Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_27.1055033533116760.0
Sklu_2357.63643657631e-100
AGR032W3312986557e-84
YBR065C (ECM2)3643216579e-84
Scas_718.453763416335e-80
CAGL0L07458g3643285422e-66
KLLA0F18502g3022712503e-24
Scas_704.16*98347770.15
YAL013W (DEP1)42043662.8
CAGL0H06347g59276654.5
Scas_482.242352627.9
Scas_579.14d22131618.0
Scas_650.2299387629.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10550
         (331 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10550                                                         650   0.0  
Sklu_2357.6 YBR065C, Contig c2357 7338-8432 reverse complement        298   e-100
AGR032W [4342] [Homologous to ScYBR065C (ECM2) - SH] complement(...   256   7e-84
YBR065C (ECM2) [255] chr2 complement(368545..369639) Putative pr...   257   9e-84
Scas_718.45                                                           248   5e-80
CAGL0L07458g complement(820608..821702) similar to sp|P38241 Sac...   213   2e-66
KLLA0F18502g complement(1699447..1700355) some similarities with...   100   3e-24
Scas_704.16*                                                           34   0.15 
YAL013W (DEP1) [55] chr1 (129273..130535) Regulator of phospholi...    30   2.8  
CAGL0H06347g 625360..627138 similar to sp|P31385 Saccharomyces c...    30   4.5  
Scas_482.2                                                             28   7.9  
Scas_579.14d                                                           28   8.0  
Scas_650.22                                                            28   9.3  

>Kwal_27.10550
          Length = 335

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/331 (95%), Positives = 317/331 (95%)

Query: 1   MEPAICEACLGDQTRLTRAVNGAECKICTLAFTVYHFKTHHKVNRTVICHNCSKQRNICQ 60
           MEPAICEACLGDQTRLTRAVNGAECKICTLAFTVYHFKTHHKVNRTVICHNCSKQRNICQ
Sbjct: 1   MEPAICEACLGDQTRLTRAVNGAECKICTLAFTVYHFKTHHKVNRTVICHNCSKQRNICQ 60

Query: 61  CCLLDLQWHIPVELRDRVLSLIQGSEVATEEAQNDMMKRFIALKDGSTYKVGGAKVTSDA 120
           CCLLDLQWHIPVELRDRVLSLIQGSEVATEEAQNDMMKRFIALKDGSTYKVGGAKVTSDA
Sbjct: 61  CCLLDLQWHIPVELRDRVLSLIQGSEVATEEAQNDMMKRFIALKDGSTYKVGGAKVTSDA 120

Query: 121 SATADVIERIRDTLQAVEDKDNSNANVKSAAIAPQSVTEVDIXXXXXXXXXXXXXXEGTA 180
           SATADVIERIRDTLQAVEDKDNSNANVKSAAIAPQSVTEVDI              EGTA
Sbjct: 121 SATADVIERIRDTLQAVEDKDNSNANVKSAAIAPQSVTEVDISHLLKKLPLKGSLSEGTA 180

Query: 181 FFLYNIDPALPEWAVVDAISEVVETPSWQEPVSASVAINHTARCGGIRFKNAELAQKFRD 240
           FFLYNIDPALPEWAVVDAISEVVETPSWQEPVSASVAINHTARCGGIRFKNAELAQKFRD
Sbjct: 181 FFLYNIDPALPEWAVVDAISEVVETPSWQEPVSASVAINHTARCGGIRFKNAELAQKFRD 240

Query: 241 SIETFKAESGLIKGKLLVQNSRVHVVSWPQFHRAALGTKNAECRKLALSLDKLVQKDLTA 300
           SIETFKAESGLIKGKLLVQNSRVHVVSWPQFHRAALGTKNAECRKLALSLDKLVQKDLTA
Sbjct: 241 SIETFKAESGLIKGKLLVQNSRVHVVSWPQFHRAALGTKNAECRKLALSLDKLVQKDLTA 300

Query: 301 SSKNTTLTKKQGRVAKKSSAIKEKKRSRRIA 331
           SSKNTTLTKKQGRVAKKSSAIKEKKRSRRIA
Sbjct: 301 SSKNTTLTKKQGRVAKKSSAIKEKKRSRRIA 331

