Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_27.1093534432816730.0
Sklu_2357.834132814440.0
YDR044W (HEM13)32832313910.0
Scas_569.333332313810.0
KLLA0F18546g37532813480.0
CAGL0K12100g32732313020.0
AGR030C32431211781e-163
Sklu_2284.445274740.33
Sklu_2201.237937691.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10935
         (340 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10935                                                         649   0.0  
Sklu_2357.8 YDR044W, Contig c2357 11533-12558                         560   0.0  
YDR044W (HEM13) [897] chr4 (546638..547624) Coproporphyrinogen I...   540   0.0  
Scas_569.3                                                            536   0.0  
KLLA0F18546g 1706744..1707871 gi|26185795|emb|CAD58624.1 Kluyver...   523   0.0  
CAGL0K12100g 1183383..1184366 highly similar to sp|P11353 Saccha...   506   0.0  
AGR030C [4340] [Homologous to ScYDR044W (HEM13) - SH] (768609..7...   458   e-163
Sklu_2284.4 YOR051C, Contig c2284 4372-5730                            33   0.33 
Sklu_2201.2 YNL084C, Contig c2201 2932-4071 reverse complement         31   1.4  

>Kwal_27.10935
          Length = 344

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/328 (95%), Positives = 313/328 (95%)

Query: 13  THPAKMPAPVDPTRMPIRQQMEELIRRKQREITQGLETLDTVKFRPDSWTRGNDGGGGTS 72
           THPAKMPAPVDPTRMPIRQQMEELIRRKQREITQGLETLDTVKFRPDSWTRGNDGGGGTS
Sbjct: 13  THPAKMPAPVDPTRMPIRQQMEELIRRKQREITQGLETLDTVKFRPDSWTRGNDGGGGTS 72

Query: 73  MVLQNGTTFEKGGVNVSVVYGQLSPAAISAMKHDHKNLKLPTDPETGLPNADGVKFFACG 132
           MVLQNGTTFEKGGVNVSVVYGQLSPAAISAMKHDHKNLKLPTDPETGLPNADGVKFFACG
Sbjct: 73  MVLQNGTTFEKGGVNVSVVYGQLSPAAISAMKHDHKNLKLPTDPETGLPNADGVKFFACG 132

Query: 133 LSMVIHPSNPHAPTTHLNYRYFETWNPDGTPQTWWFGGGADLTPSYLYEEDARLFHQEHK 192
           LSMVIHPSNPHAPTTHLNYRYFETWNPDGTPQTWWFGGGADLTPSYLYEEDARLFHQEHK
Sbjct: 133 LSMVIHPSNPHAPTTHLNYRYFETWNPDGTPQTWWFGGGADLTPSYLYEEDARLFHQEHK 192

Query: 193 KALDKHDTSLYPRYKKWCDEYFFIKHRNETXXXXXXXXXXXXXXXPQEILSLIEDCFDAF 252
           KALDKHDTSLYPRYKKWCDEYFFIKHRNET               PQEILSLIEDCFDAF
Sbjct: 193 KALDKHDTSLYPRYKKWCDEYFFIKHRNETRGIGGIFFDDKDDRDPQEILSLIEDCFDAF 252

Query: 253 LPSYLPIIARRKDMPFTEEEKQWQLIRRGRYVEFNLVLDRGTQFGLRTPGSRTESILMSL 312
           LPSYLPIIARRKDMPFTEEEKQWQLIRRGRYVEFNLVLDRGTQFGLRTPGSRTESILMSL
Sbjct: 253 LPSYLPIIARRKDMPFTEEEKQWQLIRRGRYVEFNLVLDRGTQFGLRTPGSRTESILMSL 312

Query: 313 PVTACWFYDHHPEPGSREEKLLKVLESP 340
           PVTACWFYDHHPEPGSREEKLLKVLESP
Sbjct: 313 PVTACWFYDHHPEPGSREEKLLKVLESP 340

>Sklu_2357.8 YDR044W, Contig c2357 11533-12558
          Length = 341

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/328 (80%), Positives = 282/328 (85%)

Query: 13  THPAKMPAPVDPTRMPIRQQMEELIRRKQREITQGLETLDTVKFRPDSWTRGNDGGGGTS 72
            H   MPAP DP  +PIRQQME+LI RKQ+EIT+GLETLDTVKFR DSWTRGNDGGGGTS
Sbjct: 10  NHSTAMPAPQDPKHLPIRQQMEQLILRKQKEITKGLETLDTVKFRADSWTRGNDGGGGTS 69

