Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_27.1094159558730730.0
YBR060C (ORC2)62060713341e-178
AGR028C57959613221e-177
CAGL0H10230g51451912641e-169
Scas_718.4773052511691e-152
KLLA0F18590g5964848441e-105
Scas_721.105421159790.14
AEL186W172888760.48
Kwal_56.23939671160701.9
YMR133W (REC114)42837702.0
CAGL0F03465g932118684.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10941
         (587 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10941                                                        1188   0.0  
YBR060C (ORC2) [251] chr2 complement(360612..362474) Origin reco...   518   e-178
AGR028C [4338] [Homologous to ScYBR060C (ORC2) - SH] (766480..76...   513   e-177
CAGL0H10230g complement(1000574..1002118) similar to sp|P32833 S...   491   e-169
Scas_718.47                                                           454   e-152
KLLA0F18590g 1709034..1710824 similar to sp|P32833 Saccharomyces...   329   e-105
Scas_721.105                                                           35   0.14 
AEL186W [2320] [Homologous to ScYBR275C (RIF1) - SH] complement(...    34   0.48 
Kwal_56.23939                                                          32   1.9  
YMR133W (REC114) [4090] chr13 (536206..537447,537564..537608) Me...    32   2.0  
CAGL0F03465g complement(340640..343438) similar to sp|P48524 Sac...    31   4.2  

>Kwal_27.10941
          Length = 595

 Score = 1188 bits (3073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 573/587 (97%), Positives = 573/587 (97%)

Query: 1   MSNTDDIVSHEDFKVTPGAPKSRLLPIIWRFVGRRARKTGRAGSMSPAKRRTPSPVKQED 60
           MSNTDDIVSHEDFKVTPGAPKSRLLPIIWRFVGRRARKTGRAGSMSPAKRRTPSPVKQED
Sbjct: 1   MSNTDDIVSHEDFKVTPGAPKSRLLPIIWRFVGRRARKTGRAGSMSPAKRRTPSPVKQED 60

Query: 61  TSELEQLSHDHEKSAGATPEVKVDSLPPRSPSQSPVRHPRKRGRPRSVKAEHDPKITTPS 120
           TSELEQLSHDHEKSAGATPEVKVDSLPPRSPSQSPVRHPRKRGRPRSVKAEHDPKITTPS
Sbjct: 61  TSELEQLSHDHEKSAGATPEVKVDSLPPRSPSQSPVRHPRKRGRPRSVKAEHDPKITTPS 120

Query: 121 VNASPSRSISPQGPRKLTKLEPVPESEFVTANSSPIKSSHVFSSPAKSPSKPVLKQSPFK 180
           VNASPSRSISPQGPRKLTKLEPVPESEFVTANSSPIKSSHVFSSPAKSPSKPVLKQSPFK
Sbjct: 121 VNASPSRSISPQGPRKLTKLEPVPESEFVTANSSPIKSSHVFSSPAKSPSKPVLKQSPFK 180

Query: 181 IQLDRHFVPTPIPHEGDYKPPQEKHLTYFFDGFEGYIDQKKPLRAHQKSTNTMAMAPQVT 240
           IQLDRHFVPTPIPHEGDYKPPQEKHLTYFFDGFEGYIDQKKPLRAHQKSTNTMAMAPQVT
Sbjct: 181 IQLDRHFVPTPIPHEGDYKPPQEKHLTYFFDGFEGYIDQKKPLRAHQKSTNTMAMAPQVT 240

Query: 241 REEFSLLSNTLIDSLHKPAKEALLEVQRKMFPQYWFELAQGFSLLFYGVGSKRSFLEEFV 300
           REEFSLLSNTLIDSLHKPAKEALLEVQRKMFPQYWFELAQGFSLLFYGVGSKRSFLEEFV
Sbjct: 241 REEFSLLSNTLIDSLHKPAKEALLEVQRKMFPQYWFELAQGFSLLFYGVGSKRSFLEEFV 300

Query: 301 LQYLSPQLALSDALNFGTXXXXXXXXXXXXXXGVPCVVINGYNPTCNYRDAFHSISQIMM 360
           LQYLSPQLALSDALNFGT              GVPCVVINGYNPTCNYRDAFHSISQIMM
Sbjct: 301 LQYLSPQLALSDALNFGTAEDSEAIDEESEIDGVPCVVINGYNPTCNYRDAFHSISQIMM 360

