K EN+L+  + +  L DF  +   
Sbjct: 472 KTKCISEDDARFYSSEVTAALEYLHLMG--FIYRDLKPENILLHQSGHIMLSDFDLSVQA 529

Query: 256 FPVAN-------THQ--EIAVLTNNIYVHT---TPQYRSPEMIDLYRCLPINEKSDIWAL 303
               N       +H   +  + ++    ++   T +Y +PE+I   R        D W L
Sbjct: 530 KDTKNPQVKGNASHSLVDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTAAVDWWTL 586

Query: 304 GIFLYKLLFYTTPF--ELTGQ-FA-ILHSKYEFPVNNYSSKLI-NLIIIMLAENPNLR 356
           GI +Y++LF  TPF  + T Q F+ IL ++   P NN +S+   +LI  +L +N N R
Sbjct: 587 GILIYEMLFGFTPFKGDNTNQTFSNILKNEVVIPNNNETSRACKDLIRKLLIKNENKR 644

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score = 69.7 bits (169), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 86/176 (48%), Gaps = 25/176 (14%)

Query: 142 NEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLS 201
           NE+ VM   S   NIV Y DS+ S       G ++ ++ME      L D +   +   L+
Sbjct: 611 NEIMVMSS-SKHQNIVNYIDSYLS-------GLDLWVVMEYMEGGCLTDVVTYCV---LT 659

Query: 202 EQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANT 261
           E +I  +  +V + L  +H   V  +HRD+K +NVL+  N + KL DFG    C  V +T
Sbjct: 660 EGQIGAVCREVLQGLEFLHSKGV--LHRDIKSDNVLLSMNGDIKLTDFG---FCAQVNDT 714

Query: 262 HQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 317
                V+     V  TP + +PE++      P   K DIW+LGI + +++    P+
Sbjct: 715 -----VIKRTTMV-GTPYWMAPEIVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 761

>YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine protein
           kinase required for cytokinesis [2529 bp, 842 aa]
          Length = 842

 Score = 69.7 bits (169), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 112/243 (46%), Gaps = 31/243 (12%)

Query: 85  EIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLE-----VGDLACLKRVLVTDENGLNE 139
           ++++   +G    +Y+        E   +  I  +     VGD   +K+++++ +     
Sbjct: 547 KVIEKAGQGASGSVYLAERTHIPTESNMIELINNDIDEPHVGDKVAIKQMVLSKQPRKEL 606

Query: 140 MRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYM-----NQ 194
           + NE+ VMK  S   NIV + +++  R  D     ++ ++ME     SL D +     N 
Sbjct: 607 IVNEILVMKD-SRHKNIVNFLEAYL-RTDD-----DLWVVMEFMEGGSLTDIIENSPTND 659

Query: 195 RLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTST 254
              + L+E +I  I+ +  + L  +H   +  IHRD+K +NVL+D     K+ DFG    
Sbjct: 660 NSHSPLTEPQIAYIVRETCQGLKFLHDKHI--IHRDIKSDNVLLDTRARVKITDFG---F 714

Query: 255 CFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYT 314
           C  + +   + A +        TP + +PE++        +EK D+W+LGI   ++L   
Sbjct: 715 CARLTDKRSKRATMVG------TPYWMAPEVVKQRE---YDEKIDVWSLGIMTIEMLEGE 765

Query: 315 TPF 317
            P+
Sbjct: 766 PPY 768

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 69.7 bits (169), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 85/176 (48%), Gaps = 25/176 (14%)

Query: 142 NEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLS 201
           NE+ VMK  S   NIV + DS+  +        ++ ++ME     SL D +   +   L+
Sbjct: 727 NEILVMKG-SRHNNIVNFIDSYLLKG-------DLWVIMEYMEGGSLTDVVTHCI---LT 775

Query: 202 EQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANT 261
           E +I  +  +  R L  +H   V  IHRD+K +N+L+  + N KL DFG    C  +  T
Sbjct: 776 EGQIAAVSRETLRGLHFLHSKGV--IHRDIKSDNILLSMDGNIKLTDFG---FCAQINET 830

Query: 262 HQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 317
           + +   +        TP + +PE++      P   K DIW+LGI + +++    P+
Sbjct: 831 NLKRTTMVG------TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 877

>YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine
           protein kinase of unknown function [2682 bp, 893 aa]
          Length = 893

 Score = 69.3 bits (168), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 81/302 (26%), Positives = 126/302 (41%), Gaps = 51/302 (16%)

Query: 77  VIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLAC----LKRVLVT 132
           ++VG    E ++ L +G    +++VR      +  +V  +K+   D       +KRVL  
Sbjct: 489 IMVGPQSFEKIRLLGQGDVGKVFLVR----EKKTNRVYALKVLSKDEMIKRNKIKRVLTE 544

Query: 133 DENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYM 192
            E            +   S  P IV  Y  H+ ++ D      + L ME C        +
Sbjct: 545 QE------------ILATSNHPFIVTLY--HSFQSED-----YLYLCMEYCMGGEFFRAL 585

Query: 193 NQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDF--- 249
             R    + E +      +VT AL  +H L    I+RD+K EN+L+  + +  L DF   
Sbjct: 586 QTRKTKCICEDDARFYASEVTAALEYLHLLG--FIYRDLKPENILLHQSGHIMLSDFDLS 643

Query: 250 --GSTSTCFPVANTHQEIAVLT--------NNIYVHTTPQYRSPEMIDLYRCLPINEKSD 299
                S    V  + Q   V T         N +V  T +Y +PE+I   R        D
Sbjct: 644 IQAKDSKVPVVKGSAQSTLVDTKICSDGFRTNSFV-GTEEYIAPEVI---RGNGHTAAVD 699

Query: 300 IWALGIFLYKLLFYTTPFE---LTGQFA-ILHSKYEFPVNNYSSKLI-NLIIIMLAENPN 354
            W LGI +Y++LF  TPF+       F  IL ++  FP NN  S+   +LI  +L +N +
Sbjct: 700 WWTLGILIYEMLFGFTPFKGDNTNETFTNILKNEVSFPNNNEISRTCKDLIKKLLTKNES 759

Query: 355 LR 356
            R
Sbjct: 760 KR 761

>AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W
           (KIN1) - SH] complement(823632..826847) [3216 bp, 1071
           aa]
          Length = 1071

 Score = 69.3 bits (168), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 90/191 (47%), Gaps = 23/191 (12%)

Query: 178 LLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVL 237
           +L E      LLDY+ Q     L E+   K    +  AL  +H   +  +HRD+KIEN++
Sbjct: 157 MLFEYVSGGQLLDYIIQH--GSLRERHARKFARGIASALQYLHLNNI--VHRDLKIENIM 212

Query: 238 VDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEK 297
           + ++   ++ DFG ++   P    H        ++Y      + +PE++  +       +
Sbjct: 213 ISSSGEIRIIDFGLSNMYDPKKQLH----TFCGSLY------FAAPELLKAHPY--TGPE 260

Query: 298 SDIWALGIFLYKLLFYTTPFELTGQFAILH-----SKYEFPVNNYSSKLINLIIIMLAEN 352
            DIW+ G+ LY L+    PF+     ++LH      K E+P  + S  +I+L+  ML  +
Sbjct: 261 VDIWSFGVVLYVLVCGKVPFD-DENASVLHEKIKQGKVEYP-QHLSIDVISLLSKMLVVD 318

Query: 353 PNLRPNIYQVM 363
           P  R  + QV+
Sbjct: 319 PYKRATLKQVV 329

>KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyveromyces
            lactis MAP kinase kinase kinase, start by similarity
          Length = 1338

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 66/277 (23%), Positives = 120/277 (43%), Gaps = 70/277 (25%)

Query: 90   LAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLV-----TDENGLN---EMR 141
            + +G F  +Y+               + +  G++  +K+V V      DE+ ++    ++
Sbjct: 1044 IGKGSFGAVYLA--------------LNVTTGEMLAVKQVTVPEFSSQDESAISMVEALK 1089

Query: 142  NEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFE-----VTLLMELCPNNSLLDYMNQRL 196
            +EVS +K L+   NIVQY             GFE      +L +E     S+   +  R+
Sbjct: 1090 SEVSTLKDLNHV-NIVQYL------------GFEEKNGIYSLFLEYVAGGSVGSLI--RM 1134

Query: 197  ATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCF 256
              +  +Q I  +   V   LA +H   +  +HRD+K +N+L+D +   K+ DFG      
Sbjct: 1135 YGRFDDQLIRHLTKQVLEGLAYLHSKGI--LHRDMKADNLLLDNDGVCKISDFG------ 1186

Query: 257  PVANTHQEIAVLTNNIYVHT------TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 310
                    I+  +NNIY ++      T  + +PEM+D       + K DIW+LG  + ++
Sbjct: 1187 --------ISRKSNNIYSNSDMTMRGTVFWMAPEMVDTAHGY--SAKVDIWSLGCVVLEM 1236

Query: 311  LFYTTPFE----LTGQFAILHSKYEFPVNNYSSKLIN 343
                 P+     +   F I  SK   P+ + +  L++
Sbjct: 1237 FAGKRPWSNFEVVAAMFQIGKSKTAPPIPDDTKDLVS 1273

>KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces
           cerevisiae YNL298w CLA4 ser/thr protein kinase, start by
           similarity
          Length = 879

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 114/240 (47%), Gaps = 32/240 (13%)

Query: 86  IVKYLAEGGFAHIYVVRFIE---YANELEQVPTIKLEVGDLACLKRVLVTDENGLNEMRN 142
           +V+   +G    +Y+   ++   Y +ELE     K ++G+   +K+++++ +     + N
Sbjct: 590 MVEKAGQGASGSVYLAERLQLPPYKDELE---AEKNQLGNKVAIKQMILSKQPRKELIVN 646

Query: 143 EVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLA----- 197
           E+ VMK  S   NIV + +++     D      + ++ME     SL D +          
Sbjct: 647 EILVMKD-SKHNNIVNFLEAYLKTEDD------LWVVMEYMEGGSLTDIIENSPTGSSGQ 699

Query: 198 TKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFP 257
           + L+E +I  I+ +  + L  +H   +  IHRD+K +NVL+D     K+ DFG    C  
Sbjct: 700 SPLTEPQIAYIVRETCQGLKFLHDKHI--IHRDIKSDNVLLDTRGRVKITDFG---FCAK 754

Query: 258 VANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 317
           + +   + A +        TP + +PE++   +    +EK D+W+LGI   ++L    P+
Sbjct: 755 LTDKRSKRATMVG------TPYWMAPEVV---KQREYDEKVDVWSLGIMTIEMLESEPPY 805

>Kwal_26.7355
          Length = 1446

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 72/285 (25%), Positives = 123/285 (43%), Gaps = 62/285 (21%)

Query: 116  IKLEVGDLACLKRVLV-----TDENGLN---EMRNEVSVMKQLSGCPNIVQYYDSHASRA 167
            + +  G++  +K+V V      DE  L+    +R+EV+ +K L    NIVQY        
Sbjct: 1164 LNVTTGEMIAVKQVEVPRYGSQDETTLSVLEALRSEVATLKDLDHT-NIVQYL------- 1215

Query: 168  RDGSSGFE-----VTLLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYL 222
                 GFE      +L +E     S+   +  RL  K  E  I  +   V R L+ +H  
Sbjct: 1216 -----GFENKNYVYSLFLEYVAGGSVGSLI--RLYGKFDENLIRFLAVQVLRGLSYLHSK 1268

Query: 223  PVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHT------ 276
             +  +HRD+K +N+L+D +   K+ DFG              I+  +NNIY ++      
Sbjct: 1269 KI--LHRDMKADNLLLDVDGICKISDFG--------------ISKKSNNIYSNSDMTMRG 1312

Query: 277  TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE----LTGQFAILHSKYEF 332
            T  + +PEM+D  +    + K DIW+LG  + ++     P+     +   F I   K   
Sbjct: 1313 TVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKFKSAP 1370

Query: 333  PVNNYSSKLIN-----LIIIMLAENPNLRPNIYQVMDN-LCSILK 371
            P+   + K+I+      +      NP  RP   +++ +  C + K
Sbjct: 1371 PIPEDTQKIISAEGKEFLDACFEINPEKRPTADELLSHPFCIVDK 1415

>Scas_564.7
          Length = 1210

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 97/193 (50%), Gaps = 23/193 (11%)

Query: 178 LLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVL 237
           +L E      LLDY+ Q  +  L E    K    +  AL  +H   +  +HRD+KIEN++
Sbjct: 263 MLFEYVSGGQLLDYIIQHGS--LREHHARKFARGIASALEYIHANNI--VHRDLKIENIM 318

Query: 238 VDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEK 297
           +  +   K+ DFG ++    V +  +++     ++Y      + +PE++  +       +
Sbjct: 319 ISTSGEIKIIDFGLSN----VFDRKKQLHTFCGSLY------FAAPELLKAHPY--TGPE 366

Query: 298 SDIWALGIFLYKLLFYTTPFELTGQFAILH-----SKYEFPVNNYSSKLINLIIIMLAEN 352
            D+W+ G+ LY L+    PF+     ++LH      K ++P N+ S ++I+L+  ML  +
Sbjct: 367 VDVWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKQGKVDYP-NHLSIEVISLLSKMLVVD 424

Query: 353 PNLRPNIYQVMDN 365
           P  R ++ QV+++
Sbjct: 425 PLRRASLKQVVEH 437

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 97/203 (47%), Gaps = 26/203 (12%)

Query: 120 VGDLACLKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLL 179
           +GD   +K+++++ +     + NE+ VMK  S   NIV + +++     D      + ++
Sbjct: 538 IGDKVAIKQMILSKQPRKELIVNEILVMKD-SQHKNIVNFLEAYLKTEDD------LWVV 590

Query: 180 MELCPNNSLLDYMNQRLATKLSEQ-----EILKIMFDVTRALAQMHYLPVPLIHRDVKIE 234
           ME     SL D +   + +  SE      +I  I+ +  + L  +H   +  IHRD+K +
Sbjct: 591 MEYMEGGSLTDVIENSIGSDASESPMTEPQIAYIVRETCQGLKFLHDKHI--IHRDIKSD 648

Query: 235 NVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPI 294
           NVL+D +   K+ DFG    C  + +   + A +        TP + +PE++        
Sbjct: 649 NVLLDTHGRVKITDFG---FCAKLTDKRSKRATMVG------TPYWMAPEVVKQRE---Y 696

Query: 295 NEKSDIWALGIFLYKLLFYTTPF 317
           +EK D+W+LGI   ++L    P+
Sbjct: 697 DEKVDVWSLGIMTIEMLEGEPPY 719

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 85/176 (48%), Gaps = 25/176 (14%)

Query: 142 NEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLS 201
           NE+ VM++ S   NIV + DS+ ++        ++ ++ME     SL D +   L   LS
Sbjct: 664 NEILVMRE-SKHSNIVNFIDSYLAKG-------DLWIVMEYMEGGSLTDVVTHCL---LS 712

Query: 202 EQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANT 261
           E +I  +  +  + L  +H   V  +HRD+K +N+L+    N KL DFG    C  +   
Sbjct: 713 EGQIGAVCRETLKGLQFLHSKGV--LHRDIKSDNILLSLKGNIKLTDFG---FCAQINEN 767

Query: 262 HQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 317
           + +   +        TP + +PE++      P   K DIW+LGI + +++    P+
Sbjct: 768 NLKRTTMVG------TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 814

>CAGL0K05709g complement(555903..559214) similar to sp|Q12263
           Saccharomyces cerevisiae YDR507c GIN4, start by
           similarity
          Length = 1103

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 116/249 (46%), Gaps = 42/249 (16%)

Query: 140 MRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATK 199
           +  E+ +MK L+  PN+++ +D   + +       ++ L++E      L + + +R    
Sbjct: 76  IEQEIIIMKLLN-HPNVLRLFDVWETNS-------DLYLVLEYAEKGELFNMLVER--GP 125

Query: 200 LSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVA 259
           L E E ++    +   ++  H L V  +HRD+K EN+L+D   N K+ DFG       +A
Sbjct: 126 LPENEAVRAFRQIIIGISYCHSLGV--VHRDLKPENLLLDNKLNIKIADFG-------MA 176

Query: 260 NTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINE-KSDIWALGIFLYKLLFYTTPF- 317
               E  +L  +     +P Y +PE+I     LP     SD+W+ G+ L+ LL    PF 
Sbjct: 177 ALESEDKLLETSC---GSPHYAAPEIIS---GLPYEGFSSDVWSCGVILFALLTGRLPFD 230

Query: 318 ELTGQ-----FAILHSKYEFPVNNYSSKLI-NLIIIMLAENPNLRPNIYQVMDNLCSILK 371
           E  G        +   ++E P ++  +K   +L+  +L  +P+ R  I +++        
Sbjct: 231 EEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREIL-------- 282

Query: 372 VKNPLEDKY 380
            K+PL  KY
Sbjct: 283 -KHPLLQKY 290

>YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine protein
           kinase, related to Kin2p and S. pombe KIN1 [3195 bp,
           1064 aa]
          Length = 1064

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 100/204 (49%), Gaps = 25/204 (12%)

Query: 178 LLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVL 237
           +L E      LLDY+ Q  + +  E +  K    +  AL  +H   +  +HRD+KIEN++
Sbjct: 221 MLFEYVSGGQLLDYIIQHGSIR--EHQARKFARGIASALIYLHANNI--VHRDLKIENIM 276

Query: 238 VDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLP-INE 296
           +  +   K+ DFG ++    + ++ +++     ++Y      + +PE++   +  P    
Sbjct: 277 ISDSSEIKIIDFGLSN----IYDSRKQLHTFCGSLY------FAAPELL---KANPYTGP 323

Query: 297 KSDIWALGIFLYKLLFYTTPFELTGQFAILH-----SKYEFPVNNYSSKLINLIIIMLAE 351
           + D+W+ G+ L+ L+    PF+     ++LH      K E+P  + S ++I+L+  ML  
Sbjct: 324 EVDVWSFGVVLFVLVCGKVPFDDENS-SVLHEKIKQGKVEYP-QHLSIEVISLLSKMLVV 381

Query: 352 NPNLRPNIYQVMDNLCSILKVKNP 375
           +P  R  + QV+++   +     P
Sbjct: 382 DPKRRATLKQVVEHHWMVRGFNGP 405

>Kwal_23.6458
          Length = 868

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 76/294 (25%), Positives = 125/294 (42%), Gaps = 48/294 (16%)

Query: 76  QVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTI-KLEVGDLACLKRVLVTDE 134
           +VIVG    E +K L +G    +Y+V+  +  N L  +    K E+     +KR+L   E
Sbjct: 456 EVIVGPQSFEKIKLLGQGDVGKVYLVK-EKKTNRLYALKIFSKEEMIKRKKIKRILAEQE 514

Query: 135 NGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQ 194
                       +   S  P IV  Y  H+ ++ D      + L ME C        +  
Sbjct: 515 ------------ILATSNHPFIVTLY--HSFQSED-----YLYLCMEYCMGGEFFRALQT 555

Query: 195 RLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFG---- 250
           R    + E +      +V  A+  +H +    I+RD+K EN+L+  + +  L DF     
Sbjct: 556 RKTKCIDEDDARFYSSEVVAAIEYLHLMG--FIYRDLKPENILLHKSGHIMLSDFDLSVQ 613

Query: 251 STSTCFPVANTHQEIAVLTNNI---------YVHTTPQYRSPEMIDLYRCLPINEKSDIW 301
           +  T  PV     + ++L   I         +V T  +Y +PE+I   R        D W
Sbjct: 614 AKDTKNPVVKGSAQSSLLDTKICSDGFRTNSFVGTE-EYIAPEVI---RGNGHTAAVDWW 669

Query: 302 ALGIFLYKLLFYTTPFE---LTGQFA-ILHSKYEFPVNNYSSK----LINLIII 347
            LGI +Y++LF  TP++       F+ +L ++  FP NN  S+    LI  ++I
Sbjct: 670 TLGILIYEMLFGFTPYKGDNTNKTFSNVLKNEVSFPNNNEVSRNCKDLIRKLLI 723

>Kwal_23.5668
          Length = 1689

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 110/232 (47%), Gaps = 31/232 (13%)

Query: 142 NEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMN-QRLATKL 200
           N +S  + L+G PN +     H  R R   S   +   ME C N +L D ++ + L  + 
Sbjct: 784 NSMSQFRDLNG-PNRLS---DHLKRNRIVKSTLFIQ--MEYCENRTLFDLIHTENLCAQ- 836

Query: 201 SEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVAN 260
            ++E  ++  ++  AL+ +H     +IHRD+K  N+ +D + N K+ DFG         N
Sbjct: 837 -KEEYWRLFREILDALSYIH--SQGIIHRDLKPMNIFIDESRNIKIGDFG------LAKN 887

Query: 261 THQEIAVLTNNIYVHT--TPQYRSPEMIDLYRCLPI-------NEKSDIWALGIFLYKLL 311
            H+ + +L  + ++ T  T    S     LY    +       NEK D+++LGI  ++++
Sbjct: 888 VHKSVDLLRMDSHISTASTEDLTSAIGTALYVATEVLTGSGNYNEKIDMYSLGIIFFEMV 947

Query: 312 F-YTTPFELTGQF-AILHSKYEFPVNNYSSKLI---NLIIIMLAENPNLRPN 358
           + + T  E       I  S  +FP +  SSKL     +I  +L  +PN RPN
Sbjct: 948 YSFNTGMERVNDIKKIRTSAIDFPSDFDSSKLAVEKKIITQLLDHDPNRRPN 999

>Scas_693.17
          Length = 1049

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 107/234 (45%), Gaps = 30/234 (12%)

Query: 147 MKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQEIL 206
           + Q+   P+I + Y+ H       S+ F   +L E      LLDY+ Q  +  L E    
Sbjct: 153 LGQILYHPHICRLYEMHTL-----SNHF--YMLFEYVSGGQLLDYIIQHGS--LKESRAR 203

Query: 207 KIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIA 266
                +  AL  +H   +  +HRD+KIEN+++  + N KL DFG  S  +   N   ++ 
Sbjct: 204 TFTRQICSALKYLHSHNI--VHRDLKIENIMISKDGNIKLIDFG-LSNLYDKCN---KLK 257

Query: 267 VLTNNIYVHTTPQYRSPEMIDLYRCLP-INEKSDIWALGIFLYKLLFYTTPFELTGQFAI 325
               ++Y      + +PE++   +  P I  + D+W+ G+ LY L+    PF+      +
Sbjct: 258 TYCGSLY------FAAPELL---KATPYIGPEIDVWSFGVVLYVLVCGKVPFDDENS-NV 307

Query: 326 LHSKYE----FPVNNYSSKLINLIIIMLAENPNLRPNIYQVMDNLCSILKVKNP 375
           LH K +    F     S ++I+L+  ML  +P  R  + QVM++   +     P
Sbjct: 308 LHEKIKQGKVFYPQFLSIEVISLLSKMLVVDPFKRATLDQVMNHHWMVRDCDGP 361

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 101/234 (43%), Gaps = 36/234 (15%)

Query: 85  EIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNEMRNEV 144
           E+ + L +G F  +Y VR  +              +  L  +++  +   N L +++ EV
Sbjct: 101 EVGRKLGKGKFGKVYCVRHKKSG-----------FICALKAIEKNEILQFNLLKQLKREV 149

Query: 145 SVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQE 204
            +   +   PNI++ Y       R       V LLME   N  L  Y + +     ++  
Sbjct: 150 DIQLGMDH-PNIIKLYAHFHDEKR-------VYLLMEHSINGEL--YKSLKNNGPFNDVL 199

Query: 205 ILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQE 264
               ++ +  AL  MH     +IHRDVK ENVL+  ++  KL DFG  S   P  +  + 
Sbjct: 200 ASHYIYQIADALHYMH--KKRIIHRDVKPENVLIGFDNVVKLADFG-WSILNPEGSKRKT 256

Query: 265 IAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 318
           +           T  Y SPEMI        +E+ D+WALG+  Y+L+    PFE
Sbjct: 257 LC---------GTIDYLSPEMITPRE---YDEQVDVWALGVLAYELVVGVPPFE 298

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 105/231 (45%), Gaps = 27/231 (11%)

Query: 146 VMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQEI 205
            +++L+G   I + + +    A        +  L+E  P+   L  + +     L+E   
Sbjct: 176 ALQKLNGTKGIFKLFFTFQDEA-------SLYFLLEYAPHGDFLGLIKKY--GSLNETCA 226

Query: 206 LKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEI 265
                 +  A+  +H + +  IHRD+K EN+L+D N   KL DFG T+   P   ++   
Sbjct: 227 RYYASQIIDAVDSLHNIGI--IHRDIKPENILLDKNMKVKLTDFG-TAKILPEEPSNTAD 283

Query: 266 AVLTNNIYVHT-----TPQYRSPEMI-DLYRCLPINEKSDIWALGIFLYKLLFYTTPFEL 319
                ++Y  +     T +Y SPE++ D Y     + + DIWA G  LY++L    PF+ 
Sbjct: 284 GKPYFDLYAKSKSFVGTAEYVSPELLNDNY----TDSRCDIWAFGCILYQMLAGKPPFKA 339

Query: 320 TGQF----AILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQVMDNL 366
             ++     ++  +Y F    +   + +L+  +L  +PN R  I Q+  +L
Sbjct: 340 ANEYLTFQKVMKIQYAFTA-GFPQIVKDLVKKLLVRDPNDRLTIKQIKAHL 389

>Scas_675.2
          Length = 527

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 93/189 (49%), Gaps = 22/189 (11%)

Query: 134 ENGLNE--MRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDY 191
           +NGL E  +  EV +  + S  PN+++  D + ++         + ++ME+     L D 
Sbjct: 54  KNGLTEKDISREVLLHSRCSKNPNVLRLIDCNIAKDY-------MWMIMEMADGGDLFDK 106

Query: 192 MNQRLATKLSEQEILKIMFD-VTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFG 250
           +   +     + E+ +  F  + RA++ +H     + HRD+K EN+L+D N N KL DFG
Sbjct: 107 IEPDVGV---DSEVAQFYFQQLVRAISYLHE-ECGVAHRDIKPENILLDKNGNLKLADFG 162

Query: 251 STSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 310
            +S         ++   L  +     +P Y +PE+  L+        +DIW++GI L+ L
Sbjct: 163 LSS------QYRRKDGTLRISTDQRGSPPYMAPEI--LHSRGYYAHSTDIWSIGILLFVL 214

Query: 311 LFYTTPFEL 319
           L   TP+EL
Sbjct: 215 LTGETPWEL 223

>YDR507C (GIN4) [1321] chr4 complement(1462346..1465774)
           Serine/threonine-protein kinase required for septin
           organization at the bud neck, has similarity to Ycl024p
           [3429 bp, 1142 aa]
          Length = 1142

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 113/249 (45%), Gaps = 42/249 (16%)

Query: 140 MRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATK 199
           +  E+ +MK L+  PN+++ YD   +         ++ L++E      L + + +R    
Sbjct: 78  IEREIIIMKLLN-HPNVLRLYDVWETNT-------DLYLVLEYAEKGELFNLLVER--GP 127

Query: 200 LSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVA 259
           L E E ++    +   ++  H L +  +HRD+K EN+L+D  +N K+ DFG       +A
Sbjct: 128 LPEHEAIRFFRQIIIGVSYCHALGI--VHRDLKPENLLLDHKYNIKIADFG-------MA 178

Query: 260 NTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINE-KSDIWALGIFLYKLLFYTTPF- 317
               E  +L  +     +P Y +PE++     +P     SD+W+ G+ L+ LL    PF 
Sbjct: 179 ALETEGKLLETSC---GSPHYAAPEIVS---GIPYQGFASDVWSCGVILFALLTGRLPFD 232

Query: 318 ELTGQFAIL-----HSKYEFPVNN-YSSKLINLIIIMLAENPNLRPNIYQVMDNLCSILK 371
           E  G    L       ++E P ++  S +  +LI  +L  +P  R     ++        
Sbjct: 233 EEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDIL-------- 284

Query: 372 VKNPLEDKY 380
            K+PL  KY
Sbjct: 285 -KHPLLQKY 292

>KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase, start by
           similarity
          Length = 1104

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 97/194 (50%), Gaps = 25/194 (12%)

Query: 178 LLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVL 237
           +L E      LLDY+ Q     L E+   K +  +  AL  +H   +  +HRD+KIEN++
Sbjct: 199 MLFEYVSGGQLLDYIIQH--GSLRERHARKFVRGIASALQYLHLNNI--VHRDLKIENIM 254

Query: 238 VDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLP-INE 296
           +  +   K+ DFG ++    + +  +++     ++Y      + +PE++   +  P I  
Sbjct: 255 ISTSGEIKIIDFGLSN----LYDNKKQLHTFCGSLY------FAAPELL---KANPYIGP 301

