Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_27.109391101105952e-81
Scas_569.4*1101105032e-67
YDR045C (RPC11)1101104981e-66
KLLA0F18568g1121124981e-66
AGR029W1121124685e-62
CAGL0H08415g1001004414e-58
Sklu_2357.91021024191e-54
Sklu_2119.41251221213e-09
Scas_621.15307351237e-09
YGL043W (DST1)309351227e-09
CAGL0D06160g306351229e-09
AGR011W304351211e-08
KLLA0F09361g292351201e-08
Sklu_2213.5287351192e-08
Kwal_27.99721251301152e-08
Kwal_26.7521301351192e-08
Scas_673.30*1481251134e-08
KLLA0B13860g1601221111e-07
YJR063W (RPA12)125431082e-07
AFR417W125431073e-07
KLLA0D03234g122114933e-05
CAGL0F00561g12843908e-05
YGL070C (RPB9)122110872e-04
CAGL0H03509g122110838e-04
Sklu_1830.311038650.28
AFR518C43676611.4
Scas_544.7d17379592.5
CAGL0F04939g77240567.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10939
         (110 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10939                                                         233   2e-81
Scas_569.4*                                                           198   2e-67
YDR045C (RPC11) [898] chr4 complement(547974..548306) RNA polyme...   196   1e-66
KLLA0F18568g complement(1708319..1708657) highly similar to sp|Q...   196   1e-66
AGR029W [4339] [Homologous to ScYDR045C (RPC11) - SH] complement...   184   5e-62
CAGL0H08415g 824631..824933 highly similar to sp|Q04307 Saccharo...   174   4e-58
Sklu_2357.9 YDR045C, Contig c2357 12849-13157 reverse complement      166   1e-54
Sklu_2119.4 YJR063W, Contig c2119 5697-6074 reverse complement         51   3e-09
Scas_621.15                                                            52   7e-09
YGL043W (DST1) [1934] chr7 (417485..418414) Transcription elonga...    52   7e-09
CAGL0D06160g complement(580707..581627) highly similar to sp|P07...    52   9e-09
AGR011W [4321] [Homologous to ScYGL043W (DST1) - SH] complement(...    51   1e-08
KLLA0F09361g complement(864425..865303) similar to sp|P07273 Sac...    51   1e-08
Sklu_2213.5 YGL043W, Contig c2213 7532-8395                            50   2e-08
Kwal_27.9972                                                           49   2e-08
Kwal_26.7521                                                           50   2e-08
Scas_673.30*                                                           48   4e-08
KLLA0B13860g 1215461..1215943 some similarities with sp|P32529 S...    47   1e-07
YJR063W (RPA12) [2957] chr10 (555109..555486) RNA polymerase I s...    46   2e-07
AFR417W [3609] [Homologous to ScYJR063W (RPA12) - SH] complement...    46   3e-07
KLLA0D03234g 270311..270679 highly similar to sp|P27999 Saccharo...    40   3e-05
CAGL0F00561g complement(58585..58971) highly similar to sp|P3252...    39   8e-05
YGL070C (RPB9) [1910] chr7 complement(374460..374828) RNA polyme...    38   2e-04
CAGL0H03509g complement(326276..326644) highly similar to sp|P27...    37   8e-04
Sklu_1830.3 YGL070C, Contig c1830 5480-5812 reverse complement         30   0.28 
AFR518C [3710] [Homologous to NOHBY] (1364371..1365681) [1311 bp...    28   1.4  
Scas_544.7d                                                            27   2.5  
CAGL0F04939g 503890..506208 highly similar to sp|P29496 Saccharo...    26   7.0  

>Kwal_27.10939
          Length = 110

 Score =  233 bits (595), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 110/110 (100%), Positives = 110/110 (100%)

Query: 1   MLSFCPTCHNMLVVSPAESGAYALKCGSCPYAFPIEGVEVYDRKTLPRKEVDDVLGGGWD 60
           MLSFCPTCHNMLVVSPAESGAYALKCGSCPYAFPIEGVEVYDRKTLPRKEVDDVLGGGWD
Sbjct: 1   MLSFCPTCHNMLVVSPAESGAYALKCGSCPYAFPIEGVEVYDRKTLPRKEVDDVLGGGWD 60