Query: 361 QEELSKSETKYWGNHVELQINKMIEVYRDSPPLIKLIVLVHNLDGPMVRKDPFQNMLSSL 420
           QEELSKSETKYWGNHVELQINKMIEVYRDSPPLIKLIVLVHNLDGPMVRKDPFQNMLSSL
Sbjct: 361 QEELSKSETKYWGNHVELQINKMIEVYRDSPPLIKLIVLVHNLDGPMVRKDPFQNMLSSL 420

Query: 421 SRVRQIALIASTDNLYAPLLWDHVRAQNFNFIFHDITNYQSYAVESSFSDIMQLGRSAGT 480
           SRVRQIALIASTDNLYAPLLWDHVRAQNFNFIFHDITNYQSYAVESSFSDIMQLGRSAGT
Sbjct: 421 SRVRQIALIASTDNLYAPLLWDHVRAQNFNFIFHDITNYQSYAVESSFSDIMQLGRSAGT 480

Query: 481 TGAEGARYVLESLTSNSKRMYKLLIETQLSNMDSQGKAVANKRGSHAFGIEFKQFYHMCA 540
           TGAEGARYVLESLTSNSKRMYKLLIETQLSNMDSQGKAVANKRGSHAFGIEFKQFYHMCA
Sbjct: 481 TGAEGARYVLESLTSNSKRMYKLLIETQLSNMDSQGKAVANKRGSHAFGIEFKQFYHMCA 540

Query: 541 ADFIASNEVSLRSMLGEFIEHKMAAMSRDRTGAETLYIPYVHSEMQA 587
           ADFIASNEVSLRSMLGEFIEHKMAAMSRDRTGAETLYIPYVHSEMQA
Sbjct: 541 ADFIASNEVSLRSMLGEFIEHKMAAMSRDRTGAETLYIPYVHSEMQA 587

>YBR060C (ORC2) [251] chr2 complement(360612..362474) Origin
           recognition complex, 72 kDa subunit, functions in
           pre-replication complex formation, which is essential
           for proper DNA replication initiation [1863 bp, 620 aa]
          Length = 620

 Score =  518 bits (1334), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 269/607 (44%), Positives = 373/607 (61%), Gaps = 78/607 (12%)

Query: 46  SPAKRRTPSPVKQEDTSELEQLSHDH-------EKSAGATPEVKVDSLPPRSPSQSPVRH 98
           SPAK R  +P K+ D     QL   H       E+ +    E K  S  P    ++P + 
Sbjct: 16  SPAKSRNVTP-KRVDPHGERQLRRIHSSKKNLLERISLVGNERKNTSPDPALKPKTPSKA 74

Query: 99  PRKRGRPRSVKAEHDPKITTPSVNASPSRSISPQGPRKLTK------------------- 139
           PRKRGRPR ++ E      T  +      +IS +  RKL K                   
Sbjct: 75  PRKRGRPRKIQEE-----LTDRIKKDEKDTISSKKKRKLDKDTSGNVNEESKTSNNKQVM 129

Query: 140 ------------------------LEPVPESEFVTANSSP----------IKSSHVFSSP 165
                                   + P  +  FV+ +  P          + ++H F+SP
Sbjct: 130 EKTGIKEKREREKIQVATTTYEDNVTPQTDDNFVSNSPEPPEPATPSKKSLTTNHDFTSP 189

Query: 166 AKSPSKPVLKQ-----SPFKIQLDRHFVPTPIPHEGD-YKPPQEKHLTYFFDGFEGYIDQ 219
            K      LK+     SP K+ L R+F PTP+P     Y+  + K  + F D FEGY DQ
Sbjct: 190 LKQIIMNNLKEYKDSTSPGKLTLSRNFTPTPVPKNKKLYQTSETKSASSFLDTFEGYFDQ 249