Query: 297 KSDIWALGIFLYKLLFYTTPFELTGQFAILH-----SKYEFPVNNYSSKLINLIIIMLAE 351
           + DIW+ G+ +Y L+    PF+     ++LH      K E+P  + S + I+L+  ML  
Sbjct: 302 EVDIWSFGVVIYVLVCGKVPFD-DENASVLHEKIKKGKVEYP-QHLSIECISLLSKMLVV 359

Query: 352 NPNLRPNIYQVMDN 365
           +P  R ++ QV ++
Sbjct: 360 DPLKRASLKQVCNH 373

>YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine protein
            kinase of the MEKK family involved in the cell wall
            integrity (low-osmolarity) and nutrient sensing pathways
            [4437 bp, 1478 aa]
          Length = 1478

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 69/296 (23%), Positives = 125/296 (42%), Gaps = 63/296 (21%)

Query: 90   LAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNE--------MR 141
            + +G F  +Y+               + +  G++  +K+V V   +  NE        +R
Sbjct: 1181 IGKGSFGAVYLC--------------LNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALR 1226

Query: 142  NEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFE-----VTLLMELCPNNSLLDYMNQRL 196
            +EVS +K L    NIVQY             GFE      +L +E     S+   +  R+
Sbjct: 1227 SEVSTLKDLDHL-NIVQYL------------GFENKNNIYSLFLEYVAGGSVGSLI--RM 1271

Query: 197  ATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCF 256
              +  E  I  +   V + LA +H   +  +HRD+K +N+L+D +   K+ DFG      
Sbjct: 1272 YGRFDEPLIKHLTTQVLKGLAYLHSKGI--LHRDMKADNLLLDQDGICKISDFG------ 1323

Query: 257  PVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 316
             ++   ++I    +++ +  T  + +PEM+D  +    + K DIW+LG  + ++     P
Sbjct: 1324 -ISRKSKDIYS-NSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRP 1379

Query: 317  FE----LTGQFAILHSKYEFPVNNYSSKLI-----NLIIIMLAENPNLRPNIYQVM 363
            +     +   F I  SK   P+   +  LI     N +      NP  RP   +++
Sbjct: 1380 WSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELL 1435

>Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement
          Length = 1071

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 103/224 (45%), Gaps = 21/224 (9%)

Query: 143 EVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSE 202
           E + +++L+    +++ Y +    A        +  L+E  PN   L  M +     L+E
Sbjct: 230 EKNTLQRLNNSRGVIKLYFTFQDEA-------SLYFLLEYAPNGDFLSVMKK--FGSLNE 280

Query: 203 QEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTH 262
           +        +  A+  +H   V  +HRD+K EN+L+D +   KL DFG+        +  
Sbjct: 281 ECCRYYGAQMLDAIDFIHKNGV--VHRDIKPENILLDEHMKVKLTDFGTAKLL--DRDEK 336

Query: 263 QEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQ 322
               +L  +     T +Y SPE+++   C  +N K DIWA G  LY+++    PF+ T +
Sbjct: 337 SGYNLLKKSRSFVGTAEYVSPELLN-DNC--VNYKCDIWAFGCILYQMIAGKPPFKATNE 393

Query: 323 F----AILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQV 362
           +     ++  +Y F    +   + +L+  +L ++P  R N  QV
Sbjct: 394 YLTFQKVMKVQYAFTA-GFPLVIRDLVKQLLVKSPEARLNASQV 436

>KLLA0E17127g complement(1515721..1518279) similar to sp|P38691
           Saccharomyces cerevisiae YHR082c KSP1 ser/thr protein
           kinase, start by similarity
          Length = 852

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 83/190 (43%), Gaps = 40/190 (21%)

Query: 143 EVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSE 202
           EV +  ++    NI + YD            F+  ++ME C    L + +   +  + + 
Sbjct: 116 EVDIQTKIGKHKNITELYDF-----------FDSYIIMEYCSGGDLYEAIKDDMVPRKT- 163

Query: 203 QEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTH 262
           + +  I+  +  A+  +H   +   HRD+K EN+L+  N N KL D+G  +T        
Sbjct: 164 KNVTNIINQILDAVEYVHSRGI--YHRDIKPENILIAGNWNIKLTDWGLATT-------- 213

Query: 263 QEIAVLTNNIYVHTTPQYRSPEMI----------DLYRCLPINEKSDIWALGIFLYKLLF 312
            +   +  N+    + +Y +PE+           D Y C     K DIWA+GI +  ++F
Sbjct: 214 -DKTSMERNV---GSERYMAPELFESNLDREERTDAYDCA----KVDIWAIGIVMLNIVF 265

Query: 313 YTTPFELTGQ 322
           +  PF +  Q
Sbjct: 266 HKNPFTVANQ 275

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 84/176 (47%), Gaps = 25/176 (14%)

Query: 142 NEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLS 201
           NE+ VMK  S   NIV + DS+  R        ++ ++ME     SL D +   +   L+
Sbjct: 742 NEILVMKG-SKHNNIVNFIDSYLFRG-------DLWVVMEYMEGGSLTDVVTHCI---LT 790

Query: 202 EQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANT 261
           E +I  +  +  + L  +H   V  IHRD+K +N+L+  N + KL DFG    C  +   
Sbjct: 791 EGQIGAVSRETLKGLQFLHSKGV--IHRDIKSDNILLSMNGDIKLTDFG---FCAQINEV 845

Query: 262 HQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 317
           + +   +        TP + +PE++      P   K DIW+LGI + +++    P+
Sbjct: 846 NLKRTTMVG------TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 892

>Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement
          Length = 466

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 106/234 (45%), Gaps = 28/234 (11%)

Query: 138 NEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLA 197
           N++  EV +  + S   NI++  D + S+         + + ME+     L D +   + 
Sbjct: 4   NDVSKEVIIHSRCSKHSNILKVIDCNISKDY-------LWIAMEMADGGDLFDKIEPDIG 56

Query: 198 TKLSEQEILKIMFD-VTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCF 256
               + E+ +  F  + RA+  +H +   + HRD+K EN+L+D N N KL DFG  S  F
Sbjct: 57  V---DAEVAQFYFQQLLRAIHHLHEV-CGIAHRDIKPENILLDKNGNLKLADFGLASQ-F 111

Query: 257 PVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 316
              +  + +A          +P Y +PE+I  Y      + +DIW+ GI ++ LL   TP
Sbjct: 112 RRKDGTKRLARDQRG-----SPPYMAPEII--YSSEYYADTTDIWSCGILVFVLLTGETP 164

Query: 317 FELTG-------QFAILHSKYEF-PVNNYSSKLINLIIIMLAENPNLRPNIYQV 362
           +EL         +F   +    F P        +NL+  +L  NP+ R  I Q+
Sbjct: 165 WELPSEDDYNFREFLEDNGNLSFGPWAKIDFTQLNLLRKILQPNPSKRATILQL 218

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 106/227 (46%), Gaps = 23/227 (10%)

Query: 143 EVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSE 202
           E + +++L+    IV+ + +     +D SS +    L+E  PN   L  M +  +  LSE
Sbjct: 230 EKNALQRLNNSRGIVKLFFTF----QDESSLY---FLLEYAPNGDFLSVMKKYGS--LSE 280

Query: 203 QEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTH 262
                    +   +  +H   +  IHRD+K EN+L+D +   K+ DFG+     P     
Sbjct: 281 DCTRYYSAQIIDGIKYLHSKGI--IHRDIKPENILLDKDMKVKITDFGTAKILEPKNEDE 338

Query: 263 Q--EIAVLTNNIYVHTTPQYRSPEMI-DLYRCLPINEKSDIWALGIFLYKLLFYTTPFEL 319
              E  +LT +     T +Y SPE++ D Y    ++ + DIWA G  +++++    PF+ 
Sbjct: 339 DNPEFNLLTRSKSFVGTAEYVSPELLNDSY----VDARCDIWAFGCMVFQMIAGKPPFKA 394

Query: 320 TGQF----AILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQV 362
           T ++     ++  +Y F    +   + +L+  +L + P  R  I Q+
Sbjct: 395 TNEYLTFQKVMKVQYAFTA-GFPVVVRDLVKRILLKVPEQRLTIPQI 440

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 73/284 (25%), Positives = 127/284 (44%), Gaps = 45/284 (15%)

Query: 90  LAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNEM---RNEVSV 146
           L  G ++ +Y  R +E +++ +    IK+      C KR ++  EN +  +   +N +++
Sbjct: 16  LGHGSYSTVY--RVVERSSQHQYA--IKI------CSKRHII-GENKVKYVTIEKNTLNL 64

Query: 147 MKQLSGCPNIVQ-YYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMN-QRLATKLSEQE 204
           + Q +  P I++ YY  H            +  +M+L P   LL  +  QR+    SE  
Sbjct: 65  LGQ-ANHPGIIKLYYTFHDQE--------NLYFVMDLAPGGELLQLLRRQRV---FSEAW 112

Query: 205 ILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQE 264
               M  +   +  +H + V  IHRD+K ENVL+D      + DFG+  T          
Sbjct: 113 ARHYMCQLVDTVEYIHSMGV--IHRDLKPENVLLDKEGRLMIADFGAAYTVGQSDAGSDG 170

Query: 265 IAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF------E 318
               T+ +    T +Y SPE++   +       SD+WALG  LY+ L  T PF      E
Sbjct: 171 DKPATSFV---GTAEYVSPELLLENKSY---YSSDVWALGCMLYQFLQGTPPFRGQNEME 224

Query: 319 LTGQFAILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQV 362
              Q   L   +  P N  ++ L++ I+++   +P+ R  + Q+
Sbjct: 225 TFEQIVNLDYTWRIPANPLAAGLVSKILVL---DPSQRYTLEQI 265

>Scas_616.10
          Length = 1461

 Score = 67.0 bits (162), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 87/184 (47%), Gaps = 35/184 (19%)

Query: 140 MRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATK 199
           +  E+ +MK +S  PN++  Y+   +++       E+ L++E      L DY+  +   K
Sbjct: 183 IEREIVIMKLISH-PNVMALYEVWENKS-------ELYLVLEYVDGGELFDYLVSK--GK 232

Query: 200 LSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDA-NHNFKLCDFGSTSTCFPV 258
           LSE+E +     + + ++  H   +   HRD+K EN+L+D  N + K+ DFG  +   P 
Sbjct: 233 LSEKEAVHYFKQIIQGVSYCHSFNI--CHRDLKPENLLLDKKNKSIKIADFGMAALELP- 289

Query: 259 ANTHQEIAVLTNNIYVHTT---PQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLFY 313
                       N  + T+   P Y SPE++    Y   P    SD+W+ GI L+ LL  
Sbjct: 290 ------------NKLLQTSCGSPHYASPEIVMGKSYHGGP----SDVWSCGIILFALLTG 333

Query: 314 TTPF 317
             PF
Sbjct: 334 HLPF 337

>Kwal_56.24091
          Length = 381

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 86/196 (43%), Gaps = 25/196 (12%)

Query: 123 LACLKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMEL 182
           L  +K+  +   N   + R EV +   L   PN+ + Y       R       V LLME 
Sbjct: 151 LKAMKKSEIVQYNVQKQFRREVEIQSSLKH-PNLTRLYGYFHDEKR-------VYLLMEY 202

Query: 183 CPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANH 242
             N  L  Y + R     ++      +  +  AL  MH     ++HRD+K EN+L+   +
Sbjct: 203 LVNGEL--YKHLRSHGPFNDITASHFVHQMADALNYMH--SKNILHRDIKPENILLGFQN 258

Query: 243 NFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 302
             KL DFG + +   V N+ ++            T  Y SPE+I   +    + K D+WA
Sbjct: 259 TLKLTDFGWSVS--NVGNSKRKTLC--------GTMDYLSPELI---KSREYDNKVDVWA 305

Query: 303 LGIFLYKLLFYTTPFE 318
           LG+  Y+LL  + PFE
Sbjct: 306 LGVLTYELLVGSPPFE 321

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score = 67.0 bits (162), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 98/384 (25%), Positives = 167/384 (43%), Gaps = 60/384 (15%)

Query: 16  NQPKRPLLKENAQHTPVLVVRSTNHL--RMSKSET-SSHHVVSGLNSSRSGTLPVLEQLK 72
           N  K+P  K N+ H    V++S N    R+S++E+ +S++  S    SR    P     K
Sbjct: 40  NYVKKPSPKTNSNHLD-RVIKSVNDATKRLSEAESINSNNTKSSKRKSRDTVGP----WK 94

Query: 73  TGSQVIVGNH-RVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLV 131
            G  +  G+  RV + K +  G  A I +V    Y   +     +K   G  +       
Sbjct: 95  LGKTLGKGSSGRVRLAKNIENGTLAAIKIVPKRTYNRRMRD-QKMKTAGGVSSGTDSKDS 153

Query: 132 TD-----ENGLNEMRN------EVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLM 180
           ++     +NG +   N      E+ +MK +S  PN++   +   +++       E+ L++
Sbjct: 154 SNREDPIKNGTDSALNPYGIEREIVIMKLISH-PNVMGLLEVWENKS-------ELYLVL 205

Query: 181 ELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDA 240
           E      L DY+  +   KLSE E +     + + ++  H   +   HRD+K EN+L+D 
Sbjct: 206 EYVDGGELFDYLVSK--GKLSEPEAVHYFTQIIQGVSYCHSFNI--CHRDLKPENLLLDK 261

Query: 241 -NHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMI--DLYRCLPINEK 297
            N   K+ DFG  +   P  N   E +          +P Y SPE++    Y   P    
Sbjct: 262 KNKVIKIADFGMAALELP--NKLLETSC--------GSPHYASPEIVMGKPYHGGP---- 307

Query: 298 SDIWALGIFLYKLLFYTTPFELTGQFAIL----HSKYEFP--VNNYSSKLINLIIIMLAE 351
           SD+W+ GI L+ LL    PF       +L      +++ P  + N +  LI  I++    
Sbjct: 308 SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLPPYLTNDAKDLITRILVT--- 364

Query: 352 NPNLRPNIYQVMDNLCSILKVKNP 375
           NP  R  I +++++   I K +NP
Sbjct: 365 NPEKRLTINEILNHPL-IKKYRNP 387

>Scas_720.94
          Length = 1683

 Score = 67.0 bits (162), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 58/261 (22%), Positives = 110/261 (42%), Gaps = 49/261 (18%)

Query: 89   YLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNEM----RNEV 144
            ++  G F  +Y                + L+ G++  +K + + D   + ++    + E+
Sbjct: 1366 FIGGGTFGTVY--------------SAVNLDNGEILAVKEIKIQDSKTMKKIFPLVKEEM 1411

Query: 145  SVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQE 204
            +V++ L+  PNIVQYY     R +       V + ME C   S+   +      ++ ++ 
Sbjct: 1412 TVLEMLNH-PNIVQYYGVEVHRDK-------VNIFMEYCEGGSMASLLEH---GRIEDEM 1460

Query: 205  ILKI-MFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCF----PVA 259
            + ++   ++   LA +H   V  +HRD+K EN+L+D N   K  DFG+          V 
Sbjct: 1461 VTQVYTLELLEGLAYLHQAGV--VHRDIKPENILLDFNGIIKYVDFGAARKIAKNGTKVT 1518

Query: 260  NTHQEIAVLTNNIYVHT------------TPQYRSPEMIDLYRCLPINEKSDIWALGIFL 307
            N + +           T            TP Y +PE I  Y+        DIW+ G  +
Sbjct: 1519 NINSKSKDDDEPDEKDTEGGANSVHDMLGTPMYMAPESITGYKNKTKFGSDDIWSFGCVV 1578

Query: 308  YKLLFYTTPF-ELTGQFAILH 327
             +++    P+  L  ++AI++
Sbjct: 1579 LEMITGRRPWANLDNEWAIIY 1599

>YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine
           protein kinase, related to Kin1p and S. pombe KIN1 [3444
           bp, 1147 aa]
          Length = 1147

 Score = 66.6 bits (161), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 93/193 (48%), Gaps = 23/193 (11%)

Query: 178 LLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVL 237
           +L E      LLDY+ Q     L E    K    +  AL  +H   +  +HRD+KIEN++
Sbjct: 200 MLFEYVSGGQLLDYIIQH--GSLKEHHARKFARGIASALQYLHANNI--VHRDLKIENIM 255

Query: 238 VDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLP-INE 296
           + ++   K+ DFG ++    + +  +++     ++Y      + +PE++   +  P    
Sbjct: 256 ISSSGEIKIIDFGLSN----IFDYRKQLHTFCGSLY------FAAPELL---KAQPYTGP 302

Query: 297 KSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEFPVNNYSSKL----INLIIIMLAEN 352
           + DIW+ GI LY L+    PF+     +ILH K +    +Y S L    I+L+  M+  +
Sbjct: 303 EVDIWSFGIVLYVLVCGKVPFDDENS-SILHEKIKKGKVDYPSHLSIEVISLLTRMIVVD 361

Query: 353 PNLRPNIYQVMDN 365
           P  R  +  V+++
Sbjct: 362 PLRRATLKNVVEH 374

>YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine
           protein kinase that genetically interacts with histone
           mutants and negatively regulates Swe1p protein kinase
           [4557 bp, 1518 aa]
          Length = 1518

 Score = 66.6 bits (161), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 66/248 (26%), Positives = 110/248 (44%), Gaps = 49/248 (19%)

Query: 143 EVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSE 202
           E+ +MK +S   N++  ++   +++       E+ L++E      L DY+  +   KL E
Sbjct: 164 EIVIMKLISHT-NVMALFEVWENKS-------ELYLVLEYVDGGELFDYLVSK--GKLPE 213

Query: 203 QEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDA-NHNFKLCDFGSTSTCFPVANT 261
           +E +     +   ++  H   +   HRD+K EN+L+D  N   K+ DFG  +   P    
Sbjct: 214 REAIHYFKQIVEGVSYCHSFNI--CHRDLKPENLLLDKKNRRIKIADFGMAALELP---- 267

Query: 262 HQEIAVLTNNIYVHTT---PQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLFYTTP 316
                    N  + T+   P Y SPE++    Y   P    SD+W+ GI L+ LL    P
Sbjct: 268 ---------NKLLKTSCGSPHYASPEIVMGRPYHGGP----SDVWSCGIVLFALLTGHLP 314

Query: 317 FELTGQFAIL----HSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQVMDNLCSILKV 372
           F       +L      KY+ P +N SS+  +LI  +L  +P  R    +++         
Sbjct: 315 FNDDNIKKLLLKVQSGKYQMP-SNLSSEARDLISKILVIDPEKRITTQEIL--------- 364

Query: 373 KNPLEDKY 380
           K+PL  KY
Sbjct: 365 KHPLIKKY 372

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 78/150 (52%), Gaps = 22/150 (14%)

Query: 211 DVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTN 270
           +VT AL  +H+  +  I+RD+K EN+L+D N + K+ DFG            +E+  +T 
Sbjct: 157 EVTLALEYLHFHNI--IYRDLKPENILLDRNGHIKITDFGFA----------KEVETVTW 204

Query: 271 NIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQF----AIL 326
            +    TP Y +PE+I      P N+  D W+LG+ +Y++L   TPF  T        IL
Sbjct: 205 TL--CGTPDYIAPEVI---ATKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKIL 259

Query: 327 HSKYEFPVNNYSSKLINLIIIMLAENPNLR 356
           H K  +P   ++S +I+L+  +L  +   R
Sbjct: 260 HGKVVYP-QFFNSDVIDLLSKLLTADLTRR 288

>YDL159W (STE7) [712] chr4 (172482..174029)
           Serine/threonine/tyrosine protein kinase of MAP kinase
           kinase (MAPKK or MEK) family, component of pheromone
           response, filamentous growth, and STE vegetative growth
           pathways [1548 bp, 515 aa]
          Length = 515

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 96/200 (48%), Gaps = 38/200 (19%)

Query: 137 LNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMN--Q 194
           +N++  E+S++K +    NI+ +Y ++ ++  +     E+ +LME     SL   ++  +
Sbjct: 232 INQLVRELSIVKNVKPHENIITFYGAYYNQHINN----EIIILMEYSDCGSLDKILSVYK 287

Query: 195 RLA---------TKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245
           R           T  +E  I KI + V   L  + Y    +IHRD+K  NVL+++    K
Sbjct: 288 RFVQRGTVSSKKTWFNELTISKIAYGVLNGLDHL-YRQYKIIHRDIKPSNVLINSKGQIK 346

Query: 246 LCDFGSTSTCF-PVANTHQEIAVLTNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWA 302
           LCDFG +      +A+T           +V T+  Y SPE I  ++Y       K D+W+
Sbjct: 347 LCDFGVSKKLINSIADT-----------FVGTST-YMSPERIQGNVYSI-----KGDVWS 389

Query: 303 LGIFLYKLLFYTTPFELTGQ 322
           LG+ + +L+  T  F L G 
Sbjct: 390 LGLMIIELV--TGEFPLGGH 407

>Kwal_26.7861
          Length = 955

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 83/176 (47%), Gaps = 25/176 (14%)

Query: 142 NEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLS 201
           NE+ VMK  S   NIV + DS+  R        ++ ++ME     SL D +   +   L+
Sbjct: 711 NEILVMKA-SKHANIVNFIDSYLLRG-------DLWVVMEYMEGGSLTDVVTHCI---LT 759

Query: 202 EQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANT 261
           E +I  +  +  + L  +H   V  IHRD+K +NVL+  +   KL DFG    C  +   
Sbjct: 760 EGQIGAVSRETLKGLQFLHSKGV--IHRDIKSDNVLLSMSGEIKLTDFG---FCAQINEI 814

Query: 262 HQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 317
           + +   +        TP + +PE++      P   K DIW+LGI + +++    P+
Sbjct: 815 NLKRTTMVG------TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 861

>YDR523C (SPS1) [1335] chr4 complement(1485554..1487026)
           Serine/threonine protein kinase involved in middle/late
           stage of meiosis [1473 bp, 490 aa]
          Length = 490

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 94/207 (45%), Gaps = 33/207 (15%)

Query: 178 LLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVL 237
           ++ME C   S  D + +     L E+++  I+ +VT  L  +H      IHRD+K  N+L
Sbjct: 91  IVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLH--EQRKIHRDIKAANIL 148

Query: 238 VDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPI--- 294
           ++     KL DFG +         H   + L  + +V  TP + +PE++    C  +   
Sbjct: 149 LNEEGMVKLGDFGVSG--------HIR-STLKRDTFV-GTPYWMAPEVV----CCEVDGY 194

Query: 295 NEKSDIWALGIFLYKLLFYTTPFELTGQFAILHS-------KYEFPVNNYSSKLINLIII 347
           NEK+DIW+LGI  Y+LL    P        ++ +       K + P   +S    + +  
Sbjct: 195 NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP---FSDAAKDFVAG 251

Query: 348 MLAENPNLRPNIYQVMDNLCSILKVKN 374
            L + P  RP+ Y    NL S   VKN
Sbjct: 252 CLVKTPADRPSAY----NLLSFEFVKN 274

>ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH]
           (692321..693913) [1593 bp, 530 aa]
          Length = 530

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 95/199 (47%), Gaps = 36/199 (18%)

Query: 138 NEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSL--LDYMNQR 195
           N++  E+++MK +    NIV +Y ++ +  ++     E+ +LME     SL  +    +R
Sbjct: 236 NQLMRELTIMKNVKEQKNIVGFYGAYYTAIKN----HEIIILMEYMDCGSLDKISSTYRR 291

Query: 196 LATK-----------LSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNF 244
             ++            +E  + KI + V   L+ + Y    +IHRD+K  N+L+++    
Sbjct: 292 YCSRNKVPMNASTSWFTELSLSKISYAVLNGLSYL-YQDYKIIHRDIKPSNILINSKGFV 350

Query: 245 KLCDFGSTSTCF-PVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWAL 303
           K+CDFG +      +A+T           +V T+  Y SPE I    C   N K D+W+L
Sbjct: 351 KICDFGVSKKMIDSIADT-----------FVGTS-TYMSPERIQ-GSCY--NTKGDVWSL 395

Query: 304 GIFLYKLLFYTTPFELTGQ 322
           G+ + +L+  T  F L G 
Sbjct: 396 GLMIIELV--TGEFPLGGH 412

>Scas_502.2
          Length = 1116

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 90/190 (47%), Gaps = 15/190 (7%)

Query: 178 LLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVL 237
            L+E  PN  LL  M +     L+E+        +  A+  MH   +  IHRD+K EN+L
Sbjct: 250 FLLEYAPNGDLLSLMKK--FGSLNEECCCYYGAQIIDAIKFMHSKGI--IHRDIKPENIL 305

Query: 238 VDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMI-DLYRCLPINE 296
           +D +   K+ DFG T+             +LT +     T +Y SPE++ D Y     + 
Sbjct: 306 LDKDMKVKITDFG-TAKILDNKPPGTSYDLLTRSKSFVGTAEYVSPELLNDNY----TDA 360

Query: 297 KSDIWALGIFLYKLLFYTTPFELTGQF----AILHSKYEFPVNNYSSKLINLIIIMLAEN 352
           +SDIWA G  +++++    PF+ T ++     ++  +Y F    + + + +L+  +L + 
Sbjct: 361 RSDIWAFGCIVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTA-GFPTVVRDLVKRILIKA 419

Query: 353 PNLRPNIYQV 362
           P  R  I  +
Sbjct: 420 PEQRLTIEAI 429

>CAGL0M03729g complement(420316..422901) similar to sp|P48562
           Saccharomyces cerevisiae YNL298w CLA4, start by
           similarity
          Length = 861

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 96/203 (47%), Gaps = 26/203 (12%)

Query: 120 VGDLACLKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLL 179
           +GD   +K+++++ +     + NE+ VM   S   NIV + +++     D      + ++
Sbjct: 606 IGDKVAIKQMVLSKQPRKELIVNEIMVMND-SRHENIVNFLEAYLKTEDD------LWVV 658

Query: 180 MELCPNNSLLDYM-----NQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIE 234
           ME     SL D +     N    + LSE +I  I+ +  + L  +H   +  IHRD+K +
Sbjct: 659 MEYMEGGSLTDIIENSPTNGSAYSPLSEPQIAYIVRETCKGLKFLHDKNI--IHRDIKSD 716

Query: 235 NVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPI 294
           NVL+D     K+ DFG    C  + +   + A +        TP + +PE++   +    
Sbjct: 717 NVLLDTKARVKITDFG---FCAKLTDQRSKRATMVG------TPYWMAPEVV---KQKEY 764

Query: 295 NEKSDIWALGIFLYKLLFYTTPF 317
           + K D+W+LGI   ++L    P+
Sbjct: 765 DAKVDVWSLGIMAIEMLEGEPPY 787

>KLLA0C16577g complement(1451181..1452695) some similarities with
           sp|P06784 Saccharomyces cerevisiae YDL159w STE7
           ser/thr/tyr protein kinase of MAP kinase kinase family,
           hypothetical start
          Length = 504

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 89/186 (47%), Gaps = 32/186 (17%)

Query: 138 NEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYM----- 192
           N++  E+++MK +S   NIV +Y +      + S+  E+ +LME     SL   +     
Sbjct: 207 NQLVRELTIMKNVSAHDNIVGFYGAFY----NPSTTNEIVILMEYMDCGSLDKILSVYRS 262

Query: 193 -----NQRLATKLS---EQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNF 244
                N  ++ K S   E  + +I F V   L  + Y    +IHRD+K  N+L+++  + 
Sbjct: 263 DCHRKNVSISCKTSWFNEMPLSRISFCVLNGLIYL-YDCYKIIHRDIKPSNILINSKGDV 321

Query: 245 KLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 304
           K+CDFG ++T   + N+  +  V         T  Y SPE I   R      K D+W+LG
Sbjct: 322 KICDFGVSTT---LINSLADTFV--------GTSTYMSPERIQGGR---YTTKGDVWSLG 367

Query: 305 IFLYKL 310
           + + +L
Sbjct: 368 LMIIEL 373

>Scas_668.22
          Length = 893

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 85/176 (48%), Gaps = 25/176 (14%)

Query: 142 NEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLS 201
           NE+ VMK  S  PNIV + DS+     DG    ++ ++ME     SL D +   +   L+
Sbjct: 655 NEILVMKG-SRHPNIVNFIDSYL---LDG----DLWVIMEYMEGGSLTDVVTHCI---LT 703

Query: 202 EQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANT 261
           E +I  +  +    L  +H   V  +HRD+K +N+L+  + + KL DFG    C  +   
Sbjct: 704 EGQIGAVCRETLSGLQFLHSKGV--LHRDIKSDNILLSISGDIKLTDFG---FCAQINEI 758

Query: 262 HQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 317
           + +   +        TP + +PE++      P   K DIW+LGI + +++    P+
Sbjct: 759 NLKRTTMVG------TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 805