Query: 61  NVDQTAVQCPNYDQCAGERAYFFQLQIRSADEPMTTFYKCVSCGNRWREN 110
           NVDQTAVQCPNYDQCAGERAYFFQLQIRSADEPMTTFYKCVSCGNRWREN
Sbjct: 61  NVDQTAVQCPNYDQCAGERAYFFQLQIRSADEPMTTFYKCVSCGNRWREN 110

>Scas_569.4*
          Length = 110

 Score =  198 bits (503), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 99/110 (90%)

Query: 1   MLSFCPTCHNMLVVSPAESGAYALKCGSCPYAFPIEGVEVYDRKTLPRKEVDDVLGGGWD 60
           MLSFCP C+NML+++ A+SG Y L C SCPY FPIEG+E+YDRKTLPRKEVDDVLGGGWD
Sbjct: 1   MLSFCPLCNNMLLITTADSGVYTLTCRSCPYEFPIEGIEIYDRKTLPRKEVDDVLGGGWD 60

Query: 61  NVDQTAVQCPNYDQCAGERAYFFQLQIRSADEPMTTFYKCVSCGNRWREN 110
           NVDQT VQCPNY++C GE AYFFQLQIRSADEPMTTFYKCV+C +RW+EN
Sbjct: 61  NVDQTKVQCPNYEKCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKEN 110

>YDR045C (RPC11) [898] chr4 complement(547974..548306) RNA
           polymerase III subunit C11, required for RNA cleavage
           activity and transcription termination [333 bp, 110 aa]
          Length = 110

 Score =  196 bits (498), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 97/110 (88%)

Query: 1   MLSFCPTCHNMLVVSPAESGAYALKCGSCPYAFPIEGVEVYDRKTLPRKEVDDVLGGGWD 60
           MLSFCP+C+NML+++  +SG Y L C SCPY FPIEG+E+YDRK LPRKEVDDVLGGGWD
Sbjct: 1   MLSFCPSCNNMLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLGGGWD 60

Query: 61  NVDQTAVQCPNYDQCAGERAYFFQLQIRSADEPMTTFYKCVSCGNRWREN 110
           NVDQT  QCPNYD C GE AYFFQLQIRSADEPMTTFYKCV+CG+RW+EN
Sbjct: 61  NVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWKEN 110

>KLLA0F18568g complement(1708319..1708657) highly similar to
           sp|Q04307 Saccharomyces cerevisiae YDR045c RPC11 RNA
           polymerase III subunit C11, required for RNA cleavage
           activity and transcription termination singleton, start
           by similarity
          Length = 112

 Score =  196 bits (498), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 100/112 (89%), Gaps = 2/112 (1%)

Query: 1   MLSFCPTCHNMLVVSPAESGAYALKCGSCPYAFPIEGVEVYDRKTLPRKEVDDVLGG--G 58
           MLSFCP C+NML+VS A+SG Y L CGSCPY F I+G+EVYDRK LPRKEVDDVLGG   
Sbjct: 1   MLSFCPLCNNMLLVSKADSGLYKLACGSCPYQFLIDGIEVYDRKNLPRKEVDDVLGGEGA 60

Query: 59  WDNVDQTAVQCPNYDQCAGERAYFFQLQIRSADEPMTTFYKCVSCGNRWREN 110
           WDNVDQTA QCPN+DQCAGERAYFFQLQIRSADEPMTTFYKCV+CG++WREN
Sbjct: 61  WDNVDQTAAQCPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKWREN 112

>AGR029W [4339] [Homologous to ScYDR045C (RPC11) - SH]
           complement(768240..768578) [339 bp, 112 aa]
          Length = 112

 Score =  184 bits (468), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 86/112 (76%), Positives = 96/112 (85%), Gaps = 2/112 (1%)

Query: 1   MLSFCPTCHNMLVVSPAESGAYALKCGSCPYAFPIEGVEVYDRKTLPRKEVDDVLGG--G 58
           MLSFCP C+NML VS  +SG Y L C SCPY FPIEGVE+YDR+ LPRKEVDDVLGG   
Sbjct: 1   MLSFCPYCNNMLPVSKGDSGVYRLGCPSCPYEFPIEGVEIYDRRNLPRKEVDDVLGGEGA 60

Query: 59  WDNVDQTAVQCPNYDQCAGERAYFFQLQIRSADEPMTTFYKCVSCGNRWREN 110
           WDNVDQTAVQCP ++ C GE+AYFFQLQIRSADEPMTTFYKCV+CG++WREN
Sbjct: 61  WDNVDQTAVQCPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKWREN 112