Query: 220 KKPLRAHQKSTNTMAMAPQVTREEFSLLSNTLIDSLHKPAKEALLEVQRKMFPQYWFELA 279
           +K +R + KS +TM+MAP VTREEFSL+SN   ++  K  ++ L E+Q+KMFPQYWFEL 
Sbjct: 250 RKIVRTNAKSRHTMSMAPDVTREEFSLVSNFFNENFQKRPRQKLFEIQKKMFPQYWFELT 309

Query: 280 QGFSLLFYGVGSKRSFLEEFVLQYLSPQLALSDALNFGTXXXXXXXXXXXXXXGVPCVVI 339
           QGFSLLFYGVGSKR+FLEEF + YLSP++A      +                 +PC+++
Sbjct: 310 QGFSLLFYGVGSKRNFLEEFAIDYLSPKIA------YSQLAYENELQQNKPVNSIPCLIL 363

Query: 340 NGYNPTCNYRDAFHSISQIMMQEELSKSETKYWGNHVELQINKMIEVYRDSPPLIKLIVL 399
           NGYNP+CNYRD F  I+ +++  EL++SETKYWGNHV LQI KMI+ Y++ P  IKLI++
Sbjct: 364 NGYNPSCNYRDVFKEITDLLVPAELTRSETKYWGNHVILQIQKMIDFYKNQPLDIKLILV 423

Query: 400 VHNLDGPMVRKDPFQNMLSSLSRVRQIALIASTDNLYAPLLWDHVRAQNFNFIFHDITNY 459
           VHNLDGP +RK+ FQ MLS LS +RQIA++ASTD++YAPLLWD+++AQN+NF+FHDI+N+
Sbjct: 424 VHNLDGPSIRKNTFQTMLSFLSVIRQIAIVASTDHIYAPLLWDNMKAQNYNFVFHDISNF 483

Query: 460 QSYAVESSFSDIMQLGRSAGTTGAEGARYVLESLTSNSKRMYKLLIETQLSNMDSQGKAV 519
           +   VES+F D+M++G+S  ++GAEGA+YVL+SLT NSK+MYKLLIETQ+ NM +     
Sbjct: 484 EPSTVESTFQDVMKMGKSDTSSGAEGAKYVLQSLTVNSKKMYKLLIETQMQNMGNLSANT 543

Query: 520 ANKRGSHAFGIEFKQFYHMCAADFIASNEVSLRSMLGEFIEHKMAAMSRDRTGAETLYIP 579
             KRG+   G+E K F H+CAADFIASNE++LRSML EFIEHKMA ++++ +G E +++P
Sbjct: 544 GPKRGTQRTGVELKLFNHLCAADFIASNEIALRSMLREFIEHKMANITKNNSGMEIIWVP 603

Query: 580 YVHSEMQ 586
           Y ++E++
Sbjct: 604 YTYAELE 610

>AGR028C [4338] [Homologous to ScYBR060C (ORC2) - SH]
           (766480..768219) [1740 bp, 579 aa]
          Length = 579

 Score =  513 bits (1322), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 278/596 (46%), Positives = 373/596 (62%), Gaps = 75/596 (12%)

Query: 6   DIVSHEDFKVTP---GAPKSRLLPIIWRFVGRRARKTGRAGSMSPAKRRTPSPVKQEDTS 62
           DIV+H D  V P   GAP S+ L        R    +GR G  SP  RR  +        
Sbjct: 34  DIVAHADLGVAPAGAGAPSSKFLRFYRAATARSRGASGRRGRASP--RRGGA-------- 83

Query: 63  ELEQLSHDHEKSAGATPEVKVDSLPPRSPS-QSPVRHPRKRGRPRSVKAEHDPKITTPSV 121
               +    ++ A A P  + D+    SP  + PVR P+                 TP+ 
Sbjct: 84  ----VDSSVDEGATAVPSSR-DAAKEESPRRKQPVRVPQ-----------------TPAK 121

Query: 122 NASPSRSISPQGPRKLTKLEPVPESEFVTANSSPIKSSH---VFSSPAKSPSKP-----V 173
            A+P+             LE      FVTA S+P++S      FSSP+KSP K      +
Sbjct: 122 LAAPA-------------LEADDSDGFVTARSTPLRSPRRQLTFSSPSKSPRKTRKQDVL 168