>Scas_711.25
          Length = 1515

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 62/262 (23%), Positives = 113/262 (43%), Gaps = 58/262 (22%)

Query: 90   LAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNE--------MR 141
            + +G F  +Y+               + +  G++  +K+V V   +  +E        +R
Sbjct: 1220 IGKGSFGAVYLC--------------LNVTTGEMMAVKQVEVPKYSSQDEAIISTVEALR 1265

Query: 142  NEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFE-----VTLLMELCPNNSLLDYMNQRL 196
            +EVS +K L    NIVQY             GFE      +L +E     S+   +  R+
Sbjct: 1266 SEVSTLKDLDHL-NIVQYL------------GFENKDNIYSLFLEYVAGGSVGSLI--RM 1310

Query: 197  ATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCF 256
              +  E  I  +   V R LA +H   +  +HRD+K +N+L+D +   K+ DFG      
Sbjct: 1311 YGRFDEPLIRHLNTQVLRGLAYLHSRGI--LHRDMKADNLLLDQDGVCKISDFG------ 1362

Query: 257  PVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 316
             ++   ++I    +++ +  T  + +PEM+D  +    + K DIW+LG  + ++     P
Sbjct: 1363 -ISRKSKDIYS-NSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRP 1418

Query: 317  FE----LTGQFAILHSKYEFPV 334
            +     +   F I  SK   P+
Sbjct: 1419 WSNYEVVAAMFKIGKSKSAPPI 1440

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/268 (25%), Positives = 110/268 (41%), Gaps = 70/268 (26%)

Query: 90   LAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLV--------TDENGLNEMR 141
            + +G F  +Y+               + +  G++  +K+V V        T  N    + 
Sbjct: 1130 IGKGSFGAVYL--------------GLNVTTGEMMAVKQVEVPKFGSQDETTVNNAEALI 1175

Query: 142  NEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFE-----VTLLMELCPNNSLLDYMNQRL 196
            +EVS +K L    NIVQY             GFE      +L +E     S+   +  RL
Sbjct: 1176 SEVSTLKDLDHL-NIVQYL------------GFENKNCIYSLFLEYVAGGSVGSLI--RL 1220

Query: 197  ATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCF 256
                 EQ I  +   V   LA +H   +  +HRD+K +N+L+D +   K+ DFG      
Sbjct: 1221 YGHFDEQLIRFLTTQVLEGLAYLHLRGI--LHRDMKADNLLLDNDGVCKISDFG------ 1272

Query: 257  PVANTHQEIAVLTNNIYVHT------TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 310
                    I+  +NNIY ++      T  + +PEM+D  +    + K DIW+LG  + ++
Sbjct: 1273 --------ISRKSNNIYSNSEMTMRGTVFWMAPEMVDTTQGY--SAKVDIWSLGCVVLEM 1322

Query: 311  LFYTTPFE----LTGQFAILHSKYEFPV 334
                 P+     +   F I  SK   P+
Sbjct: 1323 FAGKRPWSNLEVVAAMFQIGKSKSAPPI 1350

>ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) -
           SH] complement(994583..997204) [2622 bp, 873 aa]
          Length = 873

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 81/292 (27%), Positives = 123/292 (42%), Gaps = 44/292 (15%)

Query: 76  QVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTI-KLEVGDLACLKRVLVTDE 134
           + +VG    E ++ L +G    +Y+VR  + ++ L  +    K E+     +KR+L   E
Sbjct: 453 EAVVGPQSFEKIRLLGQGDVGKVYLVR-EKKSDRLYALKIFGKAEMIKRKKIKRILAEQE 511

Query: 135 NGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQ 194
                       +   S  P IV  Y  H+ +  D      + L ME C        +  
Sbjct: 512 ------------ILATSNHPFIVTLY--HSFQTED-----YLYLCMEYCMGGEFFRALQT 552

Query: 195 RLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFG---- 250
           R    +SE +      +VT AL  +H +    I+RD+K EN+L+  + +  L DF     
Sbjct: 553 RKTKCISEDDARFYASEVTAALEYLHLMG--FIYRDLKPENILLHQSGHVMLSDFDLSVQ 610

Query: 251 STSTCFP-VANTHQEIAVLT--------NNIYVHTTPQYRSPEMIDLYRCLPINEKSDIW 301
           +  T  P V    Q   V T         N +V T  +Y +PE+I   R        D W
Sbjct: 611 AKGTRNPQVKGNAQSSLVDTKVCSDGFRTNSFVGTE-EYIAPEVI---RGNGHTASVDWW 666

Query: 302 ALGIFLYKLLFYTTPFEL--TGQ-FA-ILHSKYEFPVNNYSSKLINLIIIML 349
            LGI  Y++LF  TPF+   T Q F+ IL +   FP NN  S+    +I  L
Sbjct: 667 TLGILTYEMLFGFTPFKGDNTNQTFSNILKNDVYFPNNNDISRTCKDLIKKL 718

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 83/176 (47%), Gaps = 25/176 (14%)

Query: 142 NEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLS 201
           NE+ VMK  S  PNIV + DS+  +        ++ ++ME     SL D +   +   L+
Sbjct: 664 NEILVMKG-SKHPNIVNFIDSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LT 712

Query: 202 EQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANT 261
           E +I  +  +    L  +H   V  +HRD+K +N+L+    + KL DFG    C  +   
Sbjct: 713 EGQIGAVCRETLSGLEFLHSKGV--LHRDIKSDNILLSMEGDIKLTDFG---FCAQINEL 767

Query: 262 HQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 317
           + +   +        TP + +PE++      P   K DIW+LGI + +++    P+
Sbjct: 768 NLKRTTMVG------TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 814

>CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces
           cerevisiae YDL159w STE7 ser/thr/tyr protein kinase of
           MAP kinase kinase family, hypothetical start
          Length = 451

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 64/223 (28%), Positives = 105/223 (47%), Gaps = 51/223 (22%)

Query: 127 KRVLVTDENGL---NEMRNEVSVMKQLSGCPNIVQYYDSH--ASRARDGSSGFEVTLLME 181
           K+ +V ++N      ++  E+++M+ ++   NIV++Y +H  +S + +GS+  +V +LME
Sbjct: 132 KKTIVIEQNNAIVKQQIYRELTIMRSVAEHRNIVEFYGAHNLSSDSINGSN--DVVILME 189

Query: 182 LCPNNSLLDYMNQRLATKLSEQEIL-------------------KIMFDVTRALAQMHYL 222
              N   LD +  R    L  + IL                   +I + V   L+ + Y 
Sbjct: 190 YM-NCGSLDTIT-RTYKSLQRRGILAANRSYPVQEWFSKPVIISRIAYSVLNGLSYL-YE 246

Query: 223 PVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNI---YVHTTPQ 279
              +IHRD+K  NVL+++    KLCDFG +               L N+I   +V T+  
Sbjct: 247 NYKIIHRDIKPSNVLINSKGRIKLCDFGVSRK-------------LNNSIADTFVGTST- 292

Query: 280 YRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQ 322
           Y SPE I   +      K D+W+LG+ L +LL  T  F L G 
Sbjct: 293 YMSPERIQGNK---YTTKGDVWSLGLMLIELL--TGEFPLGGH 330

>CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces
           cerevisiae YDR122w KIN1 or sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2, hypothetical start
          Length = 944

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 89/192 (46%), Gaps = 21/192 (10%)

Query: 178 LLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVL 237
           +  E      LLDY+ Q  +  L E    K+   +  AL  +H     ++HRD+KIEN++
Sbjct: 168 MFFEFISGGQLLDYIIQHGS--LKENHARKVSRGILSALQYLH--ANNIVHRDLKIENIM 223

Query: 238 VDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEK 297
           +      KL DFG ++   P     + +     ++Y      + +PE++  +  L    +
Sbjct: 224 LSKTGEIKLIDFGLSNMYDP----RKSLQTFCGSLY------FAAPELLKAHPYL--GPE 271

Query: 298 SDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEFPVNNY----SSKLINLIIIMLAENP 353
            D+W+ G+ LY L+    PF+     A LH K +     Y    S  +I+L+  +L  +P
Sbjct: 272 VDVWSFGVVLYVLVCGKVPFDDENSSA-LHEKIKKGKVTYPQFLSIDVISLLSKILVVDP 330

Query: 354 NLRPNIYQVMDN 365
             R  + QV+++
Sbjct: 331 QKRATLQQVVNH 342

>Kwal_47.16761
          Length = 744

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 67/311 (21%), Positives = 132/311 (42%), Gaps = 51/311 (16%)

Query: 57  LNSSRSGTLPVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTI 116
           +  S +G + V    K   +   G    E+++ L +G F  +Y VR      + +++  +
Sbjct: 307 VGESVTGHISVKWDFKATMKQHYGPQDFEVLRLLGKGTFGQVYQVR----KKDTKRIYAM 362

Query: 117 KLEVGDLACLKRVLVTDENGLNEMRNEVSVMKQLSG--CPNIVQYYDSHASRARDGSSGF 174
           K+       L + ++  +N +     E +++ + +   CP IV    S  + A       
Sbjct: 363 KV-------LSKKVIVKKNEIAHTIGERNILVRTASKSCPFIVGLKFSFQTPA------- 408

Query: 175 EVTLLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIE 234
           ++ L+ +      L  ++ +    + +E      + ++  AL  +H     +++RD+K E
Sbjct: 409 DLYLVTDFMSGGELFWHLQKE--GRFAEDRARFYIAELVLALEYLH--ENDIVYRDLKPE 464

Query: 235 NVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPI 294
           N+L+DAN N  LCDFG +           ++   TN      T +Y +PE+  L      
Sbjct: 465 NILLDANGNIALCDFGLSKA---------DLKDRTNTFC--GTTEYLAPEL--LLDESGY 511

Query: 295 NEKSDIWALGIFLYKLLFYTTPFELTGQFA---------ILHSKYEFPVNNYSSKLINLI 345
            +  D W+LG+ ++++    +PF     FA         I   K +FP +  S +  + +
Sbjct: 512 TKMVDFWSLGVLIFEMCCGWSPF-----FAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFV 566

Query: 346 IIMLAENPNLR 356
             +L  NP  R
Sbjct: 567 KGLLNRNPRHR 577

>AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH]
           (1769897..1771219) [1323 bp, 440 aa]
          Length = 440

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 67/286 (23%), Positives = 126/286 (44%), Gaps = 44/286 (15%)

Query: 85  EIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNEMRNEV 144
           EI++ +  G F  +Y  R +  +NE+  +  + LE            TDE  ++ +  E+
Sbjct: 21  EILQCIGRGNFGDVYKARDLT-SNEIVAIKVVNLED-----------TDE-PIDLLAQEI 67

Query: 145 SVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQE 204
             + +L   P I  Y  +             + ++ME C   S  + +      K++E++
Sbjct: 68  FFLSELRS-PYITNYKTAFLVDV-------SMWIVMEYCGGGSCAELLKYTPEHKVTEEQ 119

Query: 205 ILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQE 264
              I+ +V   L  +H      IHRD+K  N+L+  N + KL DFG +          Q 
Sbjct: 120 CAFIVSEVLIGLDYLH--SQRKIHRDIKSANILLTDNGHVKLGDFGVSG---------QM 168

Query: 265 IAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFA 324
           +     + +V  TP + +PE+ID  +    NE +DIW+LGI + +LL    P +   ++ 
Sbjct: 169 MVTRKRDTFV-GTPFWMAPEVIDRNK-QGYNEMADIWSLGITVIELLMGHPPLD---KYD 223

Query: 325 ILHSKYEFPVNN-------YSSKLINLIIIMLAENPNLRPNIYQVM 363
            + +    P  +       +SS   + +   L ++P+ RP   +++
Sbjct: 224 AMKALMAIPKRDPPKLDKRFSSHARDFVAQCLIKDPSQRPTAAELL 269

>KLLA0B13112g complement(1146006..1148198) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, start by similarity
          Length = 730

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 84/181 (46%), Gaps = 21/181 (11%)

Query: 137 LNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRL 196
           ++ +++E++++K+L    NIV YY S          G  + + +E  P  S+   +N   
Sbjct: 512 IDALQHEMNILKELH-HENIVTYYGS-------SQEGGNLNIFLEYVPGGSVSSMLNNY- 562

Query: 197 ATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCF 256
                E  +      +   LA +H   +  IHRD+K  N+L+D     K+ DFG +    
Sbjct: 563 -GPFDEPLVKNFTRQILIGLAYLHKRNI--IHRDIKGANILIDIKGGVKITDFGISKKLS 619

Query: 257 PVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 316
           P+     + A L  ++Y      + +PE++   + +   EK+DIW++G  + ++     P
Sbjct: 620 PLNKQQNKRASLQGSVY------WMAPEVV---KQVVTTEKADIWSVGCVIVEMFTGKHP 670

Query: 317 F 317
           F
Sbjct: 671 F 671

>YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase,
           required for metaphase DNA-damage checkpoint [1584 bp,
           527 aa]
          Length = 527

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 93/186 (50%), Gaps = 27/186 (14%)

Query: 139 EMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLAT 198
           ++  EV +  + S  PN+++  D + S+         + +++E+     L D +   +  
Sbjct: 61  DITKEVVLQSKCSKHPNVLRLIDCNVSKEY-------MWIILEMADGGDLFDKIEPDVGV 113

Query: 199 KLSEQEILKIMFDVTRALAQMHYLPVP--LIHRDVKIENVLVDANHNFKLCDFGSTSTCF 256
              + ++ +  F   + ++ ++YL V   + HRD+K EN+L+D N N KL DFG  S   
Sbjct: 114 ---DSDVAQFYFQ--QLVSAINYLHVECGVAHRDIKPENILLDKNGNLKLADFGLAS--- 165

Query: 257 PVANTHQEIAVLTNNIYVHTTPQYRSPEMI---DLYRCLPINEKSDIWALGIFLYKLLFY 313
                 ++   L  ++    +P Y +PE++   + Y      +++DIW++GI L+ LL  
Sbjct: 166 ---QFRRKDGTLRVSMDQRGSPPYMAPEVLYSEEGYYA----DRTDIWSIGILLFVLLTG 218

Query: 314 TTPFEL 319
            TP+EL
Sbjct: 219 QTPWEL 224

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 94/205 (45%), Gaps = 26/205 (12%)

Query: 143 EVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATK--- 199
           E+ VMK+     N+V+ Y+       +     +V L++E C    +      ++  K   
Sbjct: 104 EIEVMKRCHH-ENVVELYE-----ILNDPESTKVYLVLEYCSRGPVKWCPENKMEIKAVG 157

Query: 200 ---LSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFG---STS 253
              L+ Q+  K++ DV   L  +H   +   HRD+K  N+L+ +N   K+ DFG   ST+
Sbjct: 158 PSILTFQQSRKVVLDVVSGLEYLHSQGI--THRDIKPSNLLISSNGTVKISDFGVAMSTA 215

Query: 254 TCFP-VANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLF 312
           T    + ++H+++           TP + +PE+    +    +   DIW+LG+ +Y LLF
Sbjct: 216 TGSTNIQSSHEQLL----KSRALGTPAFFAPELCSTEKEYSCSSAIDIWSLGVTIYCLLF 271

Query: 313 YTTPFELTGQF----AILHSKYEFP 333
              PF          +I++   EFP
Sbjct: 272 GKLPFNANSGLELFDSIINKPLEFP 296

>YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capable
           of suppressing DNA polymerase alpha mutations [3429 bp,
           1142 aa]
          Length = 1142

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 68/281 (24%), Positives = 121/281 (43%), Gaps = 45/281 (16%)

Query: 85  EIVKYLAEGGFAHIYVVRFIEYANELEQVPTI----KLEVGDLACLKRVLVTDENGLNEM 140
           EI+K L  G    + + R I  + +L  +  +    K +      +K   +++ +   ++
Sbjct: 134 EIIKELGHGQHGKVKLARDI-LSKQLVAIKIVDRHEKKQRKFFTFIKSSKISEND---KI 189

Query: 141 RNEVSVMKQL--SGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLL----DYM-- 192
           + E+++MK+        +++  D   SR        ++ L++E C    +     D M  
Sbjct: 190 KREIAIMKKCHHKHVVQLIEVLDDLKSR--------KIYLVLEYCSRGEVKWCPPDCMES 241

Query: 193 NQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFG-S 251
           + +  + LS QE  +I+  V   L  +HY  +  IHRD+K  N+L+  +   K+ DFG S
Sbjct: 242 DAKGPSLLSFQETREILRGVVLGLEYLHYQGI--IHRDIKPANLLISGDGTVKISDFGVS 299

Query: 252 TSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMI--------------DLYRCLPINEK 297
            +     ++   E            TP + +PEM               +L+R   I+  
Sbjct: 300 LAASSTNSSDSSESLDELELAKTVGTPAFFAPEMCLGEDAFTRYNLTKENLFRGSCISFM 359

Query: 298 SDIWALGIFLYKLLFYTTP----FELTGQFAILHSKYEFPV 334
            DIWA+G+ LY LLF   P    FEL     I++   +FP 
Sbjct: 360 IDIWAVGVTLYCLLFGMLPFFSDFELKLFEKIVNDPLKFPT 400

>YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protein
           kinase involved in septin organization and cell cycle
           control [3114 bp, 1037 aa]
          Length = 1037

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 110/250 (44%), Gaps = 42/250 (16%)

Query: 140 MRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATK 199
           +  E+ +MK LS  PN++  YD   +          + L++E      L + +       
Sbjct: 74  IEREIVIMKLLS-HPNVLSLYDVWETNNN-------LYLILEYAEKGELFNLLVDH--GP 123

Query: 200 LSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVA 259
           L E+E +     +   ++  H L +  +HRD+K EN+L+D+ +N K+ DFG       +A
Sbjct: 124 LPEREAINCFRQIIIGISYCHALGI--VHRDLKPENLLLDSFYNIKIADFG-------MA 174

Query: 260 NTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINE-KSDIWALGIFLYKLLFYTTPF- 317
               +  +L  +     +P Y +PE++     LP     SD+W+ G+ L+ LL    PF 
Sbjct: 175 ALQTDADLLETSC---GSPHYAAPEIVS---GLPYEGFASDVWSCGVILFALLTGRLPFD 228

Query: 318 ELTGQ-----FAILHSKYEFPVNNYSSK-LINLIIIMLAENPNLRPNIYQVMDNLCSILK 371
           E  G        +   ++E P +   S+   +LI  +L  +P  R  I  ++        
Sbjct: 229 EENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDIL-------- 280

Query: 372 VKNPLEDKYQ 381
             +PL  KYQ
Sbjct: 281 -SHPLLKKYQ 289

>YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase
           kinase kinase essential for late nuclear division [2925
           bp, 974 aa]
          Length = 974

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 123/246 (50%), Gaps = 33/246 (13%)

Query: 123 LACLKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMEL 182
           +  +K V+  ++  LN++  E+S++K L+   NIV+Y   H    +     +E+ +L+E 
Sbjct: 50  VVAIKEVVYENDEELNDIMAEISLLKNLNH-NNIVKY---HGFIRK----SYELYILLEY 101

Query: 183 CPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYL-PVPLIHRDVKIENVLVDAN 241
           C N SL   ++ R +T LSE E       VT+ L  + YL    +IHRD+K  N+L+ A+
Sbjct: 102 CANGSLRRLIS-RSSTGLSENESKTY---VTQTLLGLKYLHGEGVIHRDIKAANILLSAD 157

Query: 242 HNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIW 301
           +  KL DFG ++             V ++ + +  T  + +PE++       +   SDIW
Sbjct: 158 NTVKLADFGVSTI------------VNSSALTLAGTLNWMAPEILGNRGASTL---SDIW 202

Query: 302 ALGIFLYKLLFYTTPFE-LTGQ---FAILHSKYEFPVNNYSSKLINLIIIMLAENPNLRP 357
           +LG  + ++L    P+  LT     +A+ +  Y +P +++S  L + +     +N   RP
Sbjct: 203 SLGATVVEMLTKNPPYHNLTDANIYYAVENDTY-YPPSSFSEPLKDFLSKCFVKNMYKRP 261

Query: 358 NIYQVM 363
              Q++
Sbjct: 262 TADQLL 267

>YPL209C (IPL1) [5240] chr16 complement(156489..157592)
           Serine/threonine protein kinase of the mitotic spindle,
           involved in chromosome segregation and activation of the
           spindle checkpoint by detection of kinetochore tension,
           required for proper spindle disassembly and orientation
           [1104 bp, 367 aa]
          Length = 367

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 85/198 (42%), Gaps = 29/198 (14%)

Query: 125 CLKRVLVTDE----NGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLM 180
           C  +V+  +E    N   + R EV +   L+  PN+ + Y       R       V LLM
Sbjct: 130 CALKVMEKEEIIKYNLQKQFRREVEIQTSLNH-PNLTKSYGYFHDEKR-------VYLLM 181

Query: 181 ELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDA 240
           E   N  +  Y   RL    ++      ++ +  AL  MH   +  IHRD+K EN+L+  
Sbjct: 182 EYLVNGEM--YKLLRLHGPFNDILASDYIYQIANALDYMHKKNI--IHRDIKPENILIGF 237

Query: 241 NHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDI 300
           N+  KL DFG  S   P  N  + +           T  Y SPEM++       +   D 
Sbjct: 238 NNVIKLTDFG-WSIINPPENRRKTVC---------GTIDYLSPEMVE---SREYDHTIDA 284

Query: 301 WALGIFLYKLLFYTTPFE 318
           WALG+  ++LL    PFE
Sbjct: 285 WALGVLAFELLTGAPPFE 302

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 64/271 (23%), Positives = 115/271 (42%), Gaps = 60/271 (22%)

Query: 90   LAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNEM--------R 141
            + +G F  +Y+              ++ +  G++  +K+V V      NE+        +
Sbjct: 1157 IGKGSFGAVYL--------------SLNITTGEMMAVKQVEVPKYGTQNELVKDMVEALK 1202

Query: 142  NEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLS 201
            +EV+ +K L    NIVQY  S          G   +L +E     S+   +  RL  +  
Sbjct: 1203 SEVATLKDLDHL-NIVQYLGSEIR-------GNIYSLFLEYVAGGSVGSLI--RLYGRFD 1252

Query: 202  EQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANT 261
            E+ I  +   V   L  +H   +  +HRD+K +N+L+D +   K+ DFG           
Sbjct: 1253 EKLIRHLNTQVLSGLKYLHSKGI--LHRDMKADNLLLDEDGICKISDFG----------- 1299

Query: 262  HQEIAVLTNNIYVHT------TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTT 315
               I+  + NIY ++      T  + +PEM+D  +    + K DIW+LG  + ++     
Sbjct: 1300 ---ISKKSKNIYSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKR 1354

Query: 316  PFE----LTGQFAILHSKYEFPVNNYSSKLI 342
            P+     +   F I  SK   P+ + + +LI
Sbjct: 1355 PWSNLEVVAAMFQIGKSKSAPPIPDDTIQLI 1385

>CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces
           cerevisiae YGR052w, hypothetical start
          Length = 355

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 92/211 (43%), Gaps = 32/211 (15%)

Query: 119 EVGDLACLKRVLVTDENGLNEMRNEVSVMKQLS---GCPNIVQYYDSHASRARDGSSGFE 175
           E  D   LK V+   +     M NE +V K LS   GCP I  + D +            
Sbjct: 29  ETDDFVALK-VIPKSKFSQRGMANEYNVGKLLSKDEGCPFICSFVDFYEDET-------N 80

Query: 176 VTLLMELCPNNSLLDYMN-QRLATKLSEQEILKIMFD-----VTRALAQMHYLPVPLIHR 229
            TL+ E C      D++   +    L+   I+K+ F      ++ A+   H + +   HR
Sbjct: 81  YTLVQEYCECGDFYDFLELSKKKGDLNAPSIIKLNFQKVVLQLSYAIKYAHSMGIA--HR 138

Query: 230 DVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLY 289
           D+K EN+L++ + + KL D+G   +    A++  +     NNI    T  YR PE     
Sbjct: 139 DIKPENILINYHGDIKLADWGHAIS----ASSSND-----NNI---GTDNYRGPETFSA- 185

Query: 290 RCLPINEKSDIWALGIFLYKLLFYTTPFELT 320
           +      +SD W++G+ L  LLF   PF  +
Sbjct: 186 KVSYNTYRSDYWSMGVTLLYLLFSHCPFRCS 216

>YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinase
            kinase kinase (MAPKKK) involved in the high-osmolarity
            signal transduction pathway [4740 bp, 1579 aa]
          Length = 1579

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/313 (21%), Positives = 130/313 (41%), Gaps = 68/313 (21%)

Query: 89   YLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNEM----RNEV 144
            ++  G F  +Y                + L+ G++  +K + + D   + ++    + E+
Sbjct: 1271 FIGGGTFGRVY--------------SAVDLDNGEILAVKEINIQDSKSMQKIFPLIKEEM 1316

Query: 145  SVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQE 204
            SV++ L+  PNIV YY     R +       V + ME C   SL   +      ++ ++ 
Sbjct: 1317 SVLEILNH-PNIVSYYGVEVHRDK-------VNIFMEYCEGGSLAALLEH---GRIEDEM 1365

Query: 205  ILKI-MFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQ 263
            + ++    +   LA +H     ++HRDVK EN+L+D N   K  DFG+      +AN   
Sbjct: 1366 VTQVYTLQLLEGLAYLH--ESGIVHRDVKPENILLDFNGVIKYVDFGAAK---KIANNGT 1420

Query: 264  EIAVLT----------------------NN----IYVHTTPQYRSPEMIDLYRCLPINEK 297
             +A +                       NN    + +  TP Y +PE I           
Sbjct: 1421 RLASMNKIENADGEHEDVTHVSDSKAVKNNENALLDMMGTPMYMAPESITGSTTKGKLGA 1480

Query: 298  SDIWALGIFLYKLLFYTTPF-ELTGQFAILHSKY-----EFPVNN-YSSKLINLIIIMLA 350
             D+W+LG  + +++    P+  L  ++AI++        +FP  +  SS  +  +   L 
Sbjct: 1481 DDVWSLGCVVLEMITGRRPWANLDNEWAIMYHVAAGHTPQFPTKDEVSSAGMKFLERCLI 1540

Query: 351  ENPNLRPNIYQVM 363
            +NP+ R +  +++
Sbjct: 1541 QNPSKRASAVELL 1553

>CAGL0K02167g complement(191468..194956) similar to sp|P38990
           Saccharomyces cerevisiae YER129w
           Serine/threonine-protein kinase, start by similarity
          Length = 1162

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/271 (25%), Positives = 118/271 (43%), Gaps = 52/271 (19%)

Query: 138 NEMRNEVSVMKQL--SGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQR 195
           ++++ E+++MK+        +++  D   SR        ++ L++E C    +       
Sbjct: 194 DKIKREIAIMKKCHHKHVVKLIEVLDDLKSR--------KIYLVLEYCSRGEVKWCPPDC 245

Query: 196 LATK------LSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDF 249
           L T+      LS Q   +I+  V   L  +HY  +  IHRD+K  N+L+      K+ DF
Sbjct: 246 LETEAKGPSPLSFQFTREILRGVVLGLEYLHYQGI--IHRDIKPANLLLSETGIVKISDF 303

Query: 250 G-----STSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMI--------------DLYR 290
           G     S+S       T  E+ +         TP + +PE+               +L++
Sbjct: 304 GVSLAASSSNVDGSDETIDELELAK----TAGTPAFFAPEICLGEDAFEKYQLDREELFK 359

Query: 291 CLPINEKSDIWALGIFLYKLLF----YTTPFELTGQFAILHSKYEFPVNNYSSKLINLII 346
              I+ K DIWALG+ LY L+F    + + FEL     I++   +FP   YS  L N  +
Sbjct: 360 GSCISFKIDIWALGVTLYCLVFGMLPFVSSFELELFEKIVNDPVKFP--KYSDMLKNNQV 417

Query: 347 IMLAENPNLRPNIYQVMDNLCSILKVKNPLE 377
           + + E        Y+   +L + L  KNP++
Sbjct: 418 LQMTEEAE-----YEAAKDLLTRLLEKNPIK 443

>Scas_493.2
          Length = 1117

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 113/249 (45%), Gaps = 42/249 (16%)

Query: 140 MRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATK 199
           +  E+ +MK L    N++  YD   + +        + +++E      L + + ++    
Sbjct: 81  IEREIIIMKLLRHA-NVLSLYDVWETNS-------NLYMILEYAEKGELFNLLVEK--GP 130

Query: 200 LSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVA 259
           L E+E ++    +   ++  H L +  +HRD+K EN+L+D   N K+ DFG       +A
Sbjct: 131 LPEKEAVRFFRQIIIGISYCHALGI--VHRDLKPENLLLDHKFNIKIADFG-------MA 181