>CAGL0H08415g 824631..824933 highly similar to sp|Q04307
           Saccharomyces cerevisiae YDR045c RPC11, start by
           similarity
          Length = 100

 Score =  174 bits (441), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 87/100 (87%)

Query: 11  MLVVSPAESGAYALKCGSCPYAFPIEGVEVYDRKTLPRKEVDDVLGGGWDNVDQTAVQCP 70
           ML+V+ +++G Y L C SCPY FPIE +E+YDRK LPRKEVDDVLGGGWDNVDQT VQCP
Sbjct: 1   MLLVATSDNGVYNLSCRSCPYEFPIESIEIYDRKKLPRKEVDDVLGGGWDNVDQTKVQCP 60

Query: 71  NYDQCAGERAYFFQLQIRSADEPMTTFYKCVSCGNRWREN 110
           NYD C GE AYFFQLQIRSADEPMTTFYKCV+C +RW+EN
Sbjct: 61  NYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKEN 100

>Sklu_2357.9 YDR045C, Contig c2357 12849-13157 reverse complement
          Length = 102

 Score =  166 bits (419), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 75/102 (73%), Positives = 86/102 (84%), Gaps = 2/102 (1%)

Query: 11  MLVVSPAESGAYALKCGSCPYAFPIEGVEVYDRKTLPRKEVDDVLGG--GWDNVDQTAVQ 68
           ML+++  ++G Y L C SCPY FPIEG+EVYDRKTL RKEVDDVLGG   WDNVDQT  Q
Sbjct: 1   MLLIATNDAGIYKLNCPSCPYEFPIEGIEVYDRKTLVRKEVDDVLGGEGAWDNVDQTGAQ 60

Query: 69  CPNYDQCAGERAYFFQLQIRSADEPMTTFYKCVSCGNRWREN 110
           CPN+D C G +AYFFQLQIRSADEPMTTFYKCV+CG++WREN
Sbjct: 61  CPNHDNCGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKWREN 102

>Sklu_2119.4 YJR063W, Contig c2119 5697-6074 reverse complement
          Length = 125

 Score = 51.2 bits (121), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 55/122 (45%), Gaps = 17/122 (13%)

Query: 2   LSFCPTCHNMLVVSPAESGAYALKCGSCPYAFP---IEGVEVYDR-------KTLPRKEV 51
           L FC  C N+L  +P+   +  ++C  C   +P      ++V           TL  K+ 
Sbjct: 7   LIFCLDCGNLLD-NPSTVSSPDIECSQCQATYPKSKFSNLKVVTSTADDAFPSTLRSKKS 65

Query: 52  DDVLGGGWDNVDQTAV---QCPNYDQCAGERAYFFQLQIRSADEPMTTFYKCVSCGNRWR 108
                   D +D+ A    +CP   QC  +   +  LQ+RSADE  T FY C SCG R+R
Sbjct: 66  VVKTSLKKDELDEGATIKEKCP---QCGNDEMRYHTLQLRSADEGATVFYTCTSCGYRFR 122

Query: 109 EN 110
            N
Sbjct: 123 TN 124

>Scas_621.15
          Length = 307

 Score = 52.0 bits (123), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%)

Query: 74  QCAGERAYFFQLQIRSADEPMTTFYKCVSCGNRWR 108
           +C  ++  ++QLQ RSADEP+TTF  C +CGNRW+
Sbjct: 271 KCKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 305

>YGL043W (DST1) [1934] chr7 (417485..418414) Transcription
           elongation factor S-II, a DNA strand transfer protein
           catalyzing homologous DNA strand exchange [930 bp, 309
           aa]
          Length = 309

 Score = 51.6 bits (122), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%)

Query: 74  QCAGERAYFFQLQIRSADEPMTTFYKCVSCGNRWR 108
           +C  ++  ++QLQ RSADEP+TTF  C +CGNRW+
Sbjct: 273 KCKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 307

>CAGL0D06160g complement(580707..581627) highly similar to sp|P07273
           Saccharomyces cerevisiae YGL043w DST1 TFIIS, start by
           similarity
          Length = 306

 Score = 51.6 bits (122), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%)

Query: 74  QCAGERAYFFQLQIRSADEPMTTFYKCVSCGNRWR 108
           +C  ++  ++QLQ RSADEP+TTF  C +CGNRW+
Sbjct: 270 KCKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 304