Query: 174 LKQSPFKIQLDRHFVPTPIPHEGDYKPPQEKHLTYFFDGFEGYIDQKKPLRAHQKSTNTM 233
           L Q P   +LD  FVP  +P    Y+ P++++LTYFFDGFEGYIDQKKP+RAH+KS N+M
Sbjct: 169 LAQVP-SFKLDPGFVPAAVPK--GYRLPEDRNLTYFFDGFEGYIDQKKPIRAHKKSRNSM 225

Query: 234 AMAPQVTREEFSLLSNTLIDSLHKPAKEALLEVQRKMFPQYWFELAQGFSLLFYGVGSKR 293
           A+AP V+R+EF LLS  L   +H+  +  L   Q+++FPQYWFE+ QGF+LLFYG+GSKR
Sbjct: 226 AIAPSVSRDEFRLLSGALNGFMHQTPRAVLTGHQQRLFPQYWFEVMQGFTLLFYGIGSKR 285

Query: 294 SFLEEFVLQYLSPQLALSDALNFGTXXXXXXXXXXXXXXGVPCVVINGYNPTCNYRDAFH 353
            FLE  V +YLSP+LALS A                   GVPCVVING+NP CNYRD F 
Sbjct: 286 RFLETLVFEYLSPKLALSGA------------PEGADVEGVPCVVINGFNPACNYRDCFQ 333

Query: 354 SISQIMMQEELSKSETKYWGNHVELQINKMIEVYRDSPPLIKLIVLVHNLDGPMVRKDPF 413
           SI+  M+ +EL  +ETKYW NHV LQI KM+E +   PP ++++VLVHNLDGPM+RKDPF
Sbjct: 334 SIAAYMLPDELRHAETKYWHNHVHLQIQKMVEHWAAQPPQVQMVVLVHNLDGPMLRKDPF 393

Query: 414 QNMLSSLSRVRQIALIASTDNLYAPLLWDHVRAQNFNFIFHDITNYQSYAVESSFSDIMQ 473
           Q MLSSL+R+RQIA++AS D+++APLLW  +RAQ +NF+FHD+TNY+ YA+E++F + ++
Sbjct: 394 QQMLSSLARIRQIAIVASVDHIHAPLLWYSLRAQLYNFVFHDVTNYEPYAIEAAFQESVR 453

Query: 474 LGRSAGTTGA-EGARYVLESLTSNSKRMYKLLIETQLSNMDSQG--KAVANKRGSHAFGI 530
           L RS    G+ + ARYVL SLT+NSKR+++LL+ET ++NM S    K   ++R   +FG+
Sbjct: 454 LNRSELQAGSIDAARYVLASLTANSKRLFRLLLETVVANMQSAKRIKLTNSRRAGISFGV 513

Query: 531 EFKQFYHMCAADFIASNEVSLRSMLGEFIEHKMAAMSRDRTGAETLYIPYVHSEMQ 586
            F  FY  CAA F+ASNE+SLRSML EF+EHKMA +++D+ G E +Y+ Y   EMQ
Sbjct: 514 PFSAFYQACAAQFVASNEMSLRSMLREFVEHKMAHLAKDKAGQEIVYVNYSFGEMQ 569

>CAGL0H10230g complement(1000574..1002118) similar to sp|P32833
           Saccharomyces cerevisiae YBR060c RRR1 origin recognition
           complex, hypothetical start
          Length = 514

 Score =  491 bits (1264), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 246/519 (47%), Positives = 341/519 (65%), Gaps = 35/519 (6%)

Query: 87  PPRSPSQSPVRH------------PRKRGRPRSVKAEHDPKITTPSVNASPSRSISPQGP 134
           PP +P +  ++             PR+ G    +K E   +  TP + +     +  Q P
Sbjct: 3   PPETPKKESLKENEDLAIKENGTSPREIGD--KIKVESAGEYETPELTSDEENLVQLQTP 60

Query: 135 RKLTKLEPVPESEFVTANSSPIKSSHVFSSPAKSPSKPVLKQSPFKIQLDRHFVPTPIPH 194
           RK  K+    E +F    +SP+K   V  +      K  L     K++L R FV T +P 
Sbjct: 61  RKRRKVNLSKEHDF----TSPLKK--VIMNNLNEYKKSDLAD---KLKLSRDFVNTQVPR 111