Query: 73  MVLQNGTTFEKGGVNVSVVYGQLSPAAISAMKHDHKNLKLPTDPETGLPNADGVKFFACG 132
           MVLQNGTTFEKGGVN SVVYGQLSP AISAM+ DHKNL LP DP+TG PNADGV FFACG
Sbjct: 70  MVLQNGTTFEKGGVNTSVVYGQLSPKAISAMRQDHKNLHLPVDPQTGEPNADGVNFFACG 129

Query: 133 LSMVIHPSNPHAPTTHLNYRYFETWNPDGTPQTWWFGGGADLTPSYLYEEDARLFHQEHK 192
           LSMVIHP NPHAPTTHLNYRYFETWNPDG+PQ WWFGGGADLTPSYLYEEDA LFH+ HK
Sbjct: 130 LSMVIHPHNPHAPTTHLNYRYFETWNPDGSPQAWWFGGGADLTPSYLYEEDAILFHKLHK 189

Query: 193 KALDKHDTSLYPRYKKWCDEYFFIKHRNETXXXXXXXXXXXXXXXPQEILSLIEDCFDAF 252
           +ALDKHDT LYPR+KKWCDEYFFI HR ET               PQEIL L+EDCFDAF
Sbjct: 190 EALDKHDTDLYPRFKKWCDEYFFINHRGETRGIGGIFFDDLDDRDPQEILKLVEDCFDAF 249

Query: 253 LPSYLPIIARRKDMPFTEEEKQWQLIRRGRYVEFNLVLDRGTQFGLRTPGSRTESILMSL 312
           LPSYL I+ARRKDMP+TEEEKQWQ +RRGRYVEFNLVLDRGTQFGLRTPGSR ESILMSL
Sbjct: 250 LPSYLTIVARRKDMPYTEEEKQWQSLRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSL 309

Query: 313 PVTACWFYDHHPEPGSREEKLLKVLESP 340
           PVTA W YDHHP+ GSRE++LL+VL+ P
Sbjct: 310 PVTASWLYDHHPDAGSREDQLLEVLKHP 337

>YDR044W (HEM13) [897] chr4 (546638..547624) Coproporphyrinogen III
           oxidase, catalyzes the oxidative decarboxylation of
           coproporphyrinogen III to proto-porhyrinogen IX, the
           sixth step in heme biosynthetic pathway, repressed by
           oxygen [987 bp, 328 aa]
          Length = 328

 Score =  540 bits (1391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/323 (78%), Positives = 275/323 (85%)

Query: 18  MPAPVDPTRMPIRQQMEELIRRKQREITQGLETLDTVKFRPDSWTRGNDGGGGTSMVLQN 77
           MPAP DP  +PIRQQME LIRRKQ EITQGLE++DTVKF  D+WTRGNDGGGGTSMV+Q+
Sbjct: 1   MPAPQDPRNLPIRQQMEALIRRKQAEITQGLESIDTVKFHADTWTRGNDGGGGTSMVIQD 60

Query: 78  GTTFEKGGVNVSVVYGQLSPAAISAMKHDHKNLKLPTDPETGLPNADGVKFFACGLSMVI 137
           GTTFEKGGVNVSVVYGQLSPAA+SAMK DHKNL+LP DP+TGLP  DGVKFFACGLSMVI
Sbjct: 61  GTTFEKGGVNVSVVYGQLSPAAVSAMKADHKNLRLPEDPKTGLPVTDGVKFFACGLSMVI 120

Query: 138 HPSNPHAPTTHLNYRYFETWNPDGTPQTWWFGGGADLTPSYLYEEDARLFHQEHKKALDK 197
           HP NPHAPTTHLNYRYFETWN DGTPQTWWFGGGADLTPSYLYEED +LFHQ HK ALDK
Sbjct: 121 HPVNPHAPTTHLNYRYFETWNQDGTPQTWWFGGGADLTPSYLYEEDGQLFHQLHKDALDK 180

Query: 198 HDTSLYPRYKKWCDEYFFIKHRNETXXXXXXXXXXXXXXXPQEILSLIEDCFDAFLPSYL 257
           HDT+LYPR+KKWCDEYF+I HR ET               PQEIL ++EDCFDAFLPSYL
Sbjct: 181 HDTALYPRFKKWCDEYFYITHRKETRGIGGIFFDDYDERDPQEILKMVEDCFDAFLPSYL 240