>AGR011W [4321] [Homologous to ScYGL043W (DST1) - SH]
           complement(737606..738520) [915 bp, 304 aa]
          Length = 304

 Score = 51.2 bits (121), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%)

Query: 74  QCAGERAYFFQLQIRSADEPMTTFYKCVSCGNRWR 108
           +C  ++  ++QLQ RSADEP+TTF  C +CGNRW+
Sbjct: 268 KCKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 302

>KLLA0F09361g complement(864425..865303) similar to sp|P07273
           Saccharomyces cerevisiae YGL043w DST1 TFIIS
           (transcription elongation factor) singleton, start by
           similarity
          Length = 292

 Score = 50.8 bits (120), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%)

Query: 74  QCAGERAYFFQLQIRSADEPMTTFYKCVSCGNRWR 108
           +C   +  ++QLQ RSADEP+TTF  C +CGNRW+
Sbjct: 256 KCKQRKVSYYQLQTRSADEPLTTFCTCENCGNRWK 290

>Sklu_2213.5 YGL043W, Contig c2213 7532-8395
          Length = 287

 Score = 50.4 bits (119), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%)

Query: 74  QCAGERAYFFQLQIRSADEPMTTFYKCVSCGNRWR 108
           +C  ++  ++QLQ RSADEP+TTF  C  CGNRW+
Sbjct: 251 KCKEKKVSYYQLQTRSADEPLTTFCTCEVCGNRWK 285

>Kwal_27.9972
          Length = 125

 Score = 48.9 bits (115), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 56/130 (43%), Gaps = 33/130 (25%)

Query: 2   LSFCPTCHNMLVVSPAESGAYALKCGSCPY-------------------AFP--IEGVEV 40
           L FC  C N+L  +P+    + ++C  C                     AFP  +   + 
Sbjct: 7   LIFCAECGNLLD-NPSAVETFHIECSQCGASYDKSKFSNLRVVTATADDAFPSALRSKKS 65

Query: 41  YDRKTLPRKEVDDVLGGGWDNVDQTAVQCPNYDQCAGERAYFFQLQIRSADEPMTTFYKC 100
             + +L + E++D  G           +CP   QC  +  ++  LQ+RSADE  T FY C
Sbjct: 66  VVKTSLHKNELED--GATIRE------KCP---QCGNDEMHYHTLQLRSADEGATVFYTC 114

Query: 101 VSCGNRWREN 110
            SCG R+R N
Sbjct: 115 TSCGYRFRTN 124

>Kwal_26.7521
          Length = 301

 Score = 50.4 bits (119), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%)

Query: 74  QCAGERAYFFQLQIRSADEPMTTFYKCVSCGNRWR 108
           +C  ++  ++QLQ RSADEP+TTF  C  CGNRW+
Sbjct: 265 KCKEKKVSYYQLQTRSADEPLTTFCTCEVCGNRWK 299

>Scas_673.30*
          Length = 148

 Score = 48.1 bits (113), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 58/125 (46%), Gaps = 20/125 (16%)

Query: 2   LSFCPTCHNMLVVSPAESGAYA---LKCGSCPYAFP------IEGVEVYDRKTLPR--KE 50
           L FC  C N+L  +P ++G+     ++C  C   +P      ++ V        P   + 
Sbjct: 27  LIFCLDCGNLLD-TPHQTGSSKHDDIECSQCQAKYPKSEFSNLKVVTATAEDAFPSALRS 85

Query: 51  VDDVLGGGW--DNVDQTAV---QCPNYDQCAGERAYFFQLQIRSADEPMTTFYKCVSCGN 105
              V+      D +++ AV   +CP   QC  +  ++  LQ+RSADE  T FY C  CG 
Sbjct: 86  KKSVVKTTLKKDELEEGAVIKEKCP---QCGNDEMHYHTLQLRSADEGATVFYTCTKCGY 142

Query: 106 RWREN 110
           ++R N
Sbjct: 143 KFRTN 147

>KLLA0B13860g 1215461..1215943 some similarities with sp|P32529
           Saccharomyces cerevisiae YJR063w RPA12 DNA-directed RNA
           polymerase I, 13. 7 KD subunit singleton, hypothetical
           start
          Length = 160

 Score = 47.4 bits (111), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 57/122 (46%), Gaps = 18/122 (14%)