Query: 260 NTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINE-KSDIWALGIFLYKLLFYTTPF- 317
               E  +L  +     +P Y +PE++     +P +  +SD+W+ G+ L+ LL    PF 
Sbjct: 182 ALETEDKLLETSC---GSPHYAAPEIVS---GIPYHGFESDVWSCGVILFALLTGRLPFD 235

Query: 318 ELTGQ-----FAILHSKYEFPVNNYSSK-LINLIIIMLAENPNLRPNIYQVMDNLCSILK 371
           E  G        +   ++E P ++  S+   +LI  +L  +P  R    +++        
Sbjct: 236 EEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREIL-------- 287

Query: 372 VKNPLEDKY 380
            K+PL  KY
Sbjct: 288 -KHPLLQKY 295

>Sklu_1995.2 YLR362W, Contig c1995 1578-3767
          Length = 729

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 84/181 (46%), Gaps = 21/181 (11%)

Query: 137 LNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRL 196
           ++ +++E++++K+L    NIV YY S          G  + + +E  P  S+   +N   
Sbjct: 510 IDALQHEMNLLKELHH-ENIVTYYGS-------SQEGGNLNIFLEYVPGGSVSSMLNNY- 560

Query: 197 ATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCF 256
                E  I      +   LA +H   +  IHRD+K  NVL+D     K+ DFG +    
Sbjct: 561 -GPFEEPLIKNFTRQILIGLAYLHRKNI--IHRDIKGANVLIDIKGCVKITDFGISKKLS 617

Query: 257 PVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 316
           P+     + A L  ++Y      + +PE++   + +   EK+DIW++G  + ++     P
Sbjct: 618 PLNKQQNKRASLQGSVY------WMAPEVV---KQVVTTEKADIWSVGCLVVEMFTGKHP 668

Query: 317 F 317
           F
Sbjct: 669 F 669

>YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine
           protein kinase related to Kin1p and Kin2p, catalytic
           domain is highly related to Snf1p [2403 bp, 800 aa]
          Length = 800

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 70/143 (48%), Gaps = 14/143 (9%)

Query: 176 VTLLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIEN 235
           + +++E         Y+ ++   +L E    ++   +   +  MHY    L+HRD+K+EN
Sbjct: 125 IGIVLEFVSGGEFYKYIQRK--RRLKESSACRLFAQLISGVNYMHY--KGLVHRDLKLEN 180

Query: 236 VLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPIN 295
           +L+D + N  + DFG  +  F      ++  ++  +     +P Y +PE++   +     
Sbjct: 181 LLLDKHENLVITDFGFVNEFF------EDNELMKTSC---GSPCYAAPELVVSTKAYEA- 230

Query: 296 EKSDIWALGIFLYKLLFYTTPFE 318
            K+D+W+ G+ LY +L    P++
Sbjct: 231 RKADVWSCGVILYAMLAGYLPWD 253

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 66/311 (21%), Positives = 132/311 (42%), Gaps = 51/311 (16%)

Query: 57  LNSSRSGTLPVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTI 116
           +  S SG + V  +     +   G    E+++ L +G F  +Y VR      + +++  +
Sbjct: 277 VGESVSGEILVRWEYWHTEKRHYGPQDFEVLRLLGKGTFGQVYQVR----KKDTKRIYAM 332

Query: 117 KLEVGDLACLKRVLVTDENGLNEMRNEVSVMKQLSG--CPNIVQYYDSHASRARDGSSGF 174
           K+       L + ++  +N +     E +++ + +   CP IV    S  +         
Sbjct: 333 KV-------LSKKVIVKKNEIAHTIGERNILVRTASKSCPFIVGLKFSFQTPT------- 378

Query: 175 EVTLLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIE 234
           ++ L+ +      L  ++ +    + +E+     + ++  AL  +H     +++RD+K E
Sbjct: 379 DLYLVTDFLSGGELFWHLQKE--GRFTEERAKFYIAELVLALEYLH--DNDIVYRDLKPE 434

Query: 235 NVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPI 294
           N+L+DAN N  LCDFG +           ++   TN      T +Y +PE+  L      
Sbjct: 435 NILLDANGNIALCDFGLSKA---------DLKDRTNTFC--GTTEYLAPEL--LLDETGY 481

Query: 295 NEKSDIWALGIFLYKLLFYTTPFELTGQFA---------ILHSKYEFPVNNYSSKLINLI 345
            +  D W+LG+ ++++    +PF     FA         I   K +FP +  S +  + +
Sbjct: 482 TKMVDFWSLGVLIFEMCCGWSPF-----FAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFV 536

Query: 346 IIMLAENPNLR 356
             +L  NP  R
Sbjct: 537 KGLLNRNPKHR 547

>YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3
           subfamily of protein kinases, required for induction of
           IME2 by Ime1p [1113 bp, 370 aa]
          Length = 370

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 94/202 (46%), Gaps = 26/202 (12%)

Query: 115 TIKLEVGDLACLKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGF 174
           T+  E  +   +K+VL  D+   N    E+ +MK LS   NI+     +    RD     
Sbjct: 56  TVIQETNEKVAIKKVL-QDKRFKNR---ELEIMKMLSHI-NIIDL--KYFFYERDSQDEI 108

Query: 175 EVTLLMELCPNN---SLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDV 231
            + L++E  P +    L  +++QR  T +S  EI   MF + ++L  +H+    + HRD+
Sbjct: 109 YLNLILEYMPQSLYQRLRHFVHQR--TPMSRLEIKYYMFQLFKSLNYLHHF-ANVCHRDI 165

Query: 232 KIENVLVD-ANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYR 290
           K +N+LVD    + KLCDFGS     P             N+    +  YR+PE+I  + 
Sbjct: 166 KPQNLLVDPETWSLKLCDFGSAKQLKPTE----------PNVSYICSRYYRAPELI--FG 213

Query: 291 CLPINEKSDIWALGIFLYKLLF 312
                 + DIW+ G  + +LL 
Sbjct: 214 ATNYTNQIDIWSSGCVMAELLL 235

>YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine
           protein kinase with unknown role [2163 bp, 720 aa]
          Length = 720

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 62/255 (24%), Positives = 111/255 (43%), Gaps = 41/255 (16%)

Query: 77  VIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKL----EVGDLACLKRVLVT 132
           + V     E ++ L +G    +Y++R      +  Q+  +K+    E+     +KRVL  
Sbjct: 317 ITVEPQSFEKIRLLGQGDVGKVYLMR----ERDTNQIFALKVLNKHEMIKRKKIKRVLTE 372

Query: 133 DENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYM 192
            E            +   S  P IV  Y  H+ + +D      + L ME C        +
Sbjct: 373 QE------------ILATSDHPFIVTLY--HSFQTKD-----YLYLCMEYCMGGEFFRAL 413

Query: 193 NQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFG-- 250
             R +  ++E++      +V  AL  +H L    I+RD+K EN+L+  + +  L DF   
Sbjct: 414 QTRKSKCIAEEDAKFYASEVVAALEYLHLLG--FIYRDLKPENILLHQSGHVMLSDFDLS 471

Query: 251 --STSTCFPVA--NTHQEIAVLTNNIYVHT---TPQYRSPEMIDLYRCLPINEKSDIWAL 303
             +T +  P    +T+ +  + ++    ++   T +Y +PE+I   R        D W L
Sbjct: 472 IQATGSKKPTMKDSTYLDTKICSDGFRTNSFVGTEEYLAPEVI---RGNGHTAAVDWWTL 528

Query: 304 GIFLYKLLFYTTPFE 318
           GI +Y++LF  TPF+
Sbjct: 529 GILIYEMLFGCTPFK 543

>Scas_651.18
          Length = 371

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 63/275 (22%), Positives = 122/275 (44%), Gaps = 49/275 (17%)

Query: 85  EIVKYLAEGGFAHIYVVRFIEYANELEQVPTIK-LEVGDLACLKRVLVTDENGLNEMRNE 143
           +I++ L  G F  ++++R    +N   +   +K L+   +  LK+V         E  N+
Sbjct: 60  QILRTLGTGSFGRVHLIR----SNHNGRFYALKVLKKHTIVKLKQV---------EHTND 106

Query: 144 VSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYM--NQRLATKLS 201
             +M  +   P +V+ + +            +V ++M+      L   +  +QR    ++
Sbjct: 107 ERLMLSVVSHPFLVRMWGTFQDFE-------QVFMIMDYIEGGELFSLLRKSQRFPNPVA 159

Query: 202 EQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANT 261
           +        +V  AL  +H + +  I+RD+K EN+L+D N + K+ DFG       +  T
Sbjct: 160 KFYAA----EVCLALEYLHSMDI--IYRDLKPENILLDKNGHIKITDFGFAKYVPDITYT 213

Query: 262 HQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTG 321
                       +  TP Y +PE++      P N+  D W+ GI +Y++L   TPF  + 
Sbjct: 214 ------------LCGTPDYIAPEVVS---TKPYNKSVDWWSFGILIYEMLAGYTPFYDSN 258

Query: 322 QFA----ILHSKYEFPVNNYSSKLINLIIIMLAEN 352
                  IL+ K +FP N +   + +L+  ++ +N
Sbjct: 259 TMKTYENILNCKLKFP-NFFHDDVKDLLSKLITKN 292

>Kwal_26.8709
          Length = 829

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 68/143 (47%), Gaps = 14/143 (9%)

Query: 176 VTLLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIEN 235
           + +++E         Y+ ++   +L E    ++   +   +  MH     L+HRD+K+EN
Sbjct: 120 IGIVLEYASGGEFYKYIQKK--RRLKEGPACRLFAQLISGVYYMHSKG--LVHRDLKLEN 175

Query: 236 VLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPIN 295
           +L+D N N  + DFG  +   P      E  ++  +     +P Y +PE++   R     
Sbjct: 176 LLLDKNENLLITDFGFVNEFLP------ENELMKTSC---GSPCYAAPELVVTARPYEA- 225

Query: 296 EKSDIWALGIFLYKLLFYTTPFE 318
            K+D+W+ G+ LY +L    P++
Sbjct: 226 RKADVWSCGVILYAMLAGYLPWD 248

>ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH]
           (1222346..1225018) [2673 bp, 890 aa]
          Length = 890

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 84/191 (43%), Gaps = 41/191 (21%)

Query: 143 EVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSE 202
           EV +  ++    NI + YD            F+  ++ME C    L + +      + + 
Sbjct: 107 EVDIQSKIGKHKNITELYDY-----------FDSYIIMEYCSGGDLYEAIKADTIPRKTR 155

Query: 203 QEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLV-DANHNFKLCDFGSTSTCFPVANT 261
           Q +  I+  +  A+  +H     + HRD+K EN+L+ D+N   KL D+G       +A T
Sbjct: 156 Q-LTHIISQILDAVEFVH--SKGIYHRDIKPENILIADSNWTVKLTDWG-------LATT 205

Query: 262 HQEIAVLTNNIYVHTTPQYRSPEMIDL----------YRCLPINEKSDIWALGIFLYKLL 311
            Q    +  N+    + +Y +PE+ +           Y C     K DIWA+GI L  ++
Sbjct: 206 DQ--TSMDRNV---GSERYMAPELFESNLDYDERNEPYEC----SKVDIWAIGIVLLNIV 256

Query: 312 FYTTPFELTGQ 322
           F+  PF +  Q
Sbjct: 257 FHKNPFSVANQ 267

>KLLA0A02497g 218592..219680 highly similar to sp|P14681
           Saccharomyces cerevisiae YGR040w KSS1 ser/thr protein
           kinase of the MAP kinase family, start by similarity
          Length = 362

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 71/139 (51%), Gaps = 9/139 (6%)

Query: 174 FEVTLLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKI 233
           FE   L++      L   +NQ+    LSE  I   ++ + RAL  +H   V  IHRD+K 
Sbjct: 87  FEAVYLVQELMETDLQKIINQQ---NLSEDHIQYFVYQILRALKSLHSAQV--IHRDLKP 141

Query: 234 ENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLP 293
            N+L+++N + K+CDFG  + C   ++  +E  V     YV  T  YR+PE++  ++   
Sbjct: 142 SNLLLNSNCDLKVCDFG-LARCLASSDQSRENMVGFMTEYV-ATRWYRAPEIMLSFQ--E 197

Query: 294 INEKSDIWALGIFLYKLLF 312
                DIW+ G  L +++ 
Sbjct: 198 YTTAMDIWSCGCILAEMIM 216

>Scas_685.24
          Length = 515

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 84/188 (44%), Gaps = 25/188 (13%)

Query: 178 LLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVL 237
           ++ME C   S  D +       L E+++  I  ++ + L  +H      IHRD+K  N+L
Sbjct: 95  IVMEYCGGGSCSDLLKYYFNNGLPEKKVAYITREILKGLQYLH--EQKKIHRDIKAANIL 152

Query: 238 VDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEM----IDLYRCLP 293
           +    + KL DFG +          Q  + L     V  TP + +PE+    I+ Y    
Sbjct: 153 LTEEGHVKLGDFGVSG---------QLKSTLRRGTIVG-TPYWMAPEVASQNIEGY---- 198

Query: 294 INEKSDIWALGIFLYKLLFYTTPFELTGQFAILH--SKYEFPV--NNYSSKLINLIIIML 349
            +EK DIW+LGI +++LL    P        +L   S+   P     YS    + + + L
Sbjct: 199 -DEKIDIWSLGITVFELLKGVPPLVKLDPIRVLANLSRKSAPRLQGAYSDAAKSFVALCL 257

Query: 350 AENPNLRP 357
            +NPN RP
Sbjct: 258 IKNPNERP 265

>Kwal_47.17263
          Length = 1127

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 76/322 (23%), Positives = 133/322 (41%), Gaps = 62/322 (19%)

Query: 85  EIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRV-LVTDENGLNEMRNE 143
           EI+  L +G    + + R +      +Q+  IK+   +     R     + NG ++++ E
Sbjct: 106 EIIGELGQGQHGKVKLARDLV----TKQLVAIKIVDRNGGKSNRFSFKKNTNGSDKIKRE 161

Query: 144 VSVMKQL--SGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATK-- 199
           +++MK+        +V+  D   SR        ++ L++E C    +      +L T+  
Sbjct: 162 IAIMKKCHHEHVVKLVEVLDDSTSR--------KIYLVLEYCSKGEVKWCPGDQLETEAR 213

Query: 200 ----LSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTC 255
               L+ Q   +I   V   L  +HY  +  IHRD+K  N+L+  +   K+ DFG     
Sbjct: 214 GPPLLTFQRAREIFRGVVLGLEYLHYQGI--IHRDIKPANLLISESGTVKISDFG---VS 268

Query: 256 FPVANTHQEIAVLTNNIYVHT--TPQYRSPEMIDLY----RCLP----------INEKSD 299
           F  + +      L       T  TP + +PE+   +    R  P          I+   D
Sbjct: 269 FAASKSGAGYGSLDELELAKTAGTPAFFAPEICLGHEASERFAPDRPSSDHGSIISYNID 328

Query: 300 IWALGIFLYKLLFYTTPF----------ELTGQFAILHSKYEFPVNNYSSKLIN------ 343
           IWA+G+ L+ LLF   PF          ++  Q  +L + YE   +N  SK+ N      
Sbjct: 329 IWAIGVTLHCLLFGMLPFFSEFELELFDKIINQELVLKT-YEEMASNGISKISNQEEYEA 387

Query: 344 ---LIIIMLAENPNLRPNIYQV 362
              L+  +L +NP  R  I ++
Sbjct: 388 AKDLLGRLLTKNPFKRIKIAEI 409

>Sklu_2255.4 YGR040W, Contig c2255 6834-7940 reverse complement
          Length = 368

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 63/119 (52%), Gaps = 6/119 (5%)

Query: 193 NQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGST 252
           N    T LS+  I   ++ + RAL  MH   V  IHRD+K  N+L+++N + K+CDFG  
Sbjct: 109 NGHSGTPLSDDHIQYFVYQMLRALKAMHSAQV--IHRDLKPSNLLLNSNCDLKVCDFG-L 165

Query: 253 STCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLL 311
           + C   ++  +E  V     YV  T  YR+PE++  ++        DIW+ G  L +++
Sbjct: 166 ARCLASSSNSRENLVGFMTEYV-ATRWYRAPEIMLTFQ--EYTTAMDIWSCGCILAEMI 221

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 71/265 (26%), Positives = 118/265 (44%), Gaps = 44/265 (16%)

Query: 125 CLKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCP 184
            LKR L  +E  L  + +E+S++++L   PNIV++ D   SR +         ++ +L  
Sbjct: 87  LLKRALKGNE--LQMLYDELSILQKLD-HPNIVKFKDWFESREK-------FYIVTQLAT 136

Query: 185 NNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVL-VDANHN 243
              L D + ++   K +E + +KI+  +  A+  MH   V  +HRD+K ENVL +D +  
Sbjct: 137 GGELFDRILKK--GKFTETDAVKIVVQMLTAVEYMHSQNV--VHRDLKPENVLYLDPSDE 192

Query: 244 FKLC--DFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIW 301
            +L   DFG       +++  Q I     ++       Y +PE++         +  DIW
Sbjct: 193 SQLVISDFGIAKQ---LSSESQLIHRAAGSM------GYVAPEVLTTSGH---GKPCDIW 240

Query: 302 ALGIFLYKLLFYTTPF--ELTGQF----------AILHSKYEFPVNNYSSKLINLIIIML 349
           +LG+  Y LL   +PF  E T  F             HS Y    NN S +    I+  L
Sbjct: 241 SLGVITYTLLCGYSPFIAESTEGFLEEVFSGSDPVTFHSPY---WNNISKEAKQFILRAL 297

Query: 350 AENPNLRPNIYQVMDNLCSILKVKN 374
              P  RP   +++ +   + K  N
Sbjct: 298 TLTPARRPTAAELLTDRWIVSKQSN 322

>CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, hypothetical start
          Length = 442

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 79/297 (26%), Positives = 128/297 (43%), Gaps = 64/297 (21%)

Query: 88  KYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNEMRNEVSVM 147
           K L  G F    VVR   Y+   E V    L       LK+ L  ++  L  + +E+S++
Sbjct: 49  KTLGAGTFG---VVRQARYSPTNEDVAVKIL-------LKKALKGNDVQLQMLYDELSIL 98

Query: 148 KQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQEILK 207
           + L   PNIV++ D   S+ +         ++ +L     L D +  +   K +E++ + 
Sbjct: 99  QMLKH-PNIVEFKDWFESKDK-------FYIVTQLAVGGELFDRILAK--GKFTERDAVS 148

Query: 208 IMFDVTRALAQMHYLPVPLIHRDVKIENVL-VDANHNFKL--CDFG-------STSTCFP 257
           I   +  A+  MH   V  +HRD+K ENVL +D + + +L   DFG       +    F 
Sbjct: 149 ITMQILSAVDYMHSKNV--VHRDLKPENVLYIDKSDDSQLVIADFGIAKQLQDNDDLIFK 206

Query: 258 VANTHQEIA--VLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTT 315
            A +   +A  VLTNN   H  P            C       DIW++G+ +Y LL   +
Sbjct: 207 AAGSLGYVAPEVLTNN--GHGKP------------C-------DIWSIGVIVYTLLCGYS 245

Query: 316 PF--ELTGQFAILHSKYEFPV-------NNYSSKLINLIIIMLAENPNLRPNIYQVM 363
            F  E    F    ++ ++PV       +N S +  N I+  L  +P  RP   ++M
Sbjct: 246 AFVAETVDGFLEECTQNKYPVTFHKPYWDNISDEAKNFILRALTLDPAERPTAAELM 302

>Kwal_56.24584
          Length = 435

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 55/199 (27%), Positives = 94/199 (47%), Gaps = 38/199 (19%)

Query: 138 NEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLA 197
           +++  E+S+M+ +    NIV ++ +  +     S+  E+ +LME    +SL   M+   A
Sbjct: 142 SQLIRELSIMQNVKPHDNIVGFFGAFYT----ASTSNEIVILMEYMDCSSLDKIMSTYKA 197

Query: 198 -----------TKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKL 246
                      T   E  + KI + V   L+ + Y    +IHRD+K  NVL+++    K+
Sbjct: 198 FVARDMQSLTETWFPEFVLAKISYAVLNGLSYL-YRNYKIIHRDIKPSNVLINSKGFVKI 256

Query: 247 CDFGSTSTCF-PVANTHQEIAVLTNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWAL 303
           CDFG +      +A+T           +V T+  Y SPE I   +Y     + K D+W+L
Sbjct: 257 CDFGVSKKLINSIADT-----------FVGTST-YMSPERIQGSVY-----STKGDVWSL 299

Query: 304 GIFLYKLLFYTTPFELTGQ 322
           G+ + +L+  T  F L G 
Sbjct: 300 GLMIIELV--TGEFPLGGH 316

>YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic
           subunit of cAMP-dependent protein kinase 1, protein
           kinase A or PKA [1194 bp, 397 aa]
          Length = 397

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 58/254 (22%), Positives = 110/254 (43%), Gaps = 45/254 (17%)

Query: 69  EQLKTGSQVIVGN---HRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLAC 125
           +Q    ++V VG+      +I++ L  G F  ++++R   +      +  +K E+  +  
Sbjct: 69  KQFIAQARVTVGSIVYKNFQILRTLGTGSFGRVHLIR-SRHNGRYYAMKVLKKEI--VVR 125

Query: 126 LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPN 185
           LK+V         E  N+  +M  +   P I++ + +            ++ ++M+    
Sbjct: 126 LKQV---------EHTNDERLMLSIVTHPFIIRMWGTFQDAQ-------QIFMIMDYIEG 169

Query: 186 NSLLDYM--NQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHN 243
             L   +  +QR    +++        +V  AL  +H     +I+RD+K EN+L+D N +
Sbjct: 170 GELFSLLRKSQRFPNPVAK----FYAAEVCLALEYLH--SKDIIYRDLKPENILLDKNGH 223

Query: 244 FKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWAL 303
            K+ DFG       V  T            +  TP Y +PE++      P N+  D W+ 
Sbjct: 224 IKITDFGFAKYVPDVTYT------------LCGTPDYIAPEVVS---TKPYNKSIDWWSF 268

Query: 304 GIFLYKLLFYTTPF 317
           GI +Y++L   TPF
Sbjct: 269 GILIYEMLAGYTPF 282

>ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C
           (MKK2) - SH] complement(557738..559312) [1575 bp, 524
           aa]
          Length = 524

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 68/251 (27%), Positives = 109/251 (43%), Gaps = 39/251 (15%)

Query: 87  VKYLAEGGFAHIYVVRFIEYANELEQ-----VPTIKLEVGD-LACLKRV--LVTDENGLN 138
           V  L E  + H+++   IE    L +     V   KL  G  +  LK +  L TD+    
Sbjct: 219 VDELEEEMWTHVHLKDQIEELGVLGEGAGGSVTKCKLRHGSKIFALKTITTLTTDQESQK 278

Query: 139 EMRNEVSVMKQLSGCPN--IVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRL 196
           ++  E+   K    C +  IV+YY               + + ME     SL D + + L
Sbjct: 279 QIFRELQFNKS---CKSDYIVRYYGMFTDEEHS-----SIYIAMEYMGGRSL-DAIYKHL 329

Query: 197 ---ATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTS 253
                ++ E+ + KI   V R L+ +H   +  IHRD+K +N+L++     KLCDFG + 
Sbjct: 330 LKHGGRVGEKVLGKIAESVLRGLSYLHQRKI--IHRDIKPQNILLNEAGQVKLCDFGVSG 387

Query: 254 TCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFY 313
                  T       T   Y      Y +PE I   +  P +  SD+W+LG+ L ++   
Sbjct: 388 EAVNSLAT-----TFTGTSY------YMAPERI---QGQPYSVTSDVWSLGLTLLEVAQA 433

Query: 314 TTPFELTGQFA 324
             PF+ +G+FA
Sbjct: 434 HFPFD-SGKFA 443

>YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinase
           kinase (MEK) serine/threonine protein kinase, involved
           in cell wall integrity (low-osmolarity) pathway [1521
           bp, 506 aa]
          Length = 506

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 74/165 (44%), Gaps = 23/165 (13%)

Query: 156 IVQYYDSHASRARDGSSGFEVTLLMELCPNNSL-LDYMNQ-RLATKLSEQEILKIMFDVT 213
           IVQYY               + + ME     SL   Y N  +   ++SE+ I KI   V 
Sbjct: 273 IVQYYGMFTDEQSS-----SIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVL 327

Query: 214 RALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIY 273
           R L+ +H   V  IHRD+K +N+L++     KLCDFG +             AV +  + 
Sbjct: 328 RGLSYLHERKV--IHRDIKPQNILLNEKGEIKLCDFGVSGE-----------AVNSLAMT 374

Query: 274 VHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 318
              T  Y +PE I   +  P +   D+W+LG+ L ++     PFE
Sbjct: 375 FTGTSFYMAPERI---QGQPYSVTCDVWSLGLTLLEVAGGRFPFE 416

>Kwal_55.20326
          Length = 750

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 91/201 (45%), Gaps = 24/201 (11%)

Query: 137 LNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRL 196
           ++ +++E+ ++K+L    NIV YY S          G  + + +E  P  S+   +N   
Sbjct: 531 VDALQHEMGLLKELQH-ENIVTYYGS-------SQEGGNLNIFLEYVPGGSVSSMLNSY- 581

Query: 197 ATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCF 256
                E  I      +   L+ +H   +  IHRD+K  N+L+D     K+ DFG +    
Sbjct: 582 -GPFEEPLIRNFTRQILIGLSYLHRKDI--IHRDIKGANILIDIKGCVKITDFGISKKLS 638

Query: 257 PVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 316
           P+     + A L  ++Y      + +PE++   + +   +K+DIW++G  + ++     P
Sbjct: 639 PLNQQQNKRASLQGSVY------WMAPEVV---KQVVTTKKADIWSVGCVIIEMFTGKHP 689

Query: 317 FELTGQFAILHSKYEFPVNNY 337
           F     F+ + + ++   N +
Sbjct: 690 FP---DFSQMQAIFKIGTNTF 707

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 55/107 (51%), Gaps = 17/107 (15%)

Query: 211 DVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTN 270
           +VT AL  +H   +  I+RD+K EN+L+D N + K+ DFG       V  T         
Sbjct: 168 EVTLALEYLHSHNI--IYRDLKPENILLDRNGHIKITDFGFAKEVITVTWT--------- 216

Query: 271 NIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 317
              +  TP Y +PE+I      P N+  D W+LGI ++++L   TPF
Sbjct: 217 ---LCGTPDYIAPEVI---TTKPYNKSVDWWSLGILIFEMLAGYTPF 257

>CAGL0F03311g complement(327599..330736) similar to sp|P38691
           Saccharomyces cerevisiae YHR082c KSP1 ser/thr protein
           kinase, start by similarity
          Length = 1045

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 84/190 (44%), Gaps = 38/190 (20%)

Query: 143 EVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSE 202
           EV +  ++    NIVQ YD            F+  ++ME C    L + +   L  K + 
Sbjct: 126 EVDIQTKIGFHENIVQLYDF-----------FDSYIIMEYCSGGDLYEAIKDDLVPKKT- 173

Query: 203 QEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDA--NHNFKLCDFGSTSTCFPVAN 260
           +EI  I+  +  A+  +H   +   HRD+K EN+L+ +  +   KL D+G  +T      
Sbjct: 174 KEITHILTQILDAIEFVHNKQI--YHRDIKPENILITSLIDWKIKLTDWGLATT------ 225

Query: 261 THQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINE--------KSDIWALGIFLYKLLF 312
              +      N+    + +Y  PE+ +    L I+E        K D+W++GI    ++F
Sbjct: 226 ---DEKSYDRNV---GSERYMPPELFE--SNLDIDERKEPYDCSKVDLWSIGIVFLNVVF 277

Query: 313 YTTPFELTGQ 322
           Y  PF +  Q
Sbjct: 278 YKNPFRIADQ 287

>AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH]
            complement(196774..201870) [5097 bp, 1698 aa]
          Length = 1698

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 99/212 (46%), Gaps = 22/212 (10%)

Query: 164  ASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQ--EILKIMFDVTRALAQMHY 221
            +SRA+  S+ F   + ME C N +L D ++      LS+Q  E  ++   +  AL+ +H 
Sbjct: 814  SSRAKPKSTLF---IQMEYCENRTLYDLIHNE---NLSQQRDEYWRLFRQILEALSYIH- 866

Query: 222  LPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVH------ 275
                +IHRD+K  N+ +D + N K+ DFG        A+  +      +N+         
Sbjct: 867  -SQGIIHRDLKPMNIFIDESRNIKIGDFGLAKNVHKSADILRIEGAFGSNVSADDLTSAI 925

Query: 276  TTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLF-YTTPFELTGQFAILHSK-YEFP 333
             T  Y + E+  L      NEK D+++LGI  +++++ + T  E       L S   E P
Sbjct: 926  GTALYVASEV--LTGNGNYNEKIDMYSLGIIFFEMVYHFDTLMERATDLRKLRSSAVELP 983