Query: 195 EGDY-KPPQEKHLTYFFDGFEGYIDQKKPLRAHQKSTNTMAMAPQVTREEFSLLSNTLID 253
             D  K    + +T F D FEGY +QK+ +R  + S N++ MAP VTREEF L+SN    
Sbjct: 112 PADVEKLKANRAVTSFTDTFEGYFEQKRSVRGVKVSKNSITMAPHVTREEFGLISNIFHR 171

Query: 254 SLHKPAKEALLEVQRKMFPQYWFELAQGFSLLFYGVGSKRSFLEEFVLQYLSPQLALSDA 313
           +LHK  ++ L  +Q+K++PQYWFE+ QGFSLLFYG+GSK+ FLE+FV +YLSP+LALS A
Sbjct: 172 NLHKNLRDHLYIIQKKLYPQYWFEVIQGFSLLFYGIGSKKVFLEDFVFKYLSPKLALSQA 231

Query: 314 LNFGTXXXXXXXXXXXXXXGVPCVVINGYNPTCNYRDAFHSISQIMMQEELSKSETKYWG 373
           +   T              G+P VV+NGYNPTCNYRD F  I  ++   EL++SE+K+WG
Sbjct: 232 IEVPTYNGKKSKFE-----GIPVVVVNGYNPTCNYRDVFKDILSLLTPAELTQSESKFWG 286

Query: 374 NHVELQINKMIEVYRDSPPLIKLIVLVHNLDGPMVRKDPFQNMLSSLSRVRQIALIASTD 433
           NHV + I K+I+ Y+D P  IKLIV +HN+DGP +R+     +LS LS +RQ+A++AS D
Sbjct: 287 NHVIMNIQKLIDYYKDKPLDIKLIVAIHNIDGPNIRRGDSPTILSFLSLIRQVAIVASAD 346

Query: 434 NLYAPLLWDHVRAQNFNFIFHDITNYQSYAVESSFSDIMQLGRSAGTTGAEGARYVLESL 493
           ++YAP LWD++RAQN+NF+FHD+TNY  Y  ESSF D+M+LG+S  +TGAEGA+YVL+SL
Sbjct: 347 HIYAPFLWDNLRAQNYNFVFHDVTNYAPYEAESSFQDVMRLGKSENSTGAEGAKYVLQSL 406

Query: 494 TSNSKRMYKLLIETQLSNMD------SQGKAVANKRGSHAFGIEFKQFYHMCAADFIASN 547
           T NSK+MYKLLIETQL +M+      S GK  A+KRG+ + G+EFKQ  H+CAADFIASN
Sbjct: 407 TLNSKKMYKLLIETQLQHMEKVSTTKSTGKVAASKRGTMSMGVEFKQLVHLCAADFIASN 466

Query: 548 EVSLRSMLGEFIEHKMAAMSRDRTGAETLYIPYVHSEMQ 586
           E++LRSML EFIEHKMA++S++  G E +++PY ++EM+
Sbjct: 467 EMALRSMLTEFIEHKMASVSKNTVGTEFVWVPYTYAEMK 505

>Scas_718.47
          Length = 730

 Score =  454 bits (1169), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 242/525 (46%), Positives = 334/525 (63%), Gaps = 39/525 (7%)

Query: 100 RKRGRPRSVKAEHDPKIT--------TPSVNASPS----RSISPQGPRKLTKLEPVPESE 147
           RKRGRPR       PKI          P ++ + S    +S  P    + + +E   ES 
Sbjct: 196 RKRGRPRKYPIPETPKIKRKRGRPRKEPVISENNSEEKGKSRKPNKKGESSDIESDRES- 254

Query: 148 FVTANSSPIKS------SHVFSSPAKSPSKPVLKQ-------SPFKIQLDRHFVPTPIPH 194
                +SP+ S       H F+SP K      L+Q       S  K+ L+R FVPT +P 
Sbjct: 255 LAMDQTSPLPSKIAPLTEHDFTSPLKQVIMNSLRQYQEDSLLSSKKLVLNREFVPTQVPK 314