Query: 258 PIIARRKDMPFTEEEKQWQLIRRGRYVEFNLVLDRGTQFGLRTPGSRTESILMSLPVTAC 317
            I+ RRKDMP+T+EE+QWQ IRRGRYVEFNL+ DRGTQFGLRTPGSR ESILMSLP  A 
Sbjct: 241 TIVKRRKDMPYTKEEQQWQAIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHAS 300

Query: 318 WFYDHHPEPGSREEKLLKVLESP 340
           W Y+HHP PGSRE KLL+V   P
Sbjct: 301 WLYNHHPAPGSREAKLLEVTTKP 323

>Scas_569.3
          Length = 333

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/323 (78%), Positives = 273/323 (84%)

Query: 18  MPAPVDPTRMPIRQQMEELIRRKQREITQGLETLDTVKFRPDSWTRGNDGGGGTSMVLQN 77
           MPAP D T +PIRQQME LIRRKQ EIT+GLE+LDTVKF  DSWTRGNDGGGGTSMV+ N
Sbjct: 7   MPAPQDKTHLPIRQQMEALIRRKQAEITKGLESLDTVKFHADSWTRGNDGGGGTSMVIAN 66

Query: 78  GTTFEKGGVNVSVVYGQLSPAAISAMKHDHKNLKLPTDPETGLPNADGVKFFACGLSMVI 137
           G+TFEKGGVNVSVVYG L+P A+ AMK DHKNLKLP DP+TGLP  DGVKFFACGLSMVI
Sbjct: 67  GSTFEKGGVNVSVVYGNLTPTAVLAMKDDHKNLKLPKDPKTGLPVPDGVKFFACGLSMVI 126

Query: 138 HPSNPHAPTTHLNYRYFETWNPDGTPQTWWFGGGADLTPSYLYEEDARLFHQEHKKALDK 197
           HP NPHAPTTHLNYRYFETWNPDGTPQ+WWFGGGADLTP YLYEEDA+ FH+ HKKALDK
Sbjct: 127 HPKNPHAPTTHLNYRYFETWNPDGTPQSWWFGGGADLTPFYLYEEDAKHFHELHKKALDK 186

Query: 198 HDTSLYPRYKKWCDEYFFIKHRNETXXXXXXXXXXXXXXXPQEILSLIEDCFDAFLPSYL 257
           HD +LYP+YKKWCDEYF+I HR ET               PQEIL + EDCFDAFLPSYL
Sbjct: 187 HDKTLYPKYKKWCDEYFYIAHRKETRGIGGIFFDDFDDRDPQEILKICEDCFDAFLPSYL 246

Query: 258 PIIARRKDMPFTEEEKQWQLIRRGRYVEFNLVLDRGTQFGLRTPGSRTESILMSLPVTAC 317
           PII +RKDMP+TEEEKQWQLIRRGRYVEFNL+ DRGTQFGLRTPGSR ESILMSLP  A 
Sbjct: 247 PIIEKRKDMPYTEEEKQWQLIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHAS 306

Query: 318 WFYDHHPEPGSREEKLLKVLESP 340
           W Y+HHP PGSRE KLL+V  +P
Sbjct: 307 WLYNHHPAPGSREAKLLEVTTNP 329

>KLLA0F18546g 1706744..1707871 gi|26185795|emb|CAD58624.1
           Kluyveromyces lactis putative coproporphyrinogen
           oxidase, start by similarity
          Length = 375

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/328 (75%), Positives = 273/328 (83%)

Query: 13  THPAKMPAPVDPTRMPIRQQMEELIRRKQREITQGLETLDTVKFRPDSWTRGNDGGGGTS 72
           TH       +  +++PIR++ME L+RRKQ+EIT+GLETLDTVKF+ DSW RGN+GGGG S
Sbjct: 44  THSKYYHCAMTDSQVPIRERMEALVRRKQQEITKGLETLDTVKFQADSWDRGNNGGGGVS 103

Query: 73  MVLQNGTTFEKGGVNVSVVYGQLSPAAISAMKHDHKNLKLPTDPETGLPNADGVKFFACG 132
           MVLQNGTTFEKGGVNVSVV+G LSP AI AMK DHKNL LP DP TG P+A GVKFFACG
Sbjct: 104 MVLQNGTTFEKGGVNVSVVHGNLSPPAIKAMKADHKNLHLPIDPATGEPDATGVKFFACG 163