Query: 334  VNNYSSKL--INLIIIMLAENPNLRPNIYQVM 363
             N  SSK     +I ++L  +P  RP   +++
Sbjct: 984  ANFDSSKRNEKKIIRLLLDHDPAKRPTAAKLL 1015

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/244 (23%), Positives = 109/244 (44%), Gaps = 41/244 (16%)

Query: 80  GNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNE 139
           GNHR ++ + +  G F+ ++  +  +   ++  +  ++    +   L++V          
Sbjct: 3   GNHRYKVGRLIQSGSFSVVHHAQDCQTGQDVA-LKYVRKPHDNPEQLQKVAAL------- 54

Query: 140 MRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATK 199
           + NE +++++L    NI Q  D +     D  +      ++E C    L D++       
Sbjct: 55  VHNEYAILRRLGTHRNICQLLDFY----EDADT---YVFVLEYCAYGDLYDFIK-----A 102

Query: 200 LSEQEILKI-----MFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTST 254
           + E+  ++I     +F +  A++  H   V   HRD+K ENVL+D     KL DFG +  
Sbjct: 103 IRERPTMRINFHSFLFQLCSAISYCHSKDVS--HRDIKPENVLMDDRGQVKLTDFGLS-- 158

Query: 255 CFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYT 314
                    +I  ++ + Y   T +Y +PE     R       +D W+LGI ++ L+F +
Sbjct: 159 ---------QIGSVSKD-YCIGTEKYLAPET--FLREYHNTFATDYWSLGITIFCLMFGS 206

Query: 315 TPFE 318
            PFE
Sbjct: 207 CPFE 210

>YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit of
           cAMP-dependent protein kinase 2, protein kinase A or PKA
           [1143 bp, 380 aa]
          Length = 380

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/239 (23%), Positives = 104/239 (43%), Gaps = 44/239 (18%)

Query: 82  HRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNEMR 141
           H  +I++ L  G F  +++VR +                  +  LK+  V     +    
Sbjct: 68  HDFQIMRTLGTGSFGRVHLVRSVHNGRYYA-----------IKVLKKQQVVKMKQVEHTN 116

Query: 142 NEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYM--NQRLATK 199
           +E  ++K L   P +++ + +    AR+      + ++M+      L   +  +QR    
Sbjct: 117 DERRMLK-LVEHPFLIRMWGTFQD-ARN------IFMVMDYIEGGELFSLLRKSQRFPNP 168

Query: 200 LSEQEILKIMFDVTRALAQMHYLPVP-LIHRDVKIENVLVDANHNFKLCDFGSTSTCFPV 258
           +++       F     +  + YL    +I+RD+K EN+L+D N + K+ DFG        
Sbjct: 169 VAK-------FYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFA------ 215

Query: 259 ANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 317
               +E+  +T  +    TP Y +PE+I      P N+  D W+LG+ +Y++L   TPF
Sbjct: 216 ----KEVQTVTWTL--CGTPDYIAPEVI---TTKPYNKSVDWWSLGVLIYEMLAGYTPF 265

>Sklu_2186.4 YHR030C, Contig c2186 5713-7278 reverse complement
          Length = 521

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/249 (24%), Positives = 106/249 (42%), Gaps = 39/249 (15%)

Query: 71  LKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANE----LEQVPTIKLEVGDLACL 126
            K  +Q    + R +++K +  G +  +   RF E   E    +++V  +  +   L C 
Sbjct: 10  FKVFNQDFTVDKRFQLIKEIGHGAYGIVCSARFTEAVEETTVAIKKVTNVFSKT--LLC- 66

Query: 127 KRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGS-SGFEVTLLMELCPN 185
           KR L            E+ +++   G  NI   YD       DGS +G  +   +  C  
Sbjct: 67  KRSL-----------RELKLLRHFRGHKNITCLYDMDIVFGIDGSFNGLYLYEELMECDM 115

Query: 186 NSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245
           + ++     +    LS+      ++ +   L  +H   V  +HRD+K  N+LV+A+   K
Sbjct: 116 HQII-----KSGQPLSDAHYQSFIYQILCGLKYIHSADV--LHRDLKPGNLLVNADCQLK 168

Query: 246 LCDFGSTSTCFPVANTHQEIAVLTNNI---YVHTTPQYRSPEMIDLYRCLPINEKSDIWA 302
           +CDFG       +A  + E  V  N     YV  T  YR+PE++  Y+        D+W+
Sbjct: 169 ICDFG-------LARGYSENPVENNQFLTEYV-ATRWYRAPEIMLSYQ--GYTRAIDVWS 218

Query: 303 LGIFLYKLL 311
            G  L +LL
Sbjct: 219 CGCILAELL 227

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 106/236 (44%), Gaps = 44/236 (18%)

Query: 85  EIVKYLAEGGFAHIYVVRFIEYANELEQVPTIK-LEVGDLACLKRVLVTDENGLNEMRNE 143
           +I++ L  G F  +++VR    +N   +   +K L+   +  LK+V  T     N+ RN 
Sbjct: 146 QILRTLGTGSFGRVHLVR----SNHNGRFYAMKVLKKNTVVKLKQVEHT-----NDERNM 196

Query: 144 VSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYM--NQRLATKLS 201
           +S++      P I++ + +            ++ ++M+      L   +  +QR    ++
Sbjct: 197 LSIVSH----PFIIRMWGTFQDSQ-------QLFMIMDYIEGGELFSLLRKSQRFPNPVA 245

Query: 202 EQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANT 261
           +        +V  AL  +H     +I+RD+K EN+L+D N + KL DFG       V  T
Sbjct: 246 K----FYAAEVCLALEYLH--SKGIIYRDLKPENILLDKNGHIKLTDFGFAKYVPDVTYT 299

Query: 262 HQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 317
                       +  TP Y +PE++      P N+  D W+ G+ +Y++L   TPF
Sbjct: 300 ------------LCGTPDYIAPEVVS---TKPYNKSVDWWSFGVLIYEMLAGYTPF 340

>Scas_548.6
          Length = 1382

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 84/176 (47%), Gaps = 22/176 (12%)

Query: 198  TKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFP 257
            T ++E E   I   +   +  +H     ++HRD+K ENV+VD+    K+ DFGS +    
Sbjct: 1226 TNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGCVKIIDFGSAAY--- 1280

Query: 258  VANTHQEIAVLTNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLFYTT 315
                   +     +++V T   Y +PE++  + Y   P     DIWA+GI LY ++F   
Sbjct: 1281 -------VKSGPFDVFVGTI-DYAAPEVLSGEPYEGKP----QDIWAIGILLYTIVFKEN 1328

Query: 316  PFELTGQFAILHSKYEF-PVNNYSSKLINLIIIMLAENPNLRPNIYQVMDNLCSIL 370
            PF    +  IL  + +F   N+ S   I LI  +L  +   RP I ++ ++   IL
Sbjct: 1329 PFYNIDE--ILEGELKFNNSNDISEDCIELIKKILIRSVPKRPLIEEIFNDKWLIL 1382

>Scas_683.6
          Length = 377

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 79/169 (46%), Gaps = 8/169 (4%)

Query: 143 EVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSE 202
           E+ ++   +   NI+   D     + D      V L+ EL   +      N      L++
Sbjct: 59  EIKLLTYFNNHENIISILDKIKPISMDKFQA--VYLVQELMETDLQRVISNNNTNKSLTD 116

Query: 203 QEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTH 262
             I    + + RAL  +H   V  IHRD+K  N+L+++N + K+CDFG  S C   +N  
Sbjct: 117 DHIQYFTYQILRALKSIHSAKV--IHRDLKPSNLLLNSNCDLKICDFG-LSRCLTSSNDS 173

Query: 263 QEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLL 311
           ++  V     YV  T  YR+PE++  ++        DIW++G  L +++
Sbjct: 174 KKTLVGFMTEYV-ATRWYRAPEIMLTFQ--EYTTAMDIWSVGCILAEMV 219

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 68/142 (47%), Gaps = 27/142 (19%)

Query: 211 DVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTN 270
           +V  AL  +H     +I+RD+K EN+L+D N + K+ DFG       V  T         
Sbjct: 258 EVCLALEYLH--SKEIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYT--------- 306

Query: 271 NIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF----ELTGQFAIL 326
              +  TP Y +PE++      P N+  D W+ GI +Y++L   TPF     +     IL
Sbjct: 307 ---LCGTPDYIAPEVVS---TKPYNKSVDWWSFGILIYEMLAGYTPFYDANTMKTYEHIL 360

Query: 327 HSKYEFP------VNNYSSKLI 342
           +S+ +FP      V +  SKLI
Sbjct: 361 NSELKFPSFFHPDVQDLLSKLI 382

>Kwal_26.7154
          Length = 1213

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 62/124 (50%), Gaps = 19/124 (15%)

Query: 196  LATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTC 255
            + T ++E E + I   +   +  +H     ++HRD+K ENV+VD N   K+ DFGS +  
Sbjct: 1055 MKTDMTEHEAMLIFKQIASGIKNLH--DNGIVHRDIKDENVIVDCNGFVKIVDFGSAAY- 1111

Query: 256  FPVANTHQEIAVLTNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLFY 313
                     +     +++V T   Y +PE++  + Y   P     DIWA+G+ LY +++ 
Sbjct: 1112 ---------VKSGPFDVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAIGVLLYTIIYK 1157

Query: 314  TTPF 317
              PF
Sbjct: 1158 ENPF 1161

>ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) - SH]
            (864528..868307) [3780 bp, 1259 aa]
          Length = 1259

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 80/179 (44%), Gaps = 34/179 (18%)

Query: 196  LATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTC 255
            L T ++E E   +   V   L  +H     ++HRD+K ENV+VD     K+ DFGS +  
Sbjct: 1101 LKTNMTEHEAKLLFKQVASGLRHLH--ENGIVHRDIKDENVIVDNRGRVKIIDFGSAAY- 1157

Query: 256  FPVANTHQEIAVLTNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLFY 313
                     +     +++V T   Y +PE++  D Y   P     D+WA+G+ LY +++ 
Sbjct: 1158 ---------VKRGPFDVFVGTI-DYAAPEVLGGDPYEGKP----QDVWAVGVLLYTIIYK 1203

Query: 314  TTPFE-----LTGQFAILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQVMDNLC 367
              PF      L G   I       P    S + + LI  +L  + N RP +    D++C
Sbjct: 1204 ENPFYNIDEILDGDLRI------SPAVVVSEECVALITRILNRSVNRRPTV----DDIC 1252

>Scas_544.6
          Length = 489

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 107/230 (46%), Gaps = 49/230 (21%)

Query: 112 QVPTIKLEVGDLACLKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGS 171
            VP+ K+    +  L++    +E  +N++  E+++MK +    NI+ +Y +  +  ++  
Sbjct: 176 HVPSSKIIAQKIIPLEK---NNEIVVNQLIRELTIMKSIKPHKNIISFYAAFYTHHQNN- 231

Query: 172 SGFEVTLLMELCPNNSL------------LDYMNQRLATKLSEQEIL-KIMFDVTRALAQ 218
              E+ +LME     SL               ++ R     ++  IL +I + V   L  
Sbjct: 232 ---EIVILMEYMDCGSLDRIFSTYKRFVARGVLDPREKNWFNDSLILSRISYAVLNGLNY 288

Query: 219 MHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCF-PVANTHQEIAVLTNNIYVHTT 277
           + Y    +IHRD+K  NVL+++    KLCDFG +      +A+T           +V T+
Sbjct: 289 L-YENYKIIHRDIKPSNVLINSKGLVKLCDFGVSKKLINSIADT-----------FVGTS 336

Query: 278 PQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAI 325
             Y SPE I  ++Y     + K D+W+LG+ + +L        +TGQF +
Sbjct: 337 -TYMSPERIQGNVY-----STKGDVWSLGLMIIEL--------VTGQFPL 372

>ABL011C [581] [Homologous to ScYLR362W (STE11) - SH]
           (378259..380364) [2106 bp, 701 aa]
          Length = 701

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/244 (23%), Positives = 109/244 (44%), Gaps = 40/244 (16%)

Query: 90  LAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDL--------------ACLKRVLVTDEN 135
           +  G F  +Y+     +  EL  V  ++LE   +              A +K++    ++
Sbjct: 421 IGSGSFGSVYL-GMNAHTGELMAVKQVELEPTTVMASSDDKKSHPSSNAVVKKLTDPPQD 479

Query: 136 GLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQR 195
           G      +++++K+L    NIV YY S          G  + + +E  P  S+   +N  
Sbjct: 480 GGRASSTKMNLLKELH-HENIVTYYGSS-------QEGGNLNIFLEYVPGGSVSSMLN-- 529

Query: 196 LATKLSEQEILKIMFDVTR-ALAQMHYLPVP-LIHRDVKIENVLVDANHNFKLCDFGSTS 253
            +    E+ ++K   + TR  L  + YL    +IHRD+K  N+L+D   + K+ DFG + 
Sbjct: 530 -SYGPFEEPLVK---NFTRQTLVGLTYLHRKNIIHRDIKGANLLIDIKGSVKITDFGISK 585

Query: 254 TCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFY 313
              P+     + A L  ++Y      + +PE++   + +   EK+DIW++G  + ++   
Sbjct: 586 KLSPLNKKQNKRASLQGSVY------WMAPEVV---KQVVTTEKADIWSVGCVVVEMFTG 636

Query: 314 TTPF 317
             PF
Sbjct: 637 KHPF 640

>CAGL0H00979g complement(94328..95527) similar to tr|Q12003
           Saccharomyces cerevisiae YPL236c, hypothetical start
          Length = 399

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 85/375 (22%), Positives = 152/375 (40%), Gaps = 91/375 (24%)

Query: 77  VIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVG----DLACLKRVL-- 130
           ++V   +  IV+ L E   + +Y+VR  +    L    +   + G    +   LKR+   
Sbjct: 26  LLVNGRKYSIVRLLKEDDMSFLYLVRLEDGMPLLSAAASGDDDDGYESVNTYTLKRIRCP 85

Query: 131 VTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLD 190
           + + + +++   E+   K+    P +V   DS   +  DG+    + ++    P  SL D
Sbjct: 86  IGNISNVSDAMREIDNYKRFQS-PYVVSSVDSQVIQELDGAK--TIYIVFPHYPLGSLQD 142

Query: 191 YMNQRL--ATKLSEQEILKIMFDVTRA-LAQMHYLPVPLIHRDVKIENVLVD------AN 241
            ++ R+   T +SE E ++IM  + R  L        P   R V+     VD       N
Sbjct: 143 SIDDRILDGTFVSESECIRIMCGIARGLLCLHDSSSAP---RGVRTLTTGVDEGASDNVN 199

Query: 242 HNFKLCD-FG----------------------------STSTCFPVANTHQEIA----VL 268
            +F L D  G                            ST++  PV+ +H+ ++    + 
Sbjct: 200 TDFNLSDNLGDDRDKISASYTDEAGLSMDEHLLELDSISTTSVVPVSYSHKMLSPSNIIF 259

Query: 269 TNN---------------IYVHTTPQ--------------YRSPEMIDLYRCLPINEKSD 299
           ++N               + + T  Q              Y +PE +DL     ++ K D
Sbjct: 260 SSNGLPIISELGSCSKADVEIKTAKQLNRLREWVDDNFNSYMAPEFLDLKTNSKLSTKVD 319

Query: 300 IWALGIFLYKLLFYTTPFE----LTG---QFAILHSKYEFPV-NNYSSKLINLIIIMLAE 351
           +W+ G   Y LLF   PFE    L G   ++AI   K+ FP  + YS  ++++I   L  
Sbjct: 320 VWSFGCICYALLFGMNPFEREEQLYGASIKYAISTGKFSFPSQSRYSDSILDIIRSCLQV 379

Query: 352 NPNLRPNIYQVMDNL 366
           +P+ RP++  V++NL
Sbjct: 380 DPSERPSVSIVLNNL 394

>CAGL0J04290g complement(400939..402012) similar to sp|P16892
           Saccharomyces cerevisiae YBL016w FUS3 or sp|P14681
           Saccharomyces cerevisiae YGR040w KSS1, start by
           similarity
          Length = 357

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 110/237 (46%), Gaps = 34/237 (14%)

Query: 121 GDLACLKRVLVTDE--NGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTL 178
           G++  +K+++  D+    L  +R E+ ++++     NI+  +D     + +  +  EV +
Sbjct: 36  GEIVAIKKIVPFDKPLFALRTLR-EIKILRRFQH-ENIISIFDIQKPESFEKFN--EVYI 91

Query: 179 LMELCPNNSLLDYMNQRLATK-LSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVL 237
           + EL   +     +++ +AT+ L++  I   ++   RA+  +H   V  IHRD+K  N+L
Sbjct: 92  IQELMQTD-----LHRVIATQTLTDDHIQYFIYQTLRAIKTLHGSNV--IHRDLKPSNIL 144

Query: 238 VDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEK 297
           +++N + K+CDFG         N   E+  +    YV  T  YR+PE+  +      +  
Sbjct: 145 INSNCDLKVCDFGLARIIDSGENGDNEVDKIGMTEYV-ATRWYRAPEV--MLTNAKYSRA 201

Query: 298 SDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEFPVNNYSSKLINLIIIMLAENPN 354
            DIW+ G  L + LF   P               FP  +Y  +L  L+I  L   P+
Sbjct: 202 MDIWSCGCILGE-LFLKRPL--------------FPGKDYRHQL--LLIFGLIGTPD 241

>Sklu_2086.4 , Contig c2086 6437-7168 reverse complement
          Length = 243

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 51/177 (28%), Positives = 79/177 (44%), Gaps = 30/177 (16%)

Query: 196 LATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTC 255
           L T ++E E   I   V   +  +H     ++HRD+K EN++VD     KL DFGS +  
Sbjct: 85  LKTNMTEHEAKLIFKQVASGIKHLH--DNGIVHRDIKDENIIVDNKGFVKLIDFGSAAY- 141

Query: 256 FPVANTHQEIAVLTNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLFY 313
                    +     +++V T   Y +PE++  D Y   P     DIWA+G+ LY ++F 
Sbjct: 142 ---------VKSGPFDVFVGTI-DYAAPEVLGGDPYEGKP----QDIWAIGVLLYTIIFK 187

Query: 314 TTPFE-----LTGQFAILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQVMDN 365
             PF      L G   I  S         S + I LI  +L  +   RP I ++ ++
Sbjct: 188 ENPFYNIDEILDGDLRISSSV------TVSEECIALIRRILNRSVPKRPTIEEIYND 238

>YKL048C (ELM1) [3211] chr11 complement(346859..348781)
           Serine/threonine protein kinase that regulates
           pseudohyphal growth [1923 bp, 640 aa]
          Length = 640

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 87/184 (47%), Gaps = 17/184 (9%)

Query: 207 KIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNF-KLCDFGS---TSTCFPVANTH 262
           KI+ D+T+ L  +H      IHRD+K  N+L+D      KL DFGS   T    P ++ +
Sbjct: 238 KILEDMTKGLEYLH--SQGCIHRDIKPSNILLDEEEKVAKLSDFGSCIFTPQSLPFSDAN 295

Query: 263 QEIAVLTNNIYVHTTPQYRSPEMIDLYRC----LPINEKSDIWALGIFLYKLLFYTTPFE 318
            E         +  TP + +PE+  L       +    K DIW+LG+ LY LL+   PF 
Sbjct: 296 FEDCFQRELNKIVGTPAFIAPELCHLGNSKRDFVTDGFKLDIWSLGVTLYCLLYNELPFF 355

Query: 319 LTGQFAILHSKYEFPVNN-YSSKLINLIII--MLAENPNLRPNIYQVMDNLCSILKVKNP 375
              +F   H   E  +++  +   +N ++I  +L ++  LR +I     +L  +L    P
Sbjct: 356 GENEFETYHKIIEVSLSSKINGNTLNDLVIKRLLEKDVTLRISI----QDLVKVLSRDQP 411

Query: 376 LEDK 379
           ++ +
Sbjct: 412 IDSR 415

>KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_1
           Kluyveromyces lactis MAP kinase, start by similarity
          Length = 495

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 109/250 (43%), Gaps = 41/250 (16%)

Query: 71  LKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANE----LEQVPTIKLEVGDLACL 126
            K  +Q    + R +++K +  G +  +   RF E A+E    +++V  +  +   L C 
Sbjct: 12  FKVFNQDFTVDKRFQLIKEIGHGSYGIVCSARFTEAADETTVAIKKVTNVFSKT--LLC- 68

Query: 127 KRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDG--SSGFEVTLLMELCP 184
           KR L            E+ +++   G  NI   YD       DG  +  +    LME C 
Sbjct: 69  KRSL-----------RELKLLRHFRGHKNITCLYDMDIVFQPDGMFNGLYLYEELME-CD 116

Query: 185 NNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNF 244
            + ++     +    L++      ++ +   L  +H   V  +HRD+K  N+LV+A+   
Sbjct: 117 MHQIV-----KSGQPLTDAHYQSFIYQILCGLKYIHSADV--LHRDLKPGNLLVNADCQL 169

Query: 245 KLCDFGSTSTCFPVANTHQEIAVLTNNI---YVHTTPQYRSPEMIDLYRCLPINEKSDIW 301
           K+CDFG       +A  + E  V  N     YV  T  YR+PE++  Y+     +  D+W
Sbjct: 170 KICDFG-------LARGYSENPVENNQFLTEYV-ATRWYRAPEIMLSYQ--GYTKAIDVW 219

Query: 302 ALGIFLYKLL 311
           + G  L +LL
Sbjct: 220 SCGCILAELL 229

>CAGL0D02244g complement(229504..230967) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, hypothetical start
          Length = 487

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 93/200 (46%), Gaps = 38/200 (19%)

Query: 137 LNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQR- 195
           L+++  E  ++ QL+  PNI++ + +H  ++ +      + +  EL P   L  Y+ +  
Sbjct: 199 LSKLDKEAKILMQLNH-PNIIKVFKTHTDKSNN------LYIFQELIPGGDLFSYLAKGD 251

Query: 196 LATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK---LCDFGST 252
               +S+ E L  ++ +  AL  +H     ++HRD+K++N+L+     F    L DFG  
Sbjct: 252 CLMPISQTEALVFVYQILHALKYLH--TKGIVHRDLKLDNILLCTPEPFTKIVLADFGIA 309

Query: 253 STCFPVANTHQEIAVLTNNIY-VHTTPQYRSPEMI---------DLYRCLPI-----NEK 297
            T          +  + + ++ V  TP+Y +PE+            +R   +     + K
Sbjct: 310 RT----------VTTMKSRMFTVVGTPEYCAPEVGFKANRKAYHSFFRAATLEQQGYDSK 359

Query: 298 SDIWALGIFLYKLLFYTTPF 317
            D+W+LG+  + +L   +PF
Sbjct: 360 CDLWSLGVITHIMLTGISPF 379

>Scas_689.25*
          Length = 409

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 54/107 (50%), Gaps = 17/107 (15%)

Query: 211 DVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTN 270
           +V  AL  +H L +  I+RD+K EN+L+D N + K+ DFG       V  T         
Sbjct: 205 EVCLALDYLHSLDI--IYRDLKPENLLLDRNGHIKVTDFGFAKYVPDVTYT--------- 253

Query: 271 NIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 317
              +  TP Y +PE+I      P N+  D W+ GI +Y++L   TPF
Sbjct: 254 ---LCGTPDYIAPEVI---SAKPYNKSVDWWSFGILIYEMLSGHTPF 294

>Sklu_2073.3 YER129W, Contig c2073 2194-5742
          Length = 1182

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/274 (24%), Positives = 113/274 (41%), Gaps = 38/274 (13%)

Query: 85  EIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNEMRNEV 144
           EI+K L  G    + + R +    +L  +  +          K      EN  ++++ E+
Sbjct: 118 EIIKELGHGQHGKVKLARDL-LTKQLVAIKIVDRHEKKNNPWKLKKTNTEN--DKIKREI 174

Query: 145 SVMKQL--SGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATK--- 199
           ++MK+        +++  D   SR        ++ L++E C    +      +L TK   
Sbjct: 175 AIMKKCHHEHVVKLIEVLDDFKSR--------KIYLVLEYCSKGEIKWCPGDQLETKARG 226

Query: 200 ---LSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFG---STS 253
              L+ Q   +++  V   L  +HY  +  IHRD+K  N+LV      K+ DFG   + S
Sbjct: 227 PPLLTFQRAREVLRGVVLGLEYLHYQGI--IHRDIKPANLLVSETGTVKISDFGVSLAAS 284

Query: 254 TC---------FPVANTHQEIAVLTNNIYV-HTTPQYRSPEMIDLYRCLPINEKSDIWAL 303
           T            +A T    A     I + H   +  +P+     + L I+   DIWAL
Sbjct: 285 TTEDGNGFIDELELAKTAGTPAFFAPEICLGHDALEKFNPDKKATKKGLCISFMIDIWAL 344

Query: 304 GIFLYKLLF----YTTPFELTGQFAILHSKYEFP 333
           G+ L+ LLF    + + FEL     I++    FP
Sbjct: 345 GVTLHCLLFGQLPFISEFELELFHKIVNDSLTFP 378

>Scas_623.11
          Length = 378

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 65/138 (47%), Gaps = 24/138 (17%)

Query: 186 NSLLDYMNQRLATKL----------SEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIEN 235
           N +LDYM Q L  +L          S  EI   MF + ++L  +H     + HRD+K +N
Sbjct: 119 NLILDYMPQSLYQRLRHFVHQRQSMSRLEIKFYMFQLFKSLNYLHNAK-NVCHRDIKPQN 177

Query: 236 VLVDAN-HNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPI 294
           +LVD N  N KLCDFGS     P             N+    +  YR+PE+I  +     
Sbjct: 178 ILVDPNSWNLKLCDFGSAKQLKPTE----------PNVSYICSRYYRAPELI--FGATNY 225

Query: 295 NEKSDIWALGIFLYKLLF 312
           + + DIW+ G  + +LL 
Sbjct: 226 SNQIDIWSSGCVMAELLL 243

>YOL016C (CMK2) [4800] chr15 complement(294777..296120)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type II [1344 bp, 447 aa]
          Length = 447

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 67/256 (26%), Positives = 116/256 (45%), Gaps = 42/256 (16%)

Query: 125 CLKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCP 184
            LK+ L  +   L  +  E+S++++LS  PNIV + D   S+ +         ++ +L  
Sbjct: 78  LLKKALQGNNVQLQMLYEELSILQKLS-HPNIVSFKDWFESKDK-------FYIVTQLAT 129

Query: 185 NNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVL-VDANHN 243
              L D +  R   K +E + ++I+  +  A+  MH   V  +HRD+K ENVL VD + N
Sbjct: 130 GGELFDRILSR--GKFTEVDAVEIIVQILGAVEYMHSKNV--VHRDLKPENVLYVDKSEN 185

Query: 244 --FKLCDFGSTSTCFPVANTHQEIAVLTNNIY-VHTTPQYRSPEMI--DLYRCLPINEKS 298
               + DFG            +++    + IY    +  Y +PE++  D +      +  
Sbjct: 186 SPLVIADFG----------IAKQLKGEEDLIYKAAGSLGYVAPEVLTQDGH-----GKPC 230

Query: 299 DIWALGIFLYKLLFYTTPF--ELTGQFAILHSKYEFPV-------NNYSSKLINLIIIML 349
           DIW++G+  Y LL   +PF  E    F    +   +PV       +N S  +   I+  L
Sbjct: 231 DIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPYWDNISIDVKRFILKAL 290

Query: 350 AENPNLRPNIYQVMDN 365
             NP  RP   +++D+
Sbjct: 291 RLNPADRPTATELLDD 306

>AFL143C [3052] [Homologous to ScYPL236C - SH] (164241..165326)
           [1086 bp, 361 aa]
          Length = 361

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 101/257 (39%), Gaps = 51/257 (19%)

Query: 154 PNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRL--ATKLSEQEILKIMFD 211
           P I    DS       GS    V ++++  P  SL   ++  L     L E  +L +M +
Sbjct: 90  PYITSLLDSQIVPLEQGSK--LVYMVLQYFPTGSLQQLIDTTLVEGVPLPEPRVLALMVE 147

Query: 212 VTRALAQMH------------------YLPVPLIHRDVKIENVLVDANHNFKLCDF---- 249
           V RA+  +H                  +L    +  DV +E        +F LCD     
Sbjct: 148 VCRAVRAVHQPGDEGVESGSATQSEDTHLLADALEMDV-LEASTSSPRRSFVLCDLRPSA 206

Query: 250 -----------GSTSTC----FPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPI 294
                         S C    + +AN  + +A +   +  H +P Y +PE+  L     I
Sbjct: 207 VMLTPQGMPIISDLSACVRSGYALANATR-LARMRAVLDTHGSPMYLAPELCALEPNACI 265