Query: 195 EGDYKPPQE----KHLTYFFDGFEGYIDQKK-PLRAHQK-STNTMAMAPQVTREEFSLLS 248
              Y+   E    K    FFD FEGY DQ+   L+   K S NTM+M P V+++EF++ +
Sbjct: 315 TDKYEKRLEASENKSSKTFFDTFEGYFDQRSHSLKYTTKLSKNTMSMGPSVSKDEFAMFT 374

Query: 249 NTLIDSLHKPAKEALLEVQRKMFPQYWFELAQGFSLLFYGVGSKRSFLEEFVLQYLSPQL 308
           N       K  +  L  +QRKMFPQYWFE+ QGFSLLFYG+GSKR+FLE+  ++Y+SP+L
Sbjct: 375 NVFNKHYLKEPRAKLQALQRKMFPQYWFEITQGFSLLFYGIGSKRNFLEDLAIKYISPKL 434

Query: 309 ALSDALNFGTXXXXXXXXXXX-XXXGVPCVVINGYNPTCNYRDAFHSISQIMMQEELSKS 367
                +                   G+PC++INGYNPTC+YR+ F  I+ IM  + L+++
Sbjct: 435 TFGKRIALQKELELKKVNKSTGSIQGIPCLIINGYNPTCSYREIFQDITDIMFPDGLTRN 494

Query: 368 ETKYWGNHVELQINKMIEVYRDSPPLIKLIVLVHNLDGPMVRKDPFQNMLSSLSRVRQIA 427
           ETK+WGN   LQ+ KMIE Y   P  IKLI+++HNLDGP +RK+ FQ + SSL++++QI 
Sbjct: 495 ETKFWGNLAILQVQKMIEFYSTQPKDIKLILVIHNLDGPALRKEIFQTIFSSLAQIKQIV 554

Query: 428 LIASTDNLYAPLLWDHVRAQNFNFIFHDITNYQSYAVESSFSDIMQLGRSAGTTGAEGAR 487
           LIAS D++YAP+L+D+ +AQN+NF+FHD+TNY+S  VESSF D M LG+S+ ++GAEGA+
Sbjct: 555 LIASVDHIYAPVLFDNKKAQNYNFVFHDVTNYESNEVESSFQDKMNLGKSSSSSGAEGAK 614

Query: 488 YVLESLTSNSKRMYKLLIETQLSNMD----SQGKAVA--NKRGSHAFGIEFKQFYHMCAA 541
           YVLESLT N+K+MYKLL++ QL+NMD    S+ K+ +  +KRG  + G+EFK F  MCA+
Sbjct: 615 YVLESLTLNAKKMYKLLLDLQLNNMDLASGSKNKSASSVSKRGGLSTGVEFKSFVTMCAS 674

Query: 542 DFIASNEVSLRSMLGEFIEHKMAAMSRDRTGAETLYIPYVHSEMQ 586
           +FIASNE+SLR+ML EFIEHKM  +SR  +G E LY+PY +SEM+
Sbjct: 675 EFIASNEISLRTMLTEFIEHKMLLLSRHSSGTEYLYVPYRYSEME 719

>KLLA0F18590g 1709034..1710824 similar to sp|P32833 Saccharomyces
           cerevisiae YBR060c RRR1 origin recognition complex, 72
           kDa subunit singleton, start by similarity
          Length = 596

 Score =  329 bits (844), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 173/484 (35%), Positives = 294/484 (60%), Gaps = 32/484 (6%)

Query: 113 DPKITTPSVNASPSRSISPQGPRKLT-KLEPVPESEFVTANSSPIKSSHVFSSPAKSPSK 171
           D KI   S  +SP++S  P+  RKLT   EP P+ +  T N+  ++ + +          
Sbjct: 124 DLKIKIDSNESSPNKS--PR--RKLTFNAEPSPQRK-TTRNT--VQRNKIIDDDL--AYD 174

Query: 172 PVLKQSPFKIQLDRHFVPTPIPH-EGDYKPPQEKHLTYFFDGFEGYIDQKKPLRAHQKST 230
            + +    K+ L+ +F PT +P  + + +   E+   YFFDGFEG+IDQ K L+  ++S 
Sbjct: 175 DIQQYKHLKLNLNPNFKPTKLPKSDNNDQTSDEQSQIYFFDGFEGFIDQTKILKTDKRSK 234