Query: 133 LSMVIHPSNPHAPTTHLNYRYFETWNPDGTPQTWWFGGGADLTPSYLYEEDARLFHQEHK 192
           LSMVIHP NPHAPTTHLNYRYFETWN DGTPQ WWFGGGADLTPSYLYEEDA+LFHQ HK
Sbjct: 164 LSMVIHPINPHAPTTHLNYRYFETWNADGTPQAWWFGGGADLTPSYLYEEDAKLFHQLHK 223

Query: 193 KALDKHDTSLYPRYKKWCDEYFFIKHRNETXXXXXXXXXXXXXXXPQEILSLIEDCFDAF 252
            ALDK D +LYP+YKKWCDEYF+IKHR ET               P EIL ++E+CFDAF
Sbjct: 224 DALDKTDVALYPKYKKWCDEYFYIKHREETRGIGGIFFDDVDDRDPNEILQMVENCFDAF 283

Query: 253 LPSYLPIIARRKDMPFTEEEKQWQLIRRGRYVEFNLVLDRGTQFGLRTPGSRTESILMSL 312
           LPSYL II RRKDMP+TEEE+QWQ IRRGRYVEFNLVLDRGTQFGLRTPGSR ESILMSL
Sbjct: 284 LPSYLEIIKRRKDMPYTEEERQWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSL 343

Query: 313 PVTACWFYDHHPEPGSREEKLLKVLESP 340
           PVTA W YDHHPE  SRE+KLL+VL++P
Sbjct: 344 PVTASWLYDHHPEVDSREDKLLQVLKNP 371

>CAGL0K12100g 1183383..1184366 highly similar to sp|P11353
           Saccharomyces cerevisiae YDR044w HEM13
           coproporphyrinogen III oxidase, start by similarity
          Length = 327

 Score =  506 bits (1302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 236/323 (73%), Positives = 267/323 (82%), Gaps = 1/323 (0%)

Query: 18  MPAPVDPTRMPIRQQMEELIRRKQREITQGLETLDTVKFRPDSWTRGNDGGGGTSMVLQN 77
           M AP DP  +PIRQQME LIRRKQ+EIT+GLE++DTVKF  D+W RGNDGGGGTSMV+QN
Sbjct: 1   MTAPQDPKHLPIRQQMEALIRRKQKEITEGLESIDTVKFTADTWERGNDGGGGTSMVIQN 60

Query: 78  GTTFEKGGVNVSVVYGQLSPAAISAMKHDHKNLKLPTDPETGLPNADGVKFFACGLSMVI 137
           G+TFEKGGVNVSVVYG+L+P A+ AMK +HK+LKLP +   GLPN++GVKFFACGLSMVI
Sbjct: 61  GSTFEKGGVNVSVVYGELTPGAVLAMKQEHKDLKLP-ESANGLPNSEGVKFFACGLSMVI 119

Query: 138 HPSNPHAPTTHLNYRYFETWNPDGTPQTWWFGGGADLTPSYLYEEDARLFHQEHKKALDK 197
           HP NP APTTHLNYRYFETWNPDGTPQTWWFGGGADLTP YL+EEDA  FH+ HK ALDK
Sbjct: 120 HPVNPLAPTTHLNYRYFETWNPDGTPQTWWFGGGADLTPFYLFEEDAEHFHKLHKAALDK 179

Query: 198 HDTSLYPRYKKWCDEYFFIKHRNETXXXXXXXXXXXXXXXPQEILSLIEDCFDAFLPSYL 257
           HDT+LYPR+KKWCDEYF+I HR ET               PQEIL + EDCFDAFLPSYL
Sbjct: 180 HDTALYPRFKKWCDEYFYIAHRGETRGIGGIFFDDYNEKDPQEILKICEDCFDAFLPSYL 239

Query: 258 PIIARRKDMPFTEEEKQWQLIRRGRYVEFNLVLDRGTQFGLRTPGSRTESILMSLPVTAC 317
            I+ RRKD+P+ E++K WQLIRRGRY EFNL+ DRGTQFGLRTPGSR ESILMSLP+ A 
Sbjct: 240 TIMKRRKDLPYNEKQKNWQLIRRGRYAEFNLIYDRGTQFGLRTPGSRVESILMSLPLHAS 299