Query: 295 NEKSDIWALGIFLYKLLFYTTPFELTGQF-------AILHSKYEFPVN-NYSSKLINLII 346
              +DIW+LG   Y L++  +PFE   Q        A     + FP N  YS +L++++ 
Sbjct: 266 LPPADIWSLGCICYALMYGISPFEREEQLHGTPLRQARASGLFSFPDNPVYSLQLLDIVR 325

Query: 347 IMLAENPNLRPNIYQVM 363
             LA  P+ RP I  +M
Sbjct: 326 QCLAVKPDARPTIDSLM 342

>YPL141C (YPL141C) [5305] chr16 complement(283463..286060)
           Serine/threonine protein kinase with similarity to Kin4p
           [2598 bp, 865 aa]
          Length = 865

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 54/239 (22%), Positives = 107/239 (44%), Gaps = 42/239 (17%)

Query: 90  LAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNEMRNEVSVMKQ 149
           L EG F  + +     ++N          +V  +  +KR  ++     N+ R EV + ++
Sbjct: 47  LGEGEFGKVKLGWPKNFSNSSNSTFDFPKQVA-IKLIKRDSIS-----NDYRKEVKIYRE 100

Query: 150 LSGC-----PNIVQYYDS-HASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQ 203
           ++       PNIV+  +    SR         + +++E         Y+ ++   +L E 
Sbjct: 101 INALKHLSHPNIVKLEEVLQNSRY--------IGIVLEYACGGEFYKYIQKK--RRLKEM 150

Query: 204 EILKIMFDVTRALAQMHYL-PVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTH 262
              ++    ++ ++ +HY+    L+HRD+K+EN+L+D N N  + DFG  +  F   N  
Sbjct: 151 NACRLF---SQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNE-FCSRNEL 206

Query: 263 QEIAVLTNNIYVHTTPQYRSPEMI---DLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 318
            + +          +P Y +PE++   + Y       K+DIW+ G+ LY +L    P++
Sbjct: 207 MKTSC--------GSPCYAAPELVISAEPYEA----RKADIWSCGVILYAILAGYLPWD 253

>AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C
           (TPK1) - SH] (405062..406222) [1161 bp, 386 aa]
          Length = 386

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 63/127 (49%), Gaps = 21/127 (16%)

Query: 211 DVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTN 270
           +V  AL  +H     +I+RD+K EN+L+D N + KL DFG       V  T         
Sbjct: 182 EVCLALEYLH--SKDIIYRDLKPENILLDKNGHIKLTDFGFAKYVPDVTYT--------- 230

Query: 271 NIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF---ELTGQFA-IL 326
              +  TP Y +PE++      P N+  D W+ GI +Y++L   TPF      G +  IL
Sbjct: 231 ---LCGTPDYIAPEVVS---TKPYNKSVDWWSFGILIYEMLAGYTPFYDQNTMGTYENIL 284

Query: 327 HSKYEFP 333
           +++ +FP
Sbjct: 285 NAEVKFP 291

>AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH]
           complement(274336..275376) [1041 bp, 346 aa]
          Length = 346

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 58/107 (54%), Gaps = 17/107 (15%)

Query: 211 DVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTN 270
           +VT AL  +H     +I+RD+K EN+L+D N + K+ DFG            +E+  +T 
Sbjct: 142 EVTLALEYLH--AHNIIYRDLKPENILLDRNGHIKITDFGFA----------KEVDTVTW 189

Query: 271 NIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 317
            +    TP Y +PE+I      P N+  D W+LGI ++++L   TPF
Sbjct: 190 TL--CGTPDYIAPEVI---TTKPYNKSIDWWSLGILIFEMLAGYTPF 231

>Scas_633.29
          Length = 789

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 78/320 (24%), Positives = 136/320 (42%), Gaps = 61/320 (19%)

Query: 70  QLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRV 129
           +L   + + V +   E ++ L  GG + +Y V+     N   +V            LKRV
Sbjct: 286 KLAKRNTITVNDTEYEKIELLGRGGSSRVYKVK-----NSQNKV----------FALKRV 330

Query: 130 LVT--DENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNS 187
                D++ ++  + E+ ++++LS    +V+ +D          SG  + L+ME C ++ 
Sbjct: 331 SFDEFDDSSVDGFKGEIELLEKLSNESRVVKLFDYQMD------SGV-LFLIME-CGDHD 382

Query: 188 LLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLC 247
           L   ++QR    L    +     +V R +  +H     ++H D+K  N  V      K+ 
Sbjct: 383 LSQILSQRSDMPLDMDFVRYHAREVVRCIKIVH--DAGIVHSDLKPAN-FVFVKGILKII 439

Query: 248 DFGSTSTCFPVANTHQEIAVLTNNIYVHT---TPQYRSPEMI---------DLYRCLPIN 295
           DFG       +AN    I   T NIY      TP Y +PE +         D      + 
Sbjct: 440 DFG-------IANA---IPDHTVNIYRENQIGTPNYMAPEALVAMNYTNENDGGNKWKVG 489

Query: 296 EKSDIWALGIFLYKLLFYTTPFE-LTGQ---FAILHSKY-----EFPVNNYS--SKLINL 344
           + SDIW+ G  +Y++++   P+    GQ    AI++        E   NN S    LI+L
Sbjct: 490 KPSDIWSCGCIIYQMIYGRPPYAGFQGQNRLLAIMNPDVKVIFSEKTANNESIPRSLIDL 549

Query: 345 IIIMLAENPNLRPNIYQVMD 364
           +   L  +P  R ++ QV++
Sbjct: 550 MKGCLTRDPEKRWSVDQVLE 569

>ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C
           (MRK1) - SH] complement(1141943..1143085) [1143 bp, 380
           aa]
          Length = 380

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 60/216 (27%), Positives = 98/216 (45%), Gaps = 27/216 (12%)

Query: 115 TIKLEVGDLACLKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGF 174
           T+  + G+   +K+VL  D    N    E+ +MK L   PN+V     H   +   ++  
Sbjct: 49  TVIEQTGEKVAIKKVL-QDRRFKNR---ELEIMKLLQH-PNVVDL-RYHFYESEPQTNEV 102

Query: 175 EVTLLMELCPNN---SLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDV 231
            + L++E  P +    L  ++  RL   +   EI   MF + ++L  +H +   + HRD+
Sbjct: 103 YLNLILEYMPQSLYQRLRHFVTGRLL--MPRDEIKVYMFQLFKSLNYLHRV-ARVCHRDI 159

Query: 232 KIENVLVDANH-NFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYR 290
           K +N+LVDA     KLCDFGS     P             N+    +  YR+PE+I  + 
Sbjct: 160 KPQNLLVDAGTLQLKLCDFGSAKQLRPTE----------PNVSYICSRYYRAPELI--FG 207

Query: 291 CLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAIL 326
                 + DIW+ G  + +LL     F   G+F I+
Sbjct: 208 ATNYTTQIDIWSTGCVMAELLLGQPMF--PGEFVIV 241

>Scas_720.103
          Length = 804

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 75/304 (24%), Positives = 123/304 (40%), Gaps = 49/304 (16%)

Query: 77  VIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTI-KLEVGDLACLKRVLVTDEN 135
           + V     E +K L +G    +++V+  +  N L  +    K ++     +KRV+   E 
Sbjct: 398 IKVNPQSFEKIKLLGQGDVGKVFLVK-EKKTNGLYAMKIYNKKDMIKREKIKRVITEQE- 455

Query: 136 GLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQR 195
                      +   S  P IV  Y  H+ +  D      + L ME C        +  R
Sbjct: 456 -----------ILATSNHPFIVTLY--HSFQTED-----YLYLCMEYCMGGEFFRALQTR 497

Query: 196 LATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFG----S 251
            +  + E +      +V  AL  +H L    I+RD+K EN+L+  + +  L DF     +
Sbjct: 498 DSKCICEDDARFYASEVLAALEYLHLLG--FIYRDLKPENILLHKSGHIMLSDFDLSVHA 555

Query: 252 TSTCFPVANTHQEIAVLTNNIYVHT--------------TPQYRSPEMIDLYRCLPINEK 297
             +  P+      +    +N+ V T              T +Y +PE+I   R       
Sbjct: 556 KDSKNPIFMKDGILPTTNSNLIVDTKICSEGFRTNSFVGTEEYIAPEVI---RGNGHTVA 612

Query: 298 SDIWALGIFLYKLLFYTTPFE---LTGQFA-ILHSKYEFP-VNNYSSKLINLIIIMLAEN 352
            D W LGI ++++LF  TPF+       FA IL   +EFP  N+ +    NLI  +L +N
Sbjct: 613 VDWWTLGILIFEMLFGKTPFKGDTTNETFANILSKDFEFPNSNDITRNCKNLIKKLLTKN 672

Query: 353 PNLR 356
              R
Sbjct: 673 ETKR 676

>YDR283C (GCN2) [1112] chr4 complement(1025062..1030041)
           Serine/threonine protein kinase that regulates
           initiation of translation by phosphorylation of
           eIF2alpha (Sui2p), involved in general amino acid
           control response and salt tolerance [4980 bp, 1659 aa]
          Length = 1659

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 93/196 (47%), Gaps = 31/196 (15%)

Query: 180 MELCPNNSLLDYMNQRLATKLSEQ--EILKIMFDVTRALAQMHYLPVPLIHRDVKIENVL 237
           ME C N +L D ++   +  L++Q  E  ++   +  AL+ +H     +IHRD+K  N+ 
Sbjct: 788 MEYCENRTLYDLIH---SENLNQQRDEYWRLFRQILEALSYIH--SQGIIHRDLKPMNIF 842

Query: 238 VDANHNFKLCDFGSTSTCFPVANTHQEIAVLT-----------NNIYVHTTPQYRSPEMI 286
           +D + N K+ DFG         N H+ + +L            N      T  Y + E++
Sbjct: 843 IDESRNVKIGDFG------LAKNVHRSLDILKLDSQNLPGSSDNLTSAIGTAMYVATEVL 896

Query: 287 DLYRCLPINEKSDIWALGIFLYKLLF-YTTPFELTGQFAILHS-KYEFPVNNYSSKL--- 341
           D       NEK D+++LGI  +++++ ++T  E       L S   EFP +   +K+   
Sbjct: 897 D--GTGHYNEKIDMYSLGIIFFEMIYPFSTGMERVNILKKLRSVSIEFPPDFDDNKMKVE 954

Query: 342 INLIIIMLAENPNLRP 357
             +I +++  +PN RP
Sbjct: 955 KKIIRLLIDHDPNKRP 970

>Sklu_1603.2 YPR054W, Contig c1603 1858-3324 reverse complement
          Length = 488

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 104/237 (43%), Gaps = 38/237 (16%)

Query: 78  IVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRV--LVTDEN 135
           I GN+  E+++ L +G +    VV  ++ +N          E G    +K++  +   E 
Sbjct: 117 IPGNY--EVLQVLGKGSYGT--VVSAVDNSNP---------EYGVRIAIKKITNIFHREV 163

Query: 136 GLNEMRNEVSVMKQLSGCPNIVQYYDSH--ASRARDGSSGFEVTLLMELCPNNSLLDYMN 193
            L     E+  M    G  NI+   D    + +  DG   ++            L+DY  
Sbjct: 164 LLKRAIRELKFMNYFKGHKNIINLLDLDIVSEKPYDGLYCYQ-----------ELIDYDL 212

Query: 194 QRL---ATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFG 250
            R+   + +LSE  I   ++ +   L  +H   V  IHRD+K  N+L   + N K+CDFG
Sbjct: 213 ARVIHSSVQLSEFHIKSFLYQILCGLKYIHSADV--IHRDLKPGNILCTIHGNLKICDFG 270

Query: 251 STSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFL 307
                 P     + ++ +TN +    T  YR+PE+I  ++    ++  D+WA+G  L
Sbjct: 271 LARGVSPQFFQGRTVSHITNYV---ATRWYRAPELILSHK--NYSKAIDMWAVGCIL 322

>YJL187C (SWE1) [2737] chr10 complement(76802..79261)
           Serine/tyrosine dual-specificity protein kinase,
           phosphorylates Cdc28p on tyrosine and inhibits its
           activity, involved in G2 phase cell-cycle checkpoint
           control [2460 bp, 819 aa]
          Length = 819

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 110/227 (48%), Gaps = 30/227 (13%)

Query: 87  VKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNEMRNEVSV 146
           V  + +G F+ +Y V F +  N+   +  IK        LKR+L+ +   LNE+ N++++
Sbjct: 447 VHSIGKGQFSTVYQVTFAQ-TNKKYAIKAIK--PNKYNSLKRILL-EIKILNEVTNQITM 502

Query: 147 MKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATK---LSEQ 203
            ++  G   I+ Y  S   +           ++ ELC N +L  ++ +++  K   L + 
Sbjct: 503 DQE--GKEYIIDYISSWKFQN-------SYYIMTELCENGNLDGFLQEQVIAKKKRLEDW 553

Query: 204 EILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQ 263
            I KI+ +++ AL  +H     ++H D+K  NV++    N KL DFG  +T  P+ +   
Sbjct: 554 RIWKIIVELSLALRFIHD-SCHIVHLDLKPANVMITFEGNLKLGDFG-MATHLPLEDKSF 611

Query: 264 EIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 310
           E              +Y +PE+I    C   + K+DI++LG+ + ++
Sbjct: 612 E---------NEGDREYIAPEIIS--DC-TYDYKADIFSLGLMIVEI 646

>Kwal_0.96
          Length = 427

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 73/296 (24%), Positives = 132/296 (44%), Gaps = 46/296 (15%)

Query: 88  KYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNEMRNEVSVM 147
           K L  G F    VVR     +  E V  IK+       LK+ L   +  L  + +E+S++
Sbjct: 50  KTLGAGSFG---VVRQARQVSSGENV-AIKI------LLKKALKGKDVELQMLYDELSIL 99

Query: 148 KQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQEILK 207
           ++L   PNIV++ D   S+ +         ++ +L     L D + ++   K +E++ ++
Sbjct: 100 QKLDH-PNIVKFKDWFESKDK-------FYIVTQLATGGELFDRILKQ--GKFTEEDAVR 149

Query: 208 IMFDVTRALAQMHYLPVPLIHRDVKIENVLV---DANHNFKLCDFGSTSTCFPVANTHQE 264
           I++ + +A+  +H     ++HRD+K EN+L     A+    L DFG       + N  + 
Sbjct: 150 IVYQILKAVEYLH--SRNIVHRDLKPENLLYLTEAADSQLVLGDFGIAK---ELKNDDEL 204

Query: 265 IAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF--ELTGQ 322
           I     ++       Y +PE++         +  DIW+LG+  Y LL   +PF  E    
Sbjct: 205 IHKAAGSM------GYVAPEVV---TTSGHGKPCDIWSLGVVTYTLLCGYSPFVAESVEG 255

Query: 323 FAILHSKYEFPV-------NNYSSKLINLIIIMLAENPNLRPNIYQVMDNLCSILK 371
           F    +    PV       +N S++  + I+  L  NP+ RP   +++ +   I K
Sbjct: 256 FLEECTIGRTPVTFHKPYWSNISNEAKDFILRALTVNPHDRPTATELLQDAWIISK 311

>Kwal_14.1416
          Length = 365

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 63/118 (53%), Gaps = 12/118 (10%)

Query: 197 ATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCF 256
              LS+  I    + + RAL  +H   V  IHRD+K  N+L+++N + K+CDFG  + C 
Sbjct: 109 GASLSDDHIQYFTYQILRALKAIHSAQV--IHRDIKPSNLLLNSNCDLKVCDFG-LARCL 165

Query: 257 PVANTHQE---IAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLL 311
            +++TH     +  +T  +    T  YR+PE++  ++   +    DIW+ G  L +++
Sbjct: 166 -ISSTHSRQNLVGFMTEYV---ATRWYRAPEIMLTFQQYTV--AMDIWSCGCILAEMI 217

>CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomyces
           cerevisiae YHR030c SLT2, hypothetical start
          Length = 488

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 60/246 (24%), Positives = 103/246 (41%), Gaps = 33/246 (13%)

Query: 71  LKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANE----LEQVPTIKLEVGDLACL 126
            K  +Q    + R E++K +  G +  +   RF E + E    +++V  I  +   L C 
Sbjct: 8   FKVFNQDFTIDKRFELIKEIGHGAYGIVCSARFTEASEETTVAIKKVTNIFSKT--LLC- 64

Query: 127 KRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGS-SGFEVTLLMELCPN 185
           KR L            E+ +++   G  NI   YD       DGS +G  +   +  C  
Sbjct: 65  KRSL-----------RELKLLRHFRGHKNITCLYDMDIVFYPDGSINGLYLYEELMECDM 113

Query: 186 NSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245
           + ++     +    L++       + +   L  +H   V  +HRD+K  N+LV+A+   K
Sbjct: 114 HQII-----KSGQALTDAHYQSFTYQILCGLKYIHSADV--LHRDLKPGNLLVNADCQLK 166

Query: 246 LCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 305
           +CDFG         N  +    LT  +    T  YR+PE++  Y+     +  DIW+ G 
Sbjct: 167 ICDFGLARGY--SENPEENNQFLTEYV---ATRWYRAPEIMLSYQ--GYTKAIDIWSTGC 219

Query: 306 FLYKLL 311
            L + L
Sbjct: 220 ILAEFL 225

>CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 521

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 54/235 (22%), Positives = 99/235 (42%), Gaps = 34/235 (14%)

Query: 83  RVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNEMRN 142
           R  I   +  G F  +Y  +   + NE+  V  + LE              E  +  +  
Sbjct: 4   RFVIENCIGRGNFGDVYKAK-DTWLNEVVAVKVVNLE------------NSEEEVELLAQ 50

Query: 143 EVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSE 202
           E+  + +L   P +  Y    A+   D S    + + ME C   S+ D +     + L E
Sbjct: 51  EIFFLAELKS-PYVTNYI---ATVVEDVS----MWIAMEYCGGGSVGDLLKYHYTSGLPE 102

Query: 203 QEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTH 262
            +   I  ++ + L+ +H      IHRD+K  N+L+      KL DFG +          
Sbjct: 103 HKTRFITREILKGLSYLH--SQRKIHRDIKAANILLTDEGKVKLSDFGVSGKL------- 153

Query: 263 QEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 317
             ++    + +V  TP + +PE++  +     +E++DIW+LGI + ++L  + P 
Sbjct: 154 --LSSFRRDTFV-GTPYWMAPEIV-AHDSEGYDERADIWSLGITVIEMLRGSPPL 204

>Kwal_47.18307
          Length = 621

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 90/194 (46%), Gaps = 21/194 (10%)

Query: 178 LLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVL 237
            ++E      LL  + QRL  +L+E     I   +   +  MH   V  IHRD+K ENVL
Sbjct: 89  FVLEYVSGGELLALI-QRLG-RLTEDLSRHITAQLVDTVDYMHSKGV--IHRDLKPENVL 144

Query: 238 VDANHNFKLCDFGSTSTCF--PVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPIN 295
           +       + DFG+  T       NT +  + +        T +Y SPE++   +C    
Sbjct: 145 LSQEGRVVITDFGAACTAADRKFENTKRTASFV-------GTAEYVSPELLLHSQC---G 194

Query: 296 EKSDIWALGIFLYKLLFYTTPF----ELTGQFAILHSKYEFPVNNYSSKLINLIIIMLAE 351
             SDIWALG  +Y+L     PF    EL     I+   Y++  +N S ++++++  +L  
Sbjct: 195 FSSDIWALGCIIYQLNQGKPPFRGENELQTFEKIVALDYKWLFSN-SPQVVSIVQSILVT 253

Query: 352 NPNLRPNIYQVMDN 365
           +P  RP+  Q+  N
Sbjct: 254 DPLKRPSAAQLKQN 267

>Scas_477.5
          Length = 703

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 85/181 (46%), Gaps = 22/181 (12%)

Query: 137 LNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRL 196
           ++ +++E++++K+L    NIV YY S          G  + + +E  P  S+   +N   
Sbjct: 485 VDALQHEMNLLKELHH-ENIVTYYGS-------SQEGPNLNIFLEYVPGGSVSSMLNNY- 535

Query: 197 ATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCF 256
                E  I+  +  V   +A +H   +  IHRD+K  N+L+D     K+ DFG +    
Sbjct: 536 -GPFEESLIVNFIRQVLIGVAYLHNKNI--IHRDIKGANILIDTKGCVKITDFGISKKLS 592

Query: 257 PVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 316
           P++   +  A L  ++Y      + +PE++   +     EK+DIW+ G  + ++     P
Sbjct: 593 PLSKQDKR-ASLQGSVY------WMAPEVV---KQTATTEKADIWSTGCVVIEMFTGKHP 642

Query: 317 F 317
           F
Sbjct: 643 F 643

>KLLA0F24618g complement(2288943..2290613) similar to sp|P38070
           Saccharomyces cerevisiae YBR028c, start by similarity
          Length = 556

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 72/299 (24%), Positives = 130/299 (43%), Gaps = 35/299 (11%)

Query: 27  AQHTPVLVVRSTNHLRMSKSETSSHHVVSGLNSSRSGTLPVLEQLKTGSQVIVGNHRVEI 86
           AQHT  L   S N    S  ET     VS +  +R        QL+  S    G  RV  
Sbjct: 120 AQHTIRL---SLNAQGDSDKETRDVLSVSSVEETR--------QLRASSFSKTGAPRVLD 168

Query: 87  ----VKYLAEGGFAHIYVVR--FIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNEM 140
               ++ L EG +  + +V+         ++Q+   ++ + + +  K    T E  +   
Sbjct: 169 DFVPIRCLGEGAYGKVLLVKDSLSSKLYAMKQLKKAEILISEDSIEKDANTTVEKRIERT 228

Query: 141 RNEVSVMKQLSGCPNIVQ-YYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATK 199
             E +++ QL   PNIV+ +Y  H +         ++ L+++  P   L  ++ ++    
Sbjct: 229 FAERTILSQLEH-PNIVKLFYSFHDNH--------KLYLVLQYIPGGELFYHLKEQ--GT 277

Query: 200 LSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFG-STSTCFPV 258
           L E  +     +++ AL  +H     +++RD+K EN L++   +  L DFG S  + F  
Sbjct: 278 LDEGTVAFYAAELSCALKFLH--SKGIVYRDLKPENCLLNERGHLVLTDFGLSKKSVFDD 335

Query: 259 ANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 317
           A T +E   +     +  TP+Y +PE++      P  +  D ++LG  +Y +L    PF
Sbjct: 336 AATPEEGENVNQLYSIIGTPEYCAPEIL---AGEPYTQNCDWYSLGCLVYDMLIGKPPF 391

>ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..27572)
           [1098 bp, 365 aa]
          Length = 365

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 60/112 (53%), Gaps = 6/112 (5%)

Query: 200 LSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVA 259
           LS+  I    + + RAL  +H   V  IHRD+K  N+L++++ + KLCDFG  S C   +
Sbjct: 112 LSDDHIQYFTYQILRALKSLHSAQV--IHRDLKPSNLLLNSSCDLKLCDFG-LSRCLASS 168

Query: 260 NTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLL 311
           +  +E  V     YV  T  YR+PE++  ++        DIW+ G  L +++
Sbjct: 169 DRSRENMVGFMTEYV-ATRWYRAPEIMLSFQ--EYTTAMDIWSCGCILAEMI 217

>ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..683847)
            [3450 bp, 1149 aa]
          Length = 1149

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 57/278 (20%), Positives = 120/278 (43%), Gaps = 44/278 (15%)

Query: 86   IVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNEMRNE-- 143
            ++K L +G F  + + R    +   +++  IK+       LK+  +   + +   R E  
Sbjct: 824  LLKVLGKGNFGKVLLAR----SKNTDRLCAIKV-------LKKDHIIQNHDIESARAEKK 872

Query: 144  VSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYM-NQRLATKLSE 202
            V ++   +  P +   Y S  +  R       +   ME      L+ ++ NQRL+ + ++
Sbjct: 873  VFLLATKAKHPFLTNLYCSFQTENR-------IYFAMEFIGGGDLMWHVQNQRLSVRRAK 925

Query: 203  QEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTH 262
                +++      LA  ++    +I+RD+K+EN+L+    + K+ D+G         N  
Sbjct: 926  FYAAEVL------LALKYFHDNGIIYRDLKLENILLTLEGHIKIADYGLCKDEMWFGNRT 979

Query: 263  QEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQ 322
                          TP++ +PE++   R     +  D WA G+ LY++L   +PF    +
Sbjct: 980  STFC---------GTPEFMAPEIL---REQAYTKAVDWWAFGVLLYQMLLCQSPFSGDDE 1027

Query: 323  ----FAILHSKYEFPVNNYSSKLINLIIIMLAENPNLR 356
                 AIL  +  +P+ + +  ++ +   +L ++P  R
Sbjct: 1028 DEVFNAILTDEPLYPI-DMAGDIVQIFQGLLTKDPEKR 1064

>YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine
           protein kinase involved in the filamentous and invasive
           growth pathway, member of the MAP kinase family [1107
           bp, 368 aa]
          Length = 368

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 61/114 (53%), Gaps = 6/114 (5%)

Query: 198 TKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFP 257
           + LS+  +    + + RAL  +H   V  IHRD+K  N+L+++N + K+CDFG  + C  
Sbjct: 113 STLSDDHVQYFTYQILRALKSIHSAQV--IHRDIKPSNLLLNSNCDLKVCDFG-LARCLA 169

Query: 258 VANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLL 311
            ++  +E  V     YV  T  YR+PE++  ++        DIW+ G  L +++
Sbjct: 170 SSSDSRETLVGFMTEYV-ATRWYRAPEIMLTFQ--EYTTAMDIWSCGCILAEMV 220

>Kwal_17.2687
          Length = 362

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 75/146 (51%), Gaps = 22/146 (15%)

Query: 175 EVTLLMELCPNNSLLDYMNQRLATK-LSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKI 233
           EV ++ EL   +     +++ +AT+ LS+  I   ++ + RAL  +H   V  IHRD+K 
Sbjct: 88  EVYIIQELMDTD-----LHRVIATQTLSDDHIQYFVYQILRALKCLHGAEV--IHRDLKP 140

Query: 234 ENVLVDANHNFKLCDFGSTSTCFPVA----NTHQEIAVLTNNIYVHTTPQYRSPEMIDLY 289
            N+LV+AN + KLCDFG  + C  +     NT +         YV  T  YR+PE++   
Sbjct: 141 ANLLVNANCDVKLCDFG-LARCAGMGPGASNTGKAGEAGQMTEYV-ATRWYRAPEVM--- 195

Query: 290 RCLPINEKS---DIWALGIFLYKLLF 312
             L   E +   D+W+ G  L +LL 
Sbjct: 196 --LTAAEYTFAMDVWSCGCILAELLL 219

>Kwal_56.24059
          Length = 353

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 57/107 (53%), Gaps = 17/107 (15%)

Query: 211 DVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTN 270
           +V  AL  +H     +I+RD+K EN+L+D N + K+ DFG            +E+  +T 
Sbjct: 149 EVILALEYLH--SHDIIYRDLKPENILLDRNGHIKITDFGFA----------KEVDTVTW 196

Query: 271 NIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 317
            +    TP Y +PE+I      P N+  D W+LGI ++++L   TPF
Sbjct: 197 TL--CGTPDYIAPEVI---ATKPYNKSVDWWSLGILIFEMLAGYTPF 238

>ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -
           SH] (398519..399607) [1089 bp, 362 aa]
          Length = 362

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 84/182 (46%), Gaps = 26/182 (14%)

Query: 143 EVSVMKQLSGCPNIV--QYYDSHASRARDGSSGFEVTLLMELCP---NNSLLDYMNQRLA 197
           E+++++ ++  PN+V  +Y+ +H S + DG       L ME  P    + +L Y   +L 
Sbjct: 70  ELAILR-IADHPNVVKLEYFFTHVSPS-DGKV--YQHLAMECLPETLQHEILRYTQNKLE 125

Query: 198 TKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHN-FKLCDFGSTSTCF 256
             L  + I    + + R +  +H L +   HRD+K  N+LVD      K+CDFGS     
Sbjct: 126 LPL--KHIKMYTYQIARGMLYLHALGI--CHRDIKPSNILVDPKSGVLKICDFGSAKK-- 179

Query: 257 PVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 316
            +      I+ + +         YR+PE+I    C     + DIW LG  + ++L     
Sbjct: 180 -LEQNQPSISYICSRF-------YRAPELI--VGCTQYTTQIDIWGLGCVIGEMLIGKAV 229

Query: 317 FE 318
           F+
Sbjct: 230 FQ 231

>Scas_700.34
          Length = 864

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 84/176 (47%), Gaps = 22/176 (12%)

Query: 143 EVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSE 202
           E++ +K L+  PNIV+  +   +    G       +++E         Y+ ++   +L E
Sbjct: 107 EINALKHLTH-PNIVKLEEVLQNSKYIG-------IVLEYASGGEFYKYIQRK--KRLKE 156