Query: 231 NTMAMAPQVTREEFSLLSNTLIDSLHKPAKEALLEVQRKMFPQYWFELAQGFSLLFYGVG 290
           N+M+ AP ++R+E+++LS    D  H+ + +A+ ++   +F Q+ FEL QGF+LLFYG+G
Sbjct: 235 NSMSSAPSISRDEYNILSQLSNDIFHRSSTKAVQKIHETLFQQFTFELLQGFTLLFYGIG 294

Query: 291 SKRSFLEEFVLQYLSPQLALSDALNFGTXXXXXXXXXXXXXXGVPCVVINGYNPTCNYRD 350
           SK+ FLE F   +LS ++AL                       +P  V+NGY  T   ++
Sbjct: 295 SKKKFLESFAFNFLSMKIAL-----------LQNPDIQKDDPCIPVFVMNGY--TTLSKN 341

Query: 351 AFHSISQIMMQEEL--SKSETKYWGNHVELQINKMIEVYRDSPPLIKLIVLVHNLDGPMV 408
            F  I +I+++ E    + ++ YW N ++LQ++++ + ++  PP +K+I+L+HNLDGP  
Sbjct: 342 IFLDIFKILVEGETIDDQGQSNYWDNRIDLQMDRLSKYFKKRPPTVKMILLIHNLDGPSF 401

Query: 409 RKDPFQNMLSSLSRVRQIALIASTDNLYAPLLWDHVRAQNFNFIFHDITNYQSYAVESSF 468
           R++ FQ  +S L++++QI ++AS D++ AP LWDH RAQ+FNF++HDITN++ Y VE+  
Sbjct: 402 RREHFQTRMSILAQIKQICVVASVDHIQAPFLWDHFRAQSFNFVYHDITNFEPYIVETVQ 461

Query: 469 SD-IMQLGRSAGTT-GAEGARYVLESLTSNSKRMYKLLIETQLSNMDSQGKAVANKRGSH 526
           +D  +   + +GT   A GA+YVLESLT NSKRMYK+L++  +  ++++ ++    + S 
Sbjct: 462 TDNAIDFSKDSGTLFNANGAKYVLESLTDNSKRMYKILLQLLMGQINAKNESKPRAKSSS 521

Query: 527 AF----GIEFKQFYHMCAADFIASNEVSLRSMLGEFIEHKMAAMSRDRTGAETLYIPYVH 582
                 GIEF + +  C   F+ S+E+ LR++L EFI+HKMA  ++++ G E + + Y +
Sbjct: 522 LNKITPGIEFSELFKTCTEQFVVSSEMGLRTILSEFIDHKMAVNTKNKMGKEIINVKYSY 581

Query: 583 SEMQ 586
            +M+
Sbjct: 582 GDME 585

>Scas_721.105
          Length = 421

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 67/159 (42%), Gaps = 15/159 (9%)

Query: 351 AFHSISQIMMQEELSKSETKYWGNHVELQINKMIEVYRDSPPLIKLIVLVHNLDGPMVRK 410
            FH    I++ E+ +K E       +  Q++K+I     +PP     ++   L+   +R 
Sbjct: 266 CFH----IVLPEQDTKEELTTVKKALSSQLSKIIRSEVSNPPAYGAKIVATILNSDELRA 321

Query: 411 DPFQNMLSSLSRVRQ--IALIASTDNLYAPLLWDHVRAQNFNFIFHDITN---------Y 459
             +++M++  SR+ +  + L    + L  P  WDH+  Q   F F  +T+         +
Sbjct: 322 QWYKDMITMSSRIMEMRVTLRDRLNELGTPGTWDHIVEQTGMFSFTGLTSEMVARLEKEH 381

Query: 460 QSYAVESSFSDIMQLGRSAGTTGAEGARYVLESLTSNSK 498
             Y V S  + I  L +      A+    V+   T+ SK
Sbjct: 382 SIYMVSSGRASIAGLNKLNVDRVAQSIDEVVRHFTNESK 420