Query: 318 WFYDHHPEPGSREEKLLKVLESP 340
           W Y+HHPEPGS E KLL+V   P
Sbjct: 300 WVYNHHPEPGSEEAKLLEVTTKP 322

>AGR030C [4340] [Homologous to ScYDR044W (HEM13) - SH]
           (768609..769583) [975 bp, 324 aa]
          Length = 324

 Score =  458 bits (1178), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 216/312 (69%), Positives = 250/312 (80%), Gaps = 2/312 (0%)

Query: 29  IRQQMEELIRRKQREITQGLETLDTVKFRPDSWTRGNDGGGGTSMVLQNGTTFEKGGVNV 88
           +R++MEEL+RRKQREIT   E +DTVKF+ DSW R  +GGGGTS VLQ+GTTFEK GVNV
Sbjct: 9   MRERMEELVRRKQREITAAFEAIDTVKFKADSWER-KEGGGGTSCVLQHGTTFEKAGVNV 67

Query: 89  SVVYGQLSPAAISAMKHDHKNLKLPTDPETGLPNADGVKFFACGLSMVIHPSNPHAPTTH 148
           SVV+G+LSPAA+SAM+ +HKNL LPTDP TG P A GV+FFACG+S+V+HP NPHAPT H
Sbjct: 68  SVVHGELSPAAVSAMRAEHKNLHLPTDPVTGQPAA-GVRFFACGISLVMHPVNPHAPTVH 126

Query: 149 LNYRYFETWNPDGTPQTWWFGGGADLTPSYLYEEDARLFHQEHKKALDKHDTSLYPRYKK 208
           LNYRYFETW+  G PQTWWFGGG+DLTPSYLYEEDARLFH  HK ALD+ D +LYPR+KK
Sbjct: 127 LNYRYFETWDAAGKPQTWWFGGGSDLTPSYLYEEDARLFHAAHKAALDRTDPALYPRFKK 186

Query: 209 WCDEYFFIKHRNETXXXXXXXXXXXXXXXPQEILSLIEDCFDAFLPSYLPIIARRKDMPF 268
           WCDEYF+IKHR E+               P+ +L + EDC DAF+P+Y  I+ RRKDMP+
Sbjct: 187 WCDEYFWIKHRGESRGIGGIFYDDADDREPETLLRMAEDCLDAFVPAYKTIMLRRKDMPY 246

Query: 269 TEEEKQWQLIRRGRYVEFNLVLDRGTQFGLRTPGSRTESILMSLPVTACWFYDHHPEPGS 328
           T  E +WQ IRRGRYVEFNLVLDRGTQFGLRTPGSR ESILMSLPVTA W YDHHP  G+
Sbjct: 247 TAAEHEWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTARWEYDHHPAEGT 306

Query: 329 REEKLLKVLESP 340
           RE  LL+VL  P
Sbjct: 307 REAALLEVLRHP 318

>Sklu_2284.4 YOR051C, Contig c2284 4372-5730
          Length = 452

 Score = 33.1 bits (74), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 5/74 (6%)

Query: 152 RYFETWNPDGTPQTWWFGGGADLTPSYLYEEDARLFHQEHKKA---LDKHDTSLYPRYKK 208
           +YFE  N    PQTW     A +    LY+  +    + ++KA   L+K + + + +YK 
Sbjct: 381 KYFEKANDRNDPQTWVDVAEAAIDLGNLYDYQSAQQEESYQKAEELLNKANRATHGKYKD 440

Query: 209 WCDEYFFIKHRNET 222
             D   F+ ++NE 
Sbjct: 441 ILDN--FLANKNEA 452

>Sklu_2201.2 YNL084C, Contig c2201 2932-4071 reverse complement
          Length = 379

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%)

Query: 21  PVDPTRMPIRQQMEELIRRKQREITQGLETLDTVKFR 57
           P++ +   IRQQ EEL++ KQ ++ QG +    V  R
Sbjct: 304 PLNASTRMIRQQFEELLKYKQDQLVQGSKNTPAVNIR 340

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.137    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,598,517
Number of extensions: 517208
Number of successful extensions: 1097
Number of sequences better than 10.0: 13
Number of HSP's gapped: 1098
Number of HSP's successfully gapped: 13
Length of query: 340
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 238
Effective length of database: 13,065,073
Effective search space: 3109487374
Effective search space used: 3109487374
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)