Query: 203 QEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTH 262
               ++   +   +  +H     L+HRD+K+EN+L+D + N  + DFG  S  +    +H
Sbjct: 157 GPACRLFAQLINGVHYIHS--KGLVHRDLKLENLLLDKHENLIITDFGFVSEFY----SH 210

Query: 263 QEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 318
            E+   +       +P Y +PE++   +     +K+DIW+ G+ LY +L    P++
Sbjct: 211 GELMKTSCG-----SPCYAAPELVVSTKPYEA-KKADIWSCGVILYAMLAGYLPWD 260

>Scas_584.11
          Length = 1074

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 82/191 (42%), Gaps = 41/191 (21%)

Query: 143 EVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSE 202
           EV ++ ++    NIV   D            F+  ++ME C    L + +   L  K + 
Sbjct: 108 EVDILTKVGKHKNIVSLVDY-----------FDSYIIMEYCSGGDLYEAIKDDLVPKKT- 155

Query: 203 QEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDA-NHNFKLCDFGSTSTCFPVANT 261
           + I  I   +  A+  +H     + HRD+K EN+L+   +   KL D+G       +A T
Sbjct: 156 KTITHIFSQIMDAIEFVH--GKSIYHRDIKPENILITGIDWTIKLTDWG-------LATT 206

Query: 262 HQEIAVLTNNIYVHTTPQYRSPEMID----------LYRCLPINEKSDIWALGIFLYKLL 311
           H+     T+      + +Y +PE+ +           Y+C    +K D+WA+GI    ++
Sbjct: 207 HE-----TSFDRSVGSERYMAPELFESNLDIEERKEAYKC----DKVDLWAMGIVFLNIV 257

Query: 312 FYTTPFELTGQ 322
           F   PF +  Q
Sbjct: 258 FQKNPFSVANQ 268

>KLLA0E07414g complement(672690..673787) highly similar to sp|P21965
           Saccharomyces cerevisiae YNL307c MCK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 365

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 80/182 (43%), Gaps = 26/182 (14%)

Query: 143 EVSVMKQLSGCPNIV--QYYDSHASRARDGSSGFEVTLLMELCP---NNSLLDYMNQRLA 197
           E+ +++ ++  PN+V  +Y+ +H S            L ME  P    N +L Y    L 
Sbjct: 72  ELEILR-IADHPNVVKLEYFYTHISPT---DHKLYQHLAMECLPEMLQNEILRYKKNNLE 127

Query: 198 TKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHN-FKLCDFGSTSTCF 256
             L   ++    + + R +  +H L +   HRD+K  NVLVD      K+CDFGS     
Sbjct: 128 LPLKHVKLYA--YQIARGMLYLHALGI--CHRDIKPSNVLVDPQTGILKICDFGSAKK-- 181

Query: 257 PVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 316
            + +    I+ + +         YR+PE+I    C     K DIW LG  L ++L     
Sbjct: 182 -LESNQPSISYICSRY-------YRAPELI--VGCTQYTTKIDIWGLGCVLGEMLLGKAV 231

Query: 317 FE 318
           F+
Sbjct: 232 FQ 233

>KLLA0E03487g complement(323764..325707) similar to sgd|S0002874
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 647

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 108/246 (43%), Gaps = 31/246 (12%)

Query: 124 ACLKRVLVTDENGLNEMRNEVSVMKQLS--GCPNIVQ-YYDSHASRARDGSSGFEVTLLM 180
            C K+ +++ EN +  +  E + +  L+    P I++ YY  H S          +  ++
Sbjct: 40  VCSKKHIIS-ENKVKYVTIEKNTLNLLAHGNHPGIIKLYYTFHDSE--------NLYFVL 90

Query: 181 ELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDA 240
           +  P   LL  +  +   + +E      M  +  AL  +H   V  +HRD+K EN+L+ +
Sbjct: 91  DFAPGGELLQLLQTQ--GRFNEAWTKHFMCQLIDALEYIHGCKV--VHRDLKPENLLLSS 146

Query: 241 NHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDI 300
                + DFG  S      N       L++      T +Y SPE++   +    N  SDI
Sbjct: 147 EGKLMITDFGVASNLAATDN-------LSSTSSFVGTAEYVSPELLLQNKS---NFCSDI 196

Query: 301 WALGIFLYKLLFYTTPF----ELTGQFAILHSKYEFPVNNYSSKLINLIIIMLAENPNLR 356
           WA+G  LY+    T PF    EL     I++  Y + +   S  + +L+  +L  +P+ R
Sbjct: 197 WAVGCMLYQFTQGTPPFRGENELAAFEKIVNLDYHW-IYMVSQHITDLVSKILVLDPDSR 255

Query: 357 PNIYQV 362
             + Q+
Sbjct: 256 YTLPQI 261

>YHR082C (KSP1) [2372] chr8 complement(268460..271549)
           Serine/threonine kinase that suppresses prp20 mutant
           when oveproduced [3090 bp, 1029 aa]
          Length = 1029

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 70/160 (43%), Gaps = 30/160 (18%)

Query: 174 FEVTLLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKI 233
           F+  ++ME C    L + +      K + + I  I+  +  A+  +H   +   HRD+K 
Sbjct: 154 FDSYIIMEYCSGGDLYEAIKADAVPKKT-KSITHIITQIMDAIEYVHNKGI--YHRDIKP 210

Query: 234 ENVLVDA-NHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDL---- 288
           EN+L+   +   KL D+G  +T         +   +  N+    + +Y SPE+ D     
Sbjct: 211 ENILISGIDWTIKLTDWGLATT---------DKTSMDRNV---GSERYMSPELFDSNLDI 258

Query: 289 ------YRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQ 322
                 Y C     K D+WA+GI    ++F+  PF +  Q
Sbjct: 259 KERKEPYDCA----KVDLWAMGIVFLNIVFHKNPFSIANQ 294

>Kwal_26.8703
          Length = 444

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 91/206 (44%), Gaps = 42/206 (20%)

Query: 156 IVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRL---ATKLSEQEILKIMFDV 212
           IV+YY   A  +        + + ME     SL D + + L     ++ E+ + KI   V
Sbjct: 216 IVRYYGMFAEESTS-----SIYIAMEYMGGKSL-DAIYKHLLERGGRIGEKVLGKIAESV 269

Query: 213 TRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNI 272
            + L+ +    +  IHRD+K +N+L++     KLCDFG +            +AV +   
Sbjct: 270 LKGLSYLQERKI--IHRDIKPQNILLNEAGQVKLCDFGVSG-----------VAVNSLAT 316

Query: 273 YVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEF 332
               T  Y +PE I   +  P +  SD+W+LG+ L +               +   ++ F
Sbjct: 317 TFTGTSFYMAPERI---QGQPYSVTSDVWSLGLTLLE---------------VAQGQFPF 358

Query: 333 PVNNYSSKL--INLIIIMLAENPNLR 356
             +N ++ +  I L++++L   P L+
Sbjct: 359 GSDNMAANMPPIELLMLILTFTPALK 384

>KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31, start by similarity
          Length = 1229

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 83/177 (46%), Gaps = 30/177 (16%)

Query: 196  LATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTC 255
            L T ++E E   +   V   +  +H     ++HRD+K ENV+VD     KL DFGS +  
Sbjct: 1071 LKTNMTEFEAKLLFKQVASGIKHLH--DNGIVHRDIKDENVIVDNKGFVKLIDFGSAAY- 1127

Query: 256  FPVANTHQEIAVLTNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLFY 313
                     +     +++V T   Y +PE++  + Y   P     DIWA+G+ LY +++ 
Sbjct: 1128 ---------VKSGPFDVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAIGVLLYTIIYK 1173

Query: 314  TTPFE-----LTGQFAILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQVMDN 365
              PF      L G   I  S +E      S++ + LI  +L  + + RP I  +M++
Sbjct: 1174 ENPFYNIDEILDGDLRI-QSTHEV-----SAECVALIRKILNRSVSKRPTIDDIMED 1224

>YFR014C (CMK1) [1695] chr6 complement(172529..173869)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type I [1341 bp, 446 aa]
          Length = 446

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/266 (21%), Positives = 121/266 (45%), Gaps = 39/266 (14%)

Query: 126 LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPN 185
           +K+ L  ++  L  + +E+ ++++L   PNIV + D   S+ +         ++ +L   
Sbjct: 69  IKKALKGNKVQLEALYDELDILQRLHH-PNIVAFKDWFESKDK-------FYIITQLAKG 120

Query: 186 NSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVL-VDANHN- 243
             L D + ++   K +E++ ++I+ ++  A+  MH   +  +HRD+K EN+L +D +   
Sbjct: 121 GELFDRILKK--GKFTEEDAVRILVEILSAVKYMHSQNI--VHRDLKPENLLYIDKSDES 176

Query: 244 -FKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 302
              + DFG          + +E+         +  P+  + +           +  DIW+
Sbjct: 177 PLVVADFGIAKRL----KSDEELLYKPAGSLGYVAPEVLTQD--------GHGKPCDIWS 224

Query: 303 LGIFLYKLLFYTTPF--ELTGQFAILHSKYEFPV-------NNYSSKLINLIIIMLAENP 353
           +G+  Y LL   + F  E    F    +  E+PV       ++ S+K    I+  L  +P
Sbjct: 225 IGVITYTLLCGYSAFRAERVQDFLDECTTGEYPVKFHRPYWDSVSNKAKQFILKALNLDP 284

Query: 354 NLRPNIYQVMDN---LCSILKVKNPL 376
           + RP   +++++   +C+ LK  N L
Sbjct: 285 SKRPTAAELLEDPWIICTELKTHNLL 310

>YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic
           subunit of cAMP-dependent protein kinase 3, protein
           kinase A or PKA [1197 bp, 398 aa]
          Length = 398

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/256 (23%), Positives = 114/256 (44%), Gaps = 48/256 (18%)

Query: 85  EIVKYLAEGGFAHIYVVRFIEYANELEQVPTIK-LEVGDLACLKRVLVTDENGLNEMRNE 143
           +I++ L  G F  ++++R    +N   +   +K L+   +  LK+V  T     N+ R  
Sbjct: 89  QILRTLGTGSFGRVHLIR----SNHNGRFYALKTLKKHTIVKLKQVEHT-----NDERRM 139

Query: 144 VSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYM--NQRLATKLS 201
           +S++      P I++ + +            +V ++M+      L   +  +QR    ++
Sbjct: 140 LSIVSH----PFIIRMWGTFQDSQ-------QVFMVMDYIEGGELFSLLRKSQRFPNPVA 188

Query: 202 EQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANT 261
           +        +V  AL  +H     +I+RD+K EN+L+D N + K+ DFG       V  T
Sbjct: 189 KFYAA----EVCLALEYLH--SKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYT 242

Query: 262 HQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTG 321
                       +  TP Y +PE++      P N+  D W+ G+ +Y++L   TPF  + 
Sbjct: 243 ------------LCGTPDYIAPEVVS---TKPYNKSVDWWSFGVLIYEMLAGYTPFYNSN 287

Query: 322 QFA----ILHSKYEFP 333
                  IL+++ +FP
Sbjct: 288 TMKTYENILNAELKFP 303

>YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine
           protein kinase with similarity to Ste20p and Cla4p [1968
           bp, 655 aa]
          Length = 655

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/205 (22%), Positives = 98/205 (47%), Gaps = 28/205 (13%)

Query: 120 VGDLACLKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLL 179
           VG+   +K++ ++++     + NE+ VM   S   NIV + +++           E+ ++
Sbjct: 399 VGERVAIKQIRLSEQPKKQLIMNELLVMND-SRQENIVNFLEAYIIDDE------ELWVI 451

Query: 180 MELCPNNSLLDYMNQ-------RLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVK 232
           ME      L D ++          ++ L+E ++  I+ +  + L  +H   +  IHRD+K
Sbjct: 452 MEYMEGGCLTDILDAVARSNTGEHSSPLNENQMAYIVKETCQGLKFLHNKKI--IHRDIK 509

Query: 233 IENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCL 292
            +N+L+++    K+ DFG    C  +     + A +        TP + +PE+++     
Sbjct: 510 SDNILLNSQGLVKITDFG---FCVELTEKRSKRATMVG------TPYWMAPEIVNQK--- 557

Query: 293 PINEKSDIWALGIFLYKLLFYTTPF 317
             +EK D+W+LGI L +++    P+
Sbjct: 558 GYDEKVDVWSLGIMLIEMIEGEPPY 582

>YPR054W (SMK1) [5484] chr16 (666275..667441) Sporulation-specific
           protein kinase of the MAP family required for completion
           of sporulation [1167 bp, 388 aa]
          Length = 388

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 95/235 (40%), Gaps = 45/235 (19%)

Query: 85  EIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNEMRNEV 144
           EI+++L +G +  +  V+F        + P  ++ V  ++     +   E  L     E+
Sbjct: 39  EIIQFLGKGAYGTVCSVKF------KGRSPAARIAVKKIS----NIFNKEILLKRAIREL 88

Query: 145 SVMKQLSGCPNIVQYYDSH--ASRARDGSSGFEVTLLMELCPNNSLLDYMNQRL---ATK 199
             M    G  NIV   D     S   DG   ++            L+DY   ++   + +
Sbjct: 89  KFMNFFKGHKNIVNLIDLEIVTSSPYDGLYCYQ-----------ELIDYDLAKVIHSSVQ 137

Query: 200 LSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFG-------ST 252
           LSE  I   ++ +   L  +H     +IHRD+K  N+L   N   K+CDFG         
Sbjct: 138 LSEFHIKYFLYQILCGLKYIH--SADVIHRDLKPGNILCTLNGCLKICDFGLARGIHAGF 195

Query: 253 STCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFL 307
             C      H     +TN +    T  YR+PE+  L    P ++  DIWA+G  L
Sbjct: 196 FKCHSTVQPH-----ITNYV---ATRWYRAPEL--LLSNQPYSKSVDIWAVGCIL 240

>CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces
           cerevisiae YBR274w CHK1 regulats inhibitory Cdk
           phosphorylation of PDS1, start by similarity
          Length = 528

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/264 (23%), Positives = 110/264 (41%), Gaps = 53/264 (20%)

Query: 84  VEIVKYLAEGGFAHIYVVRF-----IEYANELEQVPTIKLEVGDLACLKRVLVTDENGLN 138
           VE+   + EG F  +   R      +  A +   +PT                  E+GL+
Sbjct: 14  VELGGTIGEGSFGCVRSARLKFDSSVVVAVKFVHLPTCA----------------ESGLS 57

Query: 139 --EMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRL 196
             ++  EV +  + S   N+++  D +         G  + +++E+     L D +   +
Sbjct: 58  QKDVSREVVLHSKCSKHANVLRVIDCNVG-------GEYLWIMLEMADGGDLFDKIEPDV 110

Query: 197 ATKLSEQEILKIMFD-VTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTC 255
                + ++ +  F  + RAL  +H   V + HRD+K EN+L+D   N KL DFG  S  
Sbjct: 111 GV---DPDVAQFYFQQLIRALNYLH--DVGVAHRDIKPENILLDKKGNLKLADFGLAS-- 163

Query: 256 FPVANTHQEIAVLTNNIYVHTTPQYRSPEMID---LYRCLPINEKSDIWALGIFLYKLLF 312
                  ++   L  +     +P Y +PE++     Y  +     +DIW+ G+ L+ LL 
Sbjct: 164 ----QFRRKDGTLRVSTDQRGSPPYMAPEILSSQGYYANI-----TDIWSAGVLLFVLLT 214

Query: 313 YTTPFELTGQFAILHSKYEFPVNN 336
              P+ +  +       YE+ VNN
Sbjct: 215 GEIPWSIPAK---EDDNYEWFVNN 235

>YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine
           protein kinase of unknown function [1110 bp, 369 aa]
          Length = 369

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/213 (25%), Positives = 91/213 (42%), Gaps = 44/213 (20%)

Query: 140 MRNEVSVMKQLSGC---PNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRL 196
           M+NE  VMK LS C   PNI    D +   +          +++E C    L D+++   
Sbjct: 43  MKNEYDVMKILSSCNPHPNICSMLDFYTDDSY-------YIMVLEYCECGDLYDFLDIAK 95

Query: 197 AT------KLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFG 250
           +        L + ++ KI+  +  A++  H L +   HRD+K EN+L+  N + KL D+G
Sbjct: 96  SQGSPSSPSLIQIDMQKIIKQLCSAISFAHSLGIA--HRDIKPENILLTINGDIKLADWG 153

Query: 251 STSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLY---RCLPIN-----------E 296
                 P +N  Q   + T+N        YR+PE         C   N            
Sbjct: 154 HAIQS-PKSNDFQ---IGTDN--------YRAPETFSGRVSNSCFKKNFDRSSAPLYNTY 201

Query: 297 KSDIWALGIFLYKLLFYTTPFELTGQFAILHSK 329
           ++D W+LG  ++ L+F    F ++    + H K
Sbjct: 202 QADYWSLGATIFYLMFGDCLFRVSKSKKVQHLK 234

>Scas_653.25
          Length = 666

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 85/169 (50%), Gaps = 17/169 (10%)

Query: 154 PNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATK--LSEQEILKIMFD 211
           PNI++  D   +      SG +++ +ME CP+    D+ N  ++    L+ +E       
Sbjct: 329 PNIIETLDIFYN-----PSG-QISEIMEWCPH----DFFNIVMSRTHLLTRRETFCYFKQ 378

Query: 212 VTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNN 271
           +   +  +H L +   HRD+K++N ++  N   KL DFGS +T F +  + +E   L  +
Sbjct: 379 LCNGVRYLHTLGI--AHRDLKLDNCVITYNGILKLIDFGS-ATIFQLNKSTEEKPELIPS 435

Query: 272 IYVHTTPQYRSPEMIDLYRCLPINEK-SDIWALGIFLYKLLFYTTPFEL 319
             +  +  Y +PE++ L + +P +   +D+W+LGI    ++    P+ +
Sbjct: 436 RGIVGSDPYLAPEVL-LSKEIPYDASLADVWSLGIIFCAIMLKRFPWRI 483

>CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces
           cerevisiae YGR040w KSS1, start by similarity
          Length = 398

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 60/117 (51%), Gaps = 11/117 (9%)

Query: 200 LSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVA 259
           L+   I   ++ + RAL  +H   V  IHRD+K  N+L+++N + K+CDFG   T  P  
Sbjct: 133 LTVDHIQYFLYQILRALKAIHSAKV--IHRDLKPSNILLNSNCDLKICDFGLARTYDPDD 190

Query: 260 NTH----QEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLF 312
           +        +  LT  +    T  YR+PE++  ++    +   DIW+ G  L ++LF
Sbjct: 191 DASTMNGNNVGFLTEYV---ATRWYRAPEIMLNFQ--DYSTAIDIWSCGCVLAEMLF 242

>Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement
          Length = 432

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 72/291 (24%), Positives = 126/291 (43%), Gaps = 64/291 (21%)

Query: 88  KYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNEMRNEVSVM 147
           K L  G F  +   R I   + +     +K+       LK+ L  ++  L  + +E+ ++
Sbjct: 50  KTLGAGSFGVVRQARKISTGDNV----AVKI------LLKKALKGNDVQLQMLYDELMIL 99

Query: 148 KQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQEILK 207
           ++L+  PNIV++ D   S+ +         ++ +L     L D + Q+   K +E + +K
Sbjct: 100 QKLN-HPNIVKFKDWFESKEK-------FYIVTQLATGGELFDRILQK--GKFTEVDAVK 149

Query: 208 IMFDVTRALAQMHYLPVPLIHRDVKIENVL-VDANHNFKLC--DFG-------STSTCFP 257
           I+  + +A+  +H   +  +HRD+K EN+L +D + N +L   DFG              
Sbjct: 150 IVVQILKAVEYLHSRNI--VHRDLKPENLLYLDKSDNSQLVLGDFGIAKELKNDGDLIHK 207

Query: 258 VANTHQEIA--VLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTT 315
            A +   +A  VLT+N   H  P            C       DIW++G+  Y LL   +
Sbjct: 208 AAGSMGYVAPEVLTSN--GHGKP------------C-------DIWSIGVITYTLLCGYS 246

Query: 316 PF--ELTGQFAILHSKYEFPV-------NNYSSKLINLIIIMLAENPNLRP 357
           PF  E    F    +  ++PV       NN S +    I+ +L  +P  RP
Sbjct: 247 PFIAESVDGFLEECTSGQYPVTFHKPYWNNISKEAKLFILRVLTISPKKRP 297

>YOL045W (PSK2) [4773] chr15 (243495..246800) Serine/threonine protein
            kinase of unknown function [3306 bp, 1101 aa]
          Length = 1101

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 74/143 (51%), Gaps = 20/143 (13%)

Query: 226  LIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEM 285
            ++HRD+K ENV+VD++   KL DFGS +           I     +++V T   Y +PE+
Sbjct: 971  IVHRDIKDENVIVDSHGFVKLIDFGSAAY----------IKSGPFDVFVGTM-DYAAPEV 1019

Query: 286  I--DLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEFPVNNY-SSKLI 342
            +    Y+  P     DIWALG+ LY +++   P+    +  IL  +  F  + + S + I
Sbjct: 1020 LGGSSYKGKP----QDIWALGVLLYTIIYKENPYYNIDE--ILEGELRFDKSEHVSEECI 1073

Query: 343  NLIIIMLAENPNLRPNIYQVMDN 365
            +LI  +L    + RP I ++ ++
Sbjct: 1074 SLIKRILTREVDKRPTIDEIYED 1096

>Sklu_2354.4 YNL307C, Contig c2354 4429-5520 reverse complement
          Length = 363

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 77/171 (45%), Gaps = 25/171 (14%)

Query: 154 PNIV--QYYDSHASRARDGSSGFEVTLLMELCPNNSLLD---YMNQRLATKLSEQEILKI 208
           PN+V  +Y+ +H S +    +     L ME  P    L+   Y + +L   L   ++   
Sbjct: 81  PNVVKLEYFFTHVSPS---DNKMYQHLAMECLPETLQLEIHRYSSNKLELPLKHIKLYS- 136

Query: 209 MFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHN-FKLCDFGSTSTCFPVANTHQEIAV 267
            + + R +  +H L +   HRDVK  N+LVD N    K+CDFGS      +  +   I+ 
Sbjct: 137 -YQIARGMLYLHALGI--CHRDVKPSNILVDPNTGVLKICDFGSAKK---LEQSQPSISY 190

Query: 268 LTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 318
           + +         YR+PE+I    C     + DIW LG  + ++L     F+
Sbjct: 191 ICSRF-------YRAPELI--VGCTQYTTQIDIWGLGCVMGEMLIGKAVFQ 232

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 115/249 (46%), Gaps = 42/249 (16%)

Query: 124 ACLKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGF-----EVTL 178
             +K V   D++ L ++ +E+ ++K L+   NIV+Y+            GF      + +
Sbjct: 48  VAIKEVNYQDDDELVDIMSEIDLLKNLNHI-NIVKYH------------GFIQKQHNLYI 94

Query: 179 LMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLV 238
           ++E C   SL + +++     +SE E    +      L  +H   V  IHRD+K  N+L+
Sbjct: 95  ILEYCAKGSLKNLISRN--RPMSEHEAKPYVRQTLNGLNYLHEQGV--IHRDIKAANILL 150

Query: 239 DANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKS 298
           D+ +  KL DFG ++    V NT   +A   N         + +PE+I       +   S
Sbjct: 151 DSENVVKLADFGVST---KVNNTAMTLAGSLN---------WMAPEIIGNRGASTL---S 195

Query: 299 DIWALGIFLYKLLFYTTPF----ELTGQFAILHSKYEFPVNNYSSKLINLIIIMLAENPN 354
           DIW+LG  + +LL    PF    ++   +AI +  Y FP ++ SS   + +    A+N  
Sbjct: 196 DIWSLGATVVELLTGNPPFHNLIDMNIYYAIENDSY-FPPSSLSSGAKDFLQQCFAKNMY 254

Query: 355 LRPNIYQVM 363
            RP   Q++
Sbjct: 255 KRPTAVQLL 263

>Kwal_33.13846
          Length = 375

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 62/127 (48%), Gaps = 21/127 (16%)

Query: 211 DVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTN 270
           +V  AL  +H     +I+RD+K ENVL+D N + K+ DFG       V  T         
Sbjct: 171 EVCLALEYLH--AQDIIYRDLKPENVLLDKNGHVKITDFGFAKFVPDVTYT--------- 219

Query: 271 NIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFA----IL 326
              +  TP Y +PE++      P N+  D W+ GI ++++L   TPF  +        IL
Sbjct: 220 ---LCGTPDYIAPEVVS---TKPYNKSVDWWSFGILIFEMLAGYTPFYDSNTMKTYENIL 273

Query: 327 HSKYEFP 333
           +++ +FP
Sbjct: 274 NAELQFP 280

>Scas_640.14*
          Length = 728

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 87/195 (44%), Gaps = 31/195 (15%)

Query: 176 VTLLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIEN 235
           + +++E         Y+ ++   +L E    ++   +   ++ MH   +  +HRD+K+EN
Sbjct: 121 IGIVLEYASGGEFYKYVQRK--RRLKEATACRLFAQLISGVSYMHSKGI--VHRDLKLEN 176

Query: 236 VLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMI---DLYRCL 292
           +L+D + N  + DFG  +  F   N   + +          +P Y +PE++   + Y+  
Sbjct: 177 LLLDKHENLIITDFGFVNE-FYADNELMKTSC--------GSPCYAAPELVITTEPYKA- 226

Query: 293 PINEKSDIWALGIFLYKLLFYTTPFELTGQ-----------FAILHSKYEFPVNNYSSKL 341
               K+DIW+ GI LY +L    P++   Q             I  +  +FP  +Y++ L
Sbjct: 227 ---RKADIWSCGIILYGMLAGYLPWDDDKQNPNGEDIVRLYHYITKTPLKFPRIHYTTFL 283

Query: 342 INLIIIMLAENPNLR 356
              +  +L  NP  R
Sbjct: 284 GICLRHILVSNPVRR 298

>Scas_602.11
          Length = 1186

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 74/305 (24%), Positives = 118/305 (38%), Gaps = 89/305 (29%)

Query: 138 NEMRNEVSVMKQL--SGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQR 195
           + ++ E+++MK+L       +++  D   SR        ++ L++E C    +       
Sbjct: 226 DRIKREIAIMKKLHHKHVVKLIEVLDDLKSR--------KIYLVLEYCAQGEIKWCPKDC 277

Query: 196 LATK------LSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDF 249
           L T+      LS Q   +I+  V   L  +HY  +  IHRD+K  N+LVD     K+ DF
Sbjct: 278 LETEAKGPPLLSFQSAREIIRGVILGLEYLHYQGI--IHRDIKPANLLVDEEGTVKISDF 335

Query: 250 G----STSTCFPVANTHQ--------------EIAVLTNN-----------IYVHTTPQY 280
           G    S S+    AN+                E    TNN                TP +
Sbjct: 336 GVSLASRSSGNSTANSSSVLGGTPRNLSRSSTESMNTTNNNDDESIDEVELAKTAGTPAF 395

Query: 281 RSPEMI--------------DLYRCLPINEKSDIWALGIFLYKLLFYTTPF--------- 317
            +PE+               ++++   I+   DIWALGI  Y LLF   PF         
Sbjct: 396 FAPEICLGEEAFDKFSLRKNEMFKGSCISFMIDIWALGITFYCLLFGMLPFISDFELELF 455

Query: 318 -ELTGQFAILHSKYEFPVNNYSS--------KLINLIIIMLAENPNLRPNIYQVMDNLCS 368
            ++ G+     S  E   N  S+           N++  +L +NP+ R          CS
Sbjct: 456 EKIVGEPLTFPSYEELQANRVSNVCSIEEYEAAKNVLQRLLEKNPSKR----------CS 505

Query: 369 ILKVK 373
           IL++K
Sbjct: 506 ILELK 510

>KLLA0F01276g complement(120001..121560) similar to sp|P38147
           Saccharomyces cerevisiae YBR274w CHK1 regulats
           inhibitory Cdk phosphorylation of PDS1, start by
           similarity
          Length = 519

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 87/180 (48%), Gaps = 24/180 (13%)

Query: 143 EVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSE 202
           EV +  + S   N+++  D + S          + + MEL     L D +   +     +
Sbjct: 65  EVKLHSRCSNFVNVLKVIDCNLSDPF-------LWIAMELAEGGDLFDKIEPDIGV---D 114

Query: 203 QEILKIMF-DVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANT 261
            E+ +  +  + +A++ +H     + HRD+K EN+L+D + N KL DFG  ++ F   + 
Sbjct: 115 SEVAQFYYKQLIKAISYLHD-TCGVAHRDIKPENILLDKDGNLKLADFG-LASLFKRKDG 172