>AEL186W [2320] [Homologous to ScYBR275C (RIF1) - SH]
           complement(285808..290994) [5187 bp, 1728 aa]
          Length = 1728

 Score = 33.9 bits (76), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 35/88 (39%), Positives = 46/88 (52%), Gaps = 18/88 (20%)

Query: 100 RKRGRPRSVKAEHDPKITTPSVNASPSR-SISPQGPRKLTKLEPVPESEFVTANSSPIKS 158
           R  GRPR+      P+I     NA   R ++S   P K    + V  SE VT  SSPI++
Sbjct: 121 RAAGRPRT-----SPEIRVERQNADEERPTLSASSPLK----KSVVFSEEVT--SSPIRA 169

Query: 159 SHVFSSPAKS-----PSKPVLKQSPFKI 181
           + V SSP +S     PSK +LK SP K+
Sbjct: 170 T-VSSSPVRSAHNRPPSKSILKSSPSKL 196

>Kwal_56.23939
          Length = 671

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 71/160 (44%), Gaps = 13/160 (8%)

Query: 23  RLLPIIWRFVGRRARKTGRAGSMSPAKRRTPSPVKQEDTSELEQLSHDHEKSAGATPEVK 82
           ++LP++W F      K       S A  +  + +++    +LE+ +        A  E  
Sbjct: 455 QVLPLLWNFSMSMTLKPAFYAEYSTAINKISAEIQKSHLRKLEEATGQQ----LAVQEAS 510

Query: 83  VDSLPPRSPSQSPVRHPRKRGRPRSVKAEHDPKITTPSVNASPSRSISPQGPRKLTKLEP 142
            D +  + P Q P   P  +   R+++    P I   S ++SP+  + P+ PR     +P
Sbjct: 511 FDKVIEK-PVQKP-NDPDAQAS-RNIRT---PAIMPKSTSSSPAVVLKPR-PRSKPSSKP 563

Query: 143 VPESEFVTA--NSSPIKSSHVFSSPAKSPSKPVLKQSPFK 180
           +  ++ VT   N  P  S+ V    +K  + PV+KQ+P +
Sbjct: 564 LVLAKGVTTATNPKPYTSTTVKQPVSKHSTTPVMKQTPLR 603

>YMR133W (REC114) [4090] chr13 (536206..537447,537564..537608)
           Meiotic recombination protein, mutants are defective in
           double-strand break formation [1287 bp, 428 aa]
          Length = 428

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%)

Query: 349 RDAFHSISQIMMQEELSKSETKYWGNHVELQINKMIE 385
           R+A   IS+ +++E+L   E   W N VE  +NKM E
Sbjct: 391 RNASRKISKRLIKEKLKDEEFMKWVNKVETVLNKMFE 427

>CAGL0F03465g complement(340640..343438) similar to sp|P48524
           Saccharomyces cerevisiae YMR275c BUL1 or sp|Q03758
           Saccharomyces cerevisiae YML111w BUL2, hypothetical
           start
          Length = 932

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 51/118 (43%), Gaps = 9/118 (7%)

Query: 33  GRRARKTGRAGSMSPAKRRTPSPVKQEDTSELEQLSHDHEKSAGATPEVKVDSLPP-RSP 91
           G   R+ GR    SPA     S ++   TS + +L  +H  S        + +L P R P
Sbjct: 13  GIMERERGRKKQQSPALSSPSSWLRSASTSSIRRLRREHPASGLNVSHTPLKNLSPVRRP 72

Query: 92  SQSPVRHPRKRGRPRSVKAEHDPKITTPSVNASPSRSISPQGPRKLTKLEPVPESEFV 149
           + S V       RP +V+      +TTP+ +AS SR  +   P K   L+   ES  V
Sbjct: 73  ASSSVER-----RPATVQPF---SLTTPNSSASLSRMAASVPPNKPNLLKRNSESRVV 122

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.131    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,718,253
Number of extensions: 814717
Number of successful extensions: 3476
Number of sequences better than 10.0: 139
Number of HSP's gapped: 3405
Number of HSP's successfully gapped: 177
Length of query: 587
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 480
Effective length of database: 12,891,983
Effective search space: 6188151840
Effective search space used: 6188151840
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)