Query: 2   LSFCPTCHNMLVVSPAESGAYALKCGSCPYAFP------IEGVEVYDRKTLP-----RKE 50
           L FC  C ++L     ES    ++C  C  ++       ++ V   + K+ P     +K 
Sbjct: 43  LIFCLECGDLL--DGQESSQGKIRCNQCNASYNSSKFQNLKVVTSTNDKSFPSKIRSKKS 100

Query: 51  VDDVLGGGWDNVDQTAV--QCPNYDQCAGERAYFFQLQIRSADEPMTTFYKCVSCGNRWR 108
           +        +  D   +  +CP   +CA ++ ++  LQ+RSADE  T FY C +CG R+R
Sbjct: 101 LVKTSIAKNELKDGAIINEKCP---KCANDKMHYHTLQLRSADEGATVFYTCTACGYRFR 157

Query: 109 EN 110
            N
Sbjct: 158 TN 159

>YJR063W (RPA12) [2957] chr10 (555109..555486) RNA polymerase I
           subunit A12.2 [378 bp, 125 aa]
          Length = 125

 Score = 46.2 bits (108), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 68  QCPNYDQCAGERAYFFQLQIRSADEPMTTFYKCVSCGNRWREN 110
           +CP   QC  E   +  LQ+RSADE  T FY C SCG ++R N
Sbjct: 85  KCP---QCGNEEMNYHTLQLRSADEGATVFYTCTSCGYKFRTN 124

>AFR417W [3609] [Homologous to ScYJR063W (RPA12) - SH]
           complement(1184595..1184972) [378 bp, 125 aa]
          Length = 125

 Score = 45.8 bits (107), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 68  QCPNYDQCAGERAYFFQLQIRSADEPMTTFYKCVSCGNRWREN 110
           +CP   QC  +   +  LQ+RSADE  T FY C SCG R+R N
Sbjct: 85  KCP---QCGHDEMQYHTLQLRSADEGATVFYTCTSCGYRFRTN 124

>KLLA0D03234g 270311..270679 highly similar to sp|P27999
           Saccharomyces cerevisiae YGL070c RPB9 DNA-directed RNA
           polymerase II, 14. 2 KD subunit singleton, start by
           similarity
          Length = 122

 Score = 40.4 bits (93), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 44/114 (38%), Gaps = 19/114 (16%)

Query: 2   LSFCPTCHNMLV-VSPAESGAYALKCGSCPYAFPIEGVEVYDRKTLPRKEVDDVLG---- 56
             FC  C+NML      E+     +C +CPY        VY      R E+   +G    
Sbjct: 4   FRFCRDCNNMLYPREDKETHKLLFECRTCPYVEEAGTPLVY------RHELKTNIGETAG 57

Query: 57  -----GGWDNVDQTAVQCPNYDQCAGERAYFFQLQIRSADEPMTTFYKCVSCGN 105
                G    + ++  +CP   +C      FFQ Q R  D  M  FY C+ C +
Sbjct: 58  VVQDIGSDPTLPRSDKECP---KCHSRENVFFQSQQRRKDTSMVLFYVCLHCSH 108

>CAGL0F00561g complement(58585..58971) highly similar to sp|P32529
           Saccharomyces cerevisiae YJR063w RPA12 DNA-directed RNA
           polymerase I, start by similarity
          Length = 128

 Score = 39.3 bits (90), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 3/43 (6%)

Query: 68  QCPNYDQCAGERAYFFQLQIRSADEPMTTFYKCVSCGNRWREN 110
           +CP   +C  +   +  LQ+RSADE  T FY C+ C  ++R N
Sbjct: 88  KCP---KCGHDEMRYQTLQLRSADEGATVFYTCIKCNYKYRTN 127

>YGL070C (RPB9) [1910] chr7 complement(374460..374828) RNA
           polymerase II, non-essential subunit, involved in
           transcription start site selection [369 bp, 122 aa]
          Length = 122

 Score = 38.1 bits (87), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 44/110 (40%), Gaps = 11/110 (10%)

Query: 2   LSFCPTCHNMLV-VSPAESGAYALKCGSCPYAFPIEGVEVYDRKTLPRKEVDDVLG---- 56
             FC  C+NML      E+     +C +C Y        VY  + +    + +  G    
Sbjct: 4   FRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELIT--NIGETAGVVQD 61