Query: 262 HQEIAVLTNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLFYTTPFEL 319
            + I+         + P Y +PE+I  D Y      + +DIW++G+ L+ LL   TP+EL
Sbjct: 173 SKRISRDQRG----SLP-YMAPEIIYCDGYYA----DMTDIWSIGVLLFVLLTGETPWEL 223

>KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces
           cerevisiae YAR018c KIN3 ser/thr protein kinase,
           hypothetical start
          Length = 394

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 74/286 (25%), Positives = 123/286 (43%), Gaps = 70/286 (24%)

Query: 139 EMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLD----YMNQ 194
           ++ +E +++ QL    NIV+++  H       ++ F   L ME C    L      Y +Q
Sbjct: 53  QLISECAILSQLKH-DNIVEFF--HWDHDAKSNTLF---LYMEYCSKGDLSQMIRYYKHQ 106

Query: 195 RLATKLSEQEILKIMFDVTRALAQMHY-------------LPVPL-------IHRDVKIE 234
           R    + E+ + +IM  +  AL + HY             +  PL       IHRD+K  
Sbjct: 107 R--KYVPEEYVWRIMVQILMALFKCHYGRDLSKLQTIYDAMEEPLKSKGYVVIHRDLKPG 164

Query: 235 NVLV-----DANHN----------FKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQ 279
           N+ +     + N N           KL DFG   +         + ++     YV  TP 
Sbjct: 165 NIFLTGYDDEFNQNASDVDYSKVIIKLGDFGLAKSL--------QASIEFATTYV-GTPY 215

Query: 280 YRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF------ELTGQFAILHSKYEFP 333
           Y SPE++   R  P +  SDIW+LG  LY+L     PF      EL G+   + + Y  P
Sbjct: 216 YMSPEVL---RDQPYSPLSDIWSLGCILYELCSLHVPFQAKTYTELQGK---VKAGYFEP 269

Query: 334 V-NNYSSKLINLIIIMLAENPNLRPNIYQVMDNL-CSILKVKNPLE 377
           + + YS  L ++I   +  +   RP+ + +++++ C I +    LE
Sbjct: 270 LPHFYSKNLQDIITRCIQVDFTKRPSTWSLLNDIQCRICRKALDLE 315

>KLLA0A02717g 245082..246380 some similarities with sp|P53233
           Saccharomyces cerevisiae YGR052w, hypothetical start
          Length = 432

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 81/201 (40%), Gaps = 47/201 (23%)

Query: 140 MRNEVSVMKQLSG-CPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLAT 198
           +RNE  V+K+L    PNI    D +    +          ++E C N  L DYM +   +
Sbjct: 51  VRNEYRVLKKLGNRHPNICAMLDFYQDHEK-------FVFVLEYCHNGDLYDYMKRIKES 103

Query: 199 KLSEQ------------------EILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDA 240
             +++                      +MF +  AL   H L +   HRD K EN+LV  
Sbjct: 104 GGTDKNSKNARNSKSSSKSPPKLHFHSLMFQLCSALKYCHTLGIA--HRDFKPENILVTN 161

Query: 241 NHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMI---DLYRCLPINEK 297
               KL DFG  S    VA+ H              T +Y +PE     D Y        
Sbjct: 162 TGKIKLTDFG-LSYFGEVASDHGI-----------GTEKYLAPETFSHNDTYN----TYS 205

Query: 298 SDIWALGIFLYKLLFYTTPFE 318
           +D+W+LGI +  ++F + PF+
Sbjct: 206 ADLWSLGISVLYIVFGSCPFK 226

>Kwal_23.5576
          Length = 504

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/249 (24%), Positives = 110/249 (44%), Gaps = 39/249 (15%)

Query: 71  LKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANE----LEQVPTIKLEVGDLACL 126
            +  +Q    + R +++K +  G +  +   RFIE A E    +++V  +  +   L C 
Sbjct: 10  FRVFNQEFTVDKRFQLIKEIGHGAYGIVCSARFIEAAEETNVAIKKVTNVFSKT--LLC- 66

Query: 127 KRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGS-SGFEVTLLMELCPN 185
           KR L            E+ +++   G  NI   YD     + + + +G  +   +  C  
Sbjct: 67  KRSL-----------RELKLLRHFRGHKNITCLYDMDIVFSPNNTFNGLYLYEELMECDI 115

Query: 186 NSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245
           + ++     +    L++      ++ +  AL  +H   V  +HRD+K  N+LV+A+   K
Sbjct: 116 HQII-----KSGQPLTDAHYQSFIYQLLCALKYIHSADV--LHRDLKPGNLLVNADCQLK 168

Query: 246 LCDFGSTSTCFPVANTHQEIAVLTNNI---YVHTTPQYRSPEMIDLYRCLPINEKSDIWA 302
           +CDFG       +A  + E  V  N     YV  T  YR+PE++  Y+     +  DIW+
Sbjct: 169 VCDFG-------LARGYSENPVENNQFLTEYV-ATRWYRAPEIMLSYQ--GYTKAIDIWS 218

Query: 303 LGIFLYKLL 311
            G  L +LL
Sbjct: 219 CGCILAELL 227

>Kwal_55.22001
          Length = 363

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 82/182 (45%), Gaps = 26/182 (14%)

Query: 143 EVSVMKQLSGCPNIV--QYYDSHASRARDGSSGFEVTLLMELCPNNSLLD---YMNQRLA 197
           E+ +++ ++  PN+V  +Y+ +H S      +     L ME  P    L+   Y + +L 
Sbjct: 71  ELEILR-IADHPNVVKLEYFFTHTSPQ---DNKLYQHLAMECLPETLQLEIHRYASNKLE 126

Query: 198 TKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHN-FKLCDFGSTSTCF 256
             L   ++    + + R +  +H L +   HRD+K  NVLVD N    K+CDFGS     
Sbjct: 127 LPLKHTKLYT--YQIARGMLYLHALGI--CHRDIKPSNVLVDPNTGVLKICDFGSAKK-- 180

Query: 257 PVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 316
            +      I+ + +         YR+PE+I    C     + DIW LG  + ++L     
Sbjct: 181 -LEQNQPSISYICSRF-------YRAPELI--VGCTQYTTQIDIWGLGCVMGEMLIGKAV 230

Query: 317 FE 318
           F+
Sbjct: 231 FQ 232

>KLLA0D07304g 623352..624749 some similarities with sp|P32491
           Saccharomyces cerevisiae YPL140c MKK2 protein kinase of
           the map kinase kinase (MEK) family, hypothetical start
          Length = 465

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 75/166 (45%), Gaps = 25/166 (15%)

Query: 156 IVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATK---LSEQEILKIMFDV 212
           IV+YY   A           + + ME     SL D + + L +K   + E+ + KI   V
Sbjct: 237 IVRYYGMFACEETS-----TIFIAMEYMGGRSL-DSVYKHLLSKGGRIGEKVLGKIAESV 290

Query: 213 TRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNI 272
            R L  +H   +  IHRD+K +N+L +     KLCDFG +             AV +   
Sbjct: 291 LRGLFYLHERKI--IHRDIKPQNILFNEIGQIKLCDFGVSGE-----------AVNSLAT 337

Query: 273 YVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 318
               T  Y +PE I   +  P +  SD+W+LG+ L ++    +PF+
Sbjct: 338 TFTGTSYYMAPERI---QGQPYSVTSDVWSLGLTLLEVAQGHSPFD 380

>ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C
           (TOS3) - SH] (273163..276708) [3546 bp, 1181 aa]
          Length = 1181

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 99/236 (41%), Gaps = 51/236 (21%)

Query: 139 EMRNEVSVMKQLSG--CPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRL 196
           ++R E+++MK+        +++  D   SR        ++ L++E C    +      +L
Sbjct: 161 KIRREIAIMKKCDHEHVVKLIEVLDDMKSR--------KIYLVLEYCSKGEVKWCPGDQL 212

Query: 197 ATK------LSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFG 250
                    L+ Q   +I+  V   L  +HY  +  IHRD+K  N+L+  +   K+ DFG
Sbjct: 213 EAAARGPPLLTFQRTREILRGVVLGLEYLHYQGI--IHRDIKPANLLLSEHDIVKISDFG 270

Query: 251 ----STSTCFPVANTHQEIAVLT----------NNIYVHTTPQYRSPEMI---DLYRCLP 293
               S+++  P + +    +V                   TP + +PE+    D Y  L 
Sbjct: 271 VSLASSNSGTPSSRSSSSSSVKGVLGAEGPDDLELAKTAGTPAFFAPEICLGSDAYEKLN 330

Query: 294 INEKS------------DIWALGIFLYKLLFYTTPF----ELTGQFAILHSKYEFP 333
           I+ +S            DIWALG+ LY LLF   PF    E+     I++   EFP
Sbjct: 331 IDRQSNPCSGSLISYMIDIWALGVTLYCLLFGKLPFIAEYEMELFEKIVNDPLEFP 386

>KLLA0B07579g 659591..661759 weakly similar to sp|P32944
           Saccharomyces cerevisiae YJL187c SWE1 ser/tyr
           dual-specifity protein kinase, start by similarity
          Length = 722

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 98/235 (41%), Gaps = 46/235 (19%)

Query: 87  VKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNEMRNEV-- 144
           V  + +G F+ +Y V F E               G    +K V  T  N  N +  E+  
Sbjct: 399 VSIMGKGQFSTVYQVTFPE--------------TGLKYAIKSVRPTKHNFTNRILQEINM 444

Query: 145 ------SVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLAT 198
                 SV     G   IV++  S + +           ++ E C N +L  ++ + +  
Sbjct: 445 LSTIQDSVTNDTEGKEYIVEFISSWSHKG-------SFYIMTEFCENGNLDAFIQEHVIA 497

Query: 199 K---LSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTC 255
           K   L +  I KI+ ++  AL  +H     ++H D+K  NVL+    N KL DFG  +T 
Sbjct: 498 KQQRLEDWRIWKIIVEICLALRFIHD-SCSIVHLDLKPANVLITFEGNLKLADFG-MATK 555

Query: 256 FPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 310
            P+ +   E              +Y +PE+I   R    + ++DI++LG+ + ++
Sbjct: 556 LPIEDKSFE---------NEGDREYIAPEII---RDGIYDFRADIFSLGLMMIEI 598

>YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase
           kinase (MAPKKK or MEKK), component of pheromone
           response, filamentous growth, high-osmolarity sensing,
           and STE vegetative growth pathways [2154 bp, 717 aa]
          Length = 717

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 85/187 (45%), Gaps = 33/187 (17%)

Query: 137 LNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMN--- 193
           ++ +++E++++K+L    NIV YY +          G  + + +E  P  S+   +N   
Sbjct: 498 VDALQHEMNLLKELHH-ENIVTYYGA-------SQEGGNLNIFLEYVPGGSVSSMLNNYG 549

Query: 194 ---QRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFG 250
              + L T  + Q ++         +A +H     +IHRD+K  N+L+D     K+ DFG
Sbjct: 550 PFEESLITNFTRQILI--------GVAYLH--KKNIIHRDIKGANILIDIKGCVKITDFG 599

Query: 251 STSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 310
            +    P+     + A L  +++      + SPE++   +      K+DIW+ G  + ++
Sbjct: 600 ISKKLSPLNKKQNKRASLQGSVF------WMSPEVV---KQTATTAKADIWSTGCVVIEM 650

Query: 311 LFYTTPF 317
                PF
Sbjct: 651 FTGKHPF 657

>AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -
           SH] (1066272..1067981) [1710 bp, 569 aa]
          Length = 569

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 111/251 (44%), Gaps = 43/251 (17%)

Query: 71  LKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANE----LEQVPTIKLEVGDLACL 126
            K  +Q  + + R +++K +  G +  +   RF+E   +    +++V  +  +   L C 
Sbjct: 10  FKVFTQDFMVDKRFQLIKEIGYGAYGIVCSARFMESVEDTTVAIKKVTNVFSKA--LLC- 66

Query: 127 KRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNN 186
           KR L            E+ +++   G  NI   YD       DGS  F    L E     
Sbjct: 67  KRSL-----------RELKLLRHFRGHKNITCLYDMDIVLLPDGS--FNGLDLYE----- 108

Query: 187 SLLDY-MNQRLATK--LSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHN 243
            L+++ M+Q + +   L++      ++ +   L  +H   V  +HRD+K  N+LV+A+  
Sbjct: 109 ELMEWDMHQIIKSGQPLTDAHYQSFVYQILCGLKYIHSADV--LHRDLKPGNLLVNADCQ 166

Query: 244 FKLCDFGSTSTCFPVANTHQEIAVLTNNI---YVHTTPQYRSPEMIDLYRCLPINEKSDI 300
            K+CDFG       +A  + E  +  +     YV  T  YR+PE++  Y+        D+
Sbjct: 167 LKICDFG-------LARGYSENPIENDQFLTEYV-ATRWYRAPEIMLSYQ--GYTRAIDV 216

Query: 301 WALGIFLYKLL 311
           W+ G  L +LL
Sbjct: 217 WSCGCVLAELL 227

>CAGL0I05390g complement(508677..510041) similar to sp|Q12505
           Saccharomyces cerevisiae YPL026c SKS1 suppressor kinase
           of SNF3 or tr|Q03785 Saccharomyces cerevisiae YDR247w,
           start by similarity
          Length = 454

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 94/209 (44%), Gaps = 39/209 (18%)

Query: 188 LLDYMNQRLATKLSEQEILK--------IMFDVTRALAQMHYLPVPLIHRDVKIENVLVD 239
           ++DY    L T + +++           +   +  AL   H + V   H D+K EN+L+D
Sbjct: 136 VMDYYENDLFTSIVDKQYFANDGLLVKDVFLKICTALQYCHSMGV--YHCDIKPENILLD 193

Query: 240 ANHNFKLCDFG-STSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEK- 297
           A+ N  LCDFG +T + +   N      V   + Y      Y +PE I LY   P+  + 
Sbjct: 194 ASDNVYLCDFGLATDSKYLAPN------VCVGSFY------YMAPERI-LYSSAPLETET 240

Query: 298 -------SDIWALGIFLYKLLFYTTPF-------ELTGQFAILHSKYEFPVNNYSSKLIN 343
                  SDIW+LGI L  L+    P+       + T QF I ++K    +   S +L++
Sbjct: 241 AVLPTATSDIWSLGIILINLVCMRNPWLKAHQGEDATFQFFIENNKILQKILPISDELLD 300

Query: 344 LIIIMLAENPNLRPNIYQVMDNLCSILKV 372
           ++  +L   P  R  +  +M  + SI K+
Sbjct: 301 VLGDILCLEPCRRIALDVLMAKIRSIKKL 329

>ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH]
           (735828..738089) [2262 bp, 753 aa]
          Length = 753

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 67/292 (22%), Positives = 121/292 (41%), Gaps = 74/292 (25%)

Query: 64  TLPVLEQLKTGSQVI----------------VGNHRVEIVKYLAEGGFAHIYVVRFIEYA 107
           T PVL+ +++G + I                +GN++ E  K L +G F  +Y  R +  A
Sbjct: 22  TPPVLKDVRSGLEFIELEKRDDEKVYGVTKFLGNYKEE--KKLGQGTFGEVY--RGVHLA 77

Query: 108 NELEQVPTIKLEVGDLACLKRVLVTDENGLNEM--RNEVSVMKQLSGCPNIVQY----YD 161
            + +              +K++LV  EN L  +  + E++++K+L+   N+VQ     YD
Sbjct: 78  TQRQ------------VAMKKILVKTENDLFPITAQREITILKRLNHR-NVVQLIEMVYD 124

Query: 162 --------------SHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQEILK 207
                         S AS + D    F + L   +   + +L   N R+  ++++  I  
Sbjct: 125 YPPAQNGAAYGQDSSQASASADTMKSFYMILPYMVADLSGILH--NPRVTLEMAD--IKN 180

Query: 208 IMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPV-ANTHQEIA 266
           +M  +   +  +H      +HRD+K  N+L+D     K+ DFG     +    N      
Sbjct: 181 MMLQILEGINYIHC--KKFMHRDIKTANILLDHKGILKIADFGLARNYYGAPPNLKYPGG 238

Query: 267 VLTNNIY--VHTTPQYRSPEMIDLYRCLPINEKS-----DIWALGIFLYKLL 311
             T+  Y  V  T  YR+PE++       + +K+     DIW +G    +  
Sbjct: 239 AGTDAKYTSVVVTRWYRAPELV-------LGDKNYTTAVDIWGIGCVFAEFF 283

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 61/288 (21%), Positives = 121/288 (42%), Gaps = 51/288 (17%)

Query: 80  GNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENGLNE 139
           G    E+++ L +G F  +Y VR         +  T+++    +  L + ++  +N +  
Sbjct: 321 GPQDFEVLRLLGKGTFGQVYQVR---------KKDTMRIYA--MKVLSKKVIVKKNEIAH 369

Query: 140 MRNEVSVMKQLSG--CPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLA 197
              E +++ + +    P IV    S  +         ++ L+ +      L  ++ +   
Sbjct: 370 TIGERNILVRTASKSSPFIVGLKFSFQTPT-------DLYLVTDFMSGGELFWHLQKE-- 420

Query: 198 TKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFP 257
            + +E      + ++  AL  +H     +++RD+K EN+L+DAN N  LCDFG +     
Sbjct: 421 GRFTEDRAKFYIAELVLALEYLH--DNDIVYRDLKPENILLDANGNIALCDFGLSKA--- 475

Query: 258 VANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 317
                 ++   TN      T +Y +PE+  L       +  D W+LG+ ++++    +PF
Sbjct: 476 ------DLKDRTNTFC--GTTEYLAPEL--LMDETGYTKMVDFWSLGVLIFEMCCGWSPF 525

Query: 318 ELTGQFA---------ILHSKYEFPVNNYSSKLINLIIIMLAENPNLR 356
                FA         I   K +FP +  S +  + +  +L  NP  R
Sbjct: 526 -----FASDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLNRNPKHR 568

>AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH]
           (1043479..1044750) [1272 bp, 423 aa]
          Length = 423

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 67/260 (25%), Positives = 107/260 (41%), Gaps = 61/260 (23%)

Query: 155 NIVQYYDSHASRARDGSS-----GFEVTLLMELCPNNSLLDYMNQRLATK--LSEQEILK 207
           NIV++Y+   + +R G+S     G  + L ME C    L   +      +  + E++I +
Sbjct: 85  NIVEFYNWDHASSRTGNSVDYGNGEVLYLYMEYCSCGDLSQMIKHYKGMRKYVPERDIWR 144

Query: 208 IMFDVTRALAQMHY---LP---------------------VPLIHRDVKIENVLVDANH- 242
           I   +  AL + H    LP                       +IHRD+K  N+ +  +  
Sbjct: 145 IAVQLLLALYKCHTSCDLPQLDTIYDKISKSAIESEAGKVTSVIHRDLKPGNIFLTGDGV 204

Query: 243 -----------NFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPE-MIDLYR 290
                        KL DFG       +A + Q  A+     YV  TP Y SPE ++D   
Sbjct: 205 GGRGSVDYSKVEVKLGDFG-------LAKSLQS-AIEFATTYV-GTPYYMSPEVLMDQ-- 253

Query: 291 CLPINEKSDIWALGIFLYKLLFYTTPFE----LTGQFAILHSKYEFPVNNYSSKLINLII 346
             P +  SDIW+LG  +Y+L     PF     +  Q  I  +  +   + YS +L  L+I
Sbjct: 254 --PYSPLSDIWSLGCVIYELCALRVPFPARNFMELQRMIQRADVQPLPDYYSKELQQLVI 311

Query: 347 IMLAENPNLRPNIYQVMDNL 366
             +  N  LRP+ + ++  L
Sbjct: 312 SCINPNEKLRPSAFDLLQCL 331

>YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway that is probably
           parallel to cAMP pathway, affects life span [2475 bp,
           824 aa]
          Length = 824

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 64/306 (20%), Positives = 127/306 (41%), Gaps = 51/306 (16%)

Query: 62  SGTLPVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVG 121
           SG + +    K   +   G    E+++ L +G F  +Y V+      + +++  +K+   
Sbjct: 390 SGDILIKWTYKQTKKRHYGPQDFEVLRLLGKGTFGQVYQVK----KKDTQRIYAMKV--- 442

Query: 122 DLACLKRVLVTDENGLNEMRNEVSVMKQLSG--CPNIVQYYDSHASRARDGSSGFEVTLL 179
               L + ++  +N +     E +++   +    P IV    S  +         ++ L+
Sbjct: 443 ----LSKKVIVKKNEIAHTIGERNILVTTASKSSPFIVGLKFSFQTPT-------DLYLV 491

Query: 180 MELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVD 239
            +      L  ++ +    + SE      + ++  AL  +H     +++RD+K EN+L+D
Sbjct: 492 TDYMSGGELFWHLQKE--GRFSEDRAKFYIAELVLALEHLH--DNDIVYRDLKPENILLD 547

Query: 240 ANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSD 299
           AN N  LCDFG +           ++   TN      T +Y +PE+  L       +  D
Sbjct: 548 ANGNIALCDFGLSKA---------DLKDRTNTFC--GTTEYLAPEL--LLDETGYTKMVD 594

Query: 300 IWALGIFLYKLLFYTTPFELTGQFA---------ILHSKYEFPVNNYSSKLINLIIIMLA 350
            W+LG+ ++++    +PF     FA         I   K +FP +  S +  + +  +L 
Sbjct: 595 FWSLGVLIFEMCCGWSPF-----FAENNQKMYQKIAFGKVKFPRDVLSQEGRSFVKGLLN 649

Query: 351 ENPNLR 356
            NP  R
Sbjct: 650 RNPKHR 655

>YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine protein
            kinase involved in the regulation of carbohydrate
            storage, has similarity to human PIM-1 oncogene [4071 bp,
            1356 aa]
          Length = 1356

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 60/124 (48%), Gaps = 19/124 (15%)

Query: 196  LATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTC 255
              T ++E E   I   V   +  +H     ++HRD+K ENV+VD+    K+ DFGS +  
Sbjct: 1198 FKTNMTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVKIIDFGSAAY- 1254

Query: 256  FPVANTHQEIAVLTNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLFY 313
                     +     +++V T   Y +PE++  + Y   P     DIWA+GI LY ++F 
Sbjct: 1255 ---------VKSGPFDVFVGTI-DYAAPEVLGGNPYEGQP----QDIWAIGILLYTVVFK 1300

Query: 314  TTPF 317
              PF
Sbjct: 1301 ENPF 1304

>Sklu_2436.14 YDR466W, Contig c2436 31299-33653
          Length = 784

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 79/179 (44%), Gaps = 18/179 (10%)

Query: 141 RNEVSVMKQLSGCPNIVQ-YYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATK 199
           +N ++++ Q    P IV+ YY  H            +  +++  P   LL ++ QR  T 
Sbjct: 65  KNTLNLLAQ-GNNPGIVKLYYTFHDQE--------NLYFVLDYAPGGELL-HLLQRYGT- 113

Query: 200 LSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVA 259
             E      M  +   +  +H   V  IHRD+K ENVL+  +    + DFG+ S      
Sbjct: 114 FDEVWSKHFMCQLVDVVEYIHSKGV--IHRDLKPENVLLSKDGRLMVTDFGAASVVT-TD 170

Query: 260 NTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 318
            T  + +V         T +Y SPE++   +C      SDIWALG  LY+ +  + PF 
Sbjct: 171 GTSSDNSVSERAASFVGTAEYVSPELLLNNQCF---FSSDIWALGCILYQFMQGSPPFR 226

>Scas_703.5
          Length = 749

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 63/311 (20%), Positives = 131/311 (42%), Gaps = 51/311 (16%)

Query: 57  LNSSRSGTLPVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTI 116
           L+ + +G + +  +  +  +   G +  E+++ L +G F  +Y V+      + +++  +
Sbjct: 317 LDENVTGDILIKWEYSSTKKRHYGPNDFEVLRLLGKGTFGQVYQVK----KKDTKRIYAM 372

Query: 117 KLEVGDLACLKRVLVTDENGLNEMRNE--VSVMKQLSGCPNIVQYYDSHASRARDGSSGF 174
           K+       L + ++  +N +     E  + V       P IV    S  +         
Sbjct: 373 KV-------LSKKVIVKKNEVAHTIGERNILVTTATKASPFIVGLKFSFQTPT------- 418

Query: 175 EVTLLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIE 234
           ++ L+ +      L  ++ +    + +E+     + ++  AL  +H     +++RD+K E
Sbjct: 419 DLYLVTDFMSGGELFWHLQKE--GRFTEERAKFYIAELVLALEYLH--DNDIVYRDLKPE 474

Query: 235 NVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPI 294
           N+L+DAN N  LCDFG +           ++   TN      T +Y +PE+  L      
Sbjct: 475 NILLDANGNIALCDFGLSKA---------DLKDRTNTFC--GTTEYLAPEL--LLDEAGY 521

Query: 295 NEKSDIWALGIFLYKLLFYTTPFELTGQFA---------ILHSKYEFPVNNYSSKLINLI 345
            +  D W+LG+ ++++    +PF     FA         I   K +FP +  S +  + +
Sbjct: 522 TKMVDFWSLGVLIFEMCCGWSPF-----FAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFV 576

Query: 346 IIMLAENPNLR 356
             +L  NP  R
Sbjct: 577 KGLLNRNPKHR 587

>CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31, start by similarity
          Length = 1336

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 79/171 (46%), Gaps = 22/171 (12%)

Query: 198  TKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFP 257
            T ++E E   +   V   +  +H     ++HRD+K EN++VD+    K+ DFGS +    
Sbjct: 1180 TNMTEIEAKLLFKQVVSGVKHLH--DQGIVHRDIKDENIIVDSQGFVKIIDFGSAAY--- 1234

Query: 258  VANTHQEIAVLTNNIYVHTTPQYRSPEMIDL--YRCLPINEKSDIWALGIFLYKLLFYTT 315
                   +     +++V T   Y +PE++    Y   P     DIWA+GI LY ++F   
Sbjct: 1235 -------VKSGPFDVFVGTI-DYAAPEVLGGSPYEGKP----QDIWAIGILLYTIVFKEN 1282

Query: 316  PFELTGQFAILHSKYEFPVNNY-SSKLINLIIIMLAENPNLRPNIYQVMDN 365
            PF    +  IL  + +F  +   S +   LI  +L  N   RP I  + ++
Sbjct: 1283 PFYNIDE--ILEGELKFNSSELVSEQCTTLIAKILNRNVQKRPTIDDIYND 1331

>Sklu_1843.3 YOR231W, Contig c1843 2632-4092 reverse complement
          Length = 486

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 60/123 (48%), Gaps = 16/123 (13%)

Query: 195 RLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTST 254
           R   ++SE+ + KI   V R L+ +H   +  IHRD+K +N+L++     KLCDFG +  
Sbjct: 293 RRGGRISEKVLGKIAESVLRGLSYLHERRI--IHRDIKPQNILLNEIGQVKLCDFGVSGE 350

Query: 255 CFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYT 314
                      AV +       T  Y +PE I   +  P +  SD+W+LG+ L ++    
Sbjct: 351 -----------AVNSLATTFTGTSYYMAPERI---QGQPYSVTSDVWSLGLTLLEVAQGH 396

Query: 315 TPF 317
            PF
Sbjct: 397 FPF 399

>Kwal_55.20189
          Length = 812

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 82/191 (42%), Gaps = 41/191 (21%)

Query: 143 EVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSE 202
           EV +  ++    NI + YD            F+  ++ME C    L + +   L  K + 
Sbjct: 107 EVDIHTKVGKHKNITELYDF-----------FDSFIVMEYCSGGDLYEAIKADLIPKRT- 154

Query: 203 QEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVD-ANHNFKLCDFGSTSTCFPVANT 261
           + I  I   +  A+  +H   +   HRD+K EN+L++ ++   KL D+G  +T       
Sbjct: 155 KVITHIASQIMEAIEFVHQKGI--YHRDLKPENILIEGSDWTIKLTDWGLATT------- 205

Query: 262 HQEIAVLTNNIYVHTTPQYRSPEMIDL----------YRCLPINEKSDIWALGIFLYKLL 311
             E   L  ++    + +Y +PE+ +           Y C     K D+WA+GI L  ++
Sbjct: 206 --EPTSLDRSV---GSERYMAPELFEENLDRDERSEPYDC----SKVDLWAIGIVLLNIV 256

Query: 312 FYTTPFELTGQ 322
           F   PF +  Q
Sbjct: 257 FQKNPFSVANQ 267

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.130    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 29,611,248
Number of extensions: 1333406
Number of successful extensions: 4959
Number of sequences better than 10.0: 659
Number of HSP's gapped: 4616
Number of HSP's successfully gapped: 689
Length of query: 922
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 811
Effective length of database: 12,753,511
Effective search space: 10343097421
Effective search space used: 10343097421
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 66 (30.0 bits)