Query: 57  -GGWDNVDQTAVQCPNYDQCAGERAYFFQLQIRSADEPMTTFYKCVSCGN 105
            G    + ++  +CP   +C      FFQ Q R  D  M  F+ C+SC +
Sbjct: 62  IGSDPTLPRSDRECP---KCHSRENVFFQSQQRRKDTSMVLFFVCLSCSH 108

>CAGL0H03509g complement(326276..326644) highly similar to sp|P27999
           Saccharomyces cerevisiae YGL070c RPB9, start by
           similarity
          Length = 122

 Score = 36.6 bits (83), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 44/110 (40%), Gaps = 11/110 (10%)

Query: 2   LSFCPTCHNMLV-VSPAESGAYALKCGSCPYAFPIEGVEVYDRKTLPRKEVDDVLG---- 56
             FC  C+NML      E+     +C +C Y        VY  + +    + +  G    
Sbjct: 4   FRFCRDCNNMLYPREDKENNRLLFECRTCSYIEEAGSPLVYRHELIT--NIGETAGVVQD 61

Query: 57  -GGWDNVDQTAVQCPNYDQCAGERAYFFQLQIRSADEPMTTFYKCVSCGN 105
            G    + ++  +CP   +C      FFQ Q R  D  M  F+ C++C +
Sbjct: 62  IGSDPTLPRSDRECP---KCHSRENVFFQSQQRRKDTSMVLFFVCLACSH 108

>Sklu_1830.3 YGL070C, Contig c1830 5480-5812 reverse complement
          Length = 110

 Score = 29.6 bits (65), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 3/38 (7%)

Query: 68  QCPNYDQCAGERAYFFQLQIRSADEPMTTFYKCVSCGN 105
           +CP   +C      FFQ Q R  D  M  F+ C++C +
Sbjct: 62  ECP---KCHSHENVFFQSQQRRKDTSMVLFFVCLACSH 96

>AFR518C [3710] [Homologous to NOHBY] (1364371..1365681) [1311 bp,
           436 aa]
          Length = 436

 Score = 28.1 bits (61), Expect = 1.4,   Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 34/76 (44%), Gaps = 3/76 (3%)

Query: 38  VEVYDRKTLPRKEVDDVLGGGWDNVDQTAVQCPNYDQ---CAGERAYFFQLQIRSADEPM 94
           +E+  R+ L  +E+++  G  W N D+   +  N  +   CA E+     L+++   E +
Sbjct: 345 IEIASRRRLTIRELENSYGSSWRNADKNFSRQINRRKKIWCAIEQGLLDGLELKECFEIL 404

Query: 95  TTFYKCVSCGNRWREN 110
             + +    G  W  N
Sbjct: 405 ENYVRDRGKGLSWYYN 420

>Scas_544.7d
          Length = 173

 Score = 27.3 bits (59), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 30/79 (37%), Gaps = 21/79 (26%)

Query: 5   CPTCHNMLVVSPAESGA---YALKCGSCPYAFPIEGVEVYDRKTLPR-----KEVDDV-- 54
           CP C   L V  A+S     Y   C  C Y +    + V D +++ +      E  +V  
Sbjct: 61  CPNCETALTVLLAKSSRKKRYKFTCKHCDYDYVTPSMSVTDERSISQIVDHLNETLNVEY 120

Query: 55  -----------LGGGWDNV 62
                      LGGG DNV
Sbjct: 121 LRFQELKKNIELGGGIDNV 139

>CAGL0F04939g 503890..506208 highly similar to sp|P29496
           Saccharomyces cerevisiae YLR274w CDC46 cell division
           control protein, start by similarity
          Length = 772

 Score = 26.2 bits (56), Expect = 7.0,   Method: Composition-based stats.
 Identities = 13/40 (32%), Positives = 21/40 (52%)

Query: 16  PAESGAYALKCGSCPYAFPIEGVEVYDRKTLPRKEVDDVL 55
           P  SGA +  CG  PY    E  +  D++ L  +EV +++
Sbjct: 232 PTGSGAASKNCGPDPYIIIHESSKFIDQQFLKLQEVPELV 271

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.137    0.461 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,613,367
Number of extensions: 132208
Number of successful extensions: 242
Number of sequences better than 10.0: 28
Number of HSP's gapped: 239
Number of HSP's successfully gapped: 28
Length of query: 110
Length of database: 16,596,109
Length adjustment: 80
Effective length of query: 30
Effective length of database: 13,826,669
Effective search space: 414800070
Effective search space used: 414800070
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)