>Sklu_2357.6 YBR065C, Contig c2357 7338-8432 reverse complement
          Length = 364

 Score =  298 bits (763), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 160/365 (43%), Positives = 219/365 (60%), Gaps = 46/365 (12%)

Query: 2   EPAICEACLGDQT---RLTRAVNGAECKICTLAFTVYHFKT--HHKVNRTVICHNCSKQR 56
            PAICE+CL   +   R+T+A +GA CKICTL FT+++FK   H  + +T+IC NCSKQR
Sbjct: 5   HPAICESCLSRDSKFIRMTKAPDGATCKICTLPFTLFYFKLPGHRHLTKTLICLNCSKQR 64

Query: 57  NICQCCLLDLQWHIPVELRDRVLSLIQGSEVATEEAQNDMMKRFIALKDGSTYKVGGAKV 116
           NICQCCLLDL WH+P  +RD++LS++  S V TEEA N+M+KRFI LKDG ++K+GGA V
Sbjct: 65  NICQCCLLDLSWHVPTNVRDQILSMLNDSAVVTEEASNEMVKRFIGLKDGDSFKMGGASV 124

Query: 117 TSDASATADVIERIRDTLQAVEDKDNSNANVKSAAIAPQSVTEV---------------- 160
           TSD  +   V+ ++++ L A   +  S A     A  P  + +V                
Sbjct: 125 TSDYDSNQQVMLKLQNILNASTSQGTSPA----TAGEPDPLNDVATLVTKDKHDKREKYA 180

Query: 161 --DIXXXXXXXXXXXXXXEGT---AFFLYNIDPALPEWAVVDAISEVVETPSWQEPVSAS 215
             DI              +G    +FFLYNIDP +PEW++V+ IS +VET  WQ+  + S
Sbjct: 181 NLDISHILKRLPLKGSIDKGDSTRSFFLYNIDPGIPEWSIVEKISSMVETTQWQDRETTS 240

Query: 216 VAINHTARCGGIRFKNAELAQKFRDSIETFKAESGLIKGKLLVQNSRVHVVSWPQFHRAA 275
           V INHTA+CGGIRFK+A+LA +F   +E   +     KG L V+N R+HVV W   H  A
Sbjct: 241 VIINHTAKCGGIRFKSADLANRFITQLEKNGS-----KGVLAVRNCRIHVVKWSSMHSGA 295

Query: 276 LGTKNAECRKLALSLDKLVQKDLTASS----------KNTTLTKKQGRVAKKSSAIKEKK 325
            G K AE  KL LSLDKLVQKD++ S+           N   T+  G+V +K   +++KK
Sbjct: 296 FGDKYAEFVKLGLSLDKLVQKDVSPSTTKKENPVTTKSNKKDTRATGKV-QKIGILRDKK 354

Query: 326 RSRRI 330
           + RR+
Sbjct: 355 KKRRV 359

>AGR032W [4342] [Homologous to ScYBR065C (ECM2) - SH]
           complement(770660..771655) [996 bp, 331 aa]
          Length = 331

 Score =  256 bits (655), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 125/298 (41%), Positives = 186/298 (62%), Gaps = 15/298 (5%)

Query: 3   PAICEACLGD-QTRLTRAVNGAECKICTLAFTVYHFKTHH--KVNRTVICHNCSKQRNIC 59
           P+ICE CL D   R+TRA  GAECKICTL FT+YHFK     +V +T++C  C+ QRN+C
Sbjct: 6   PSICEQCLTDADLRMTRAARGAECKICTLPFTLYHFKPPGAPRVTKTLVCRRCAAQRNVC 65

Query: 60  QCCLLDLQWHIPVELRDRVLSLIQGSEVATEEAQNDMMKRFIALKDGSTYKVGGAKVTSD 119
           QCC+LDL W +PV LRD ++SL+QGS+  T EA N+M++RF+AL+ G   ++GGA++T+D
Sbjct: 66  QCCMLDLAWKLPVALRDELVSLVQGSDERTPEASNEMVRRFLALRGG---QLGGARLTAD 122

Query: 120 ASATADVIERIRDTLQAVEDKDNSNANVKSAAIAPQSVTEVDIXXXXXXXXXXXXXXEGT 179
           ++   +++ ++R    A      ++   + A   P+  T++                   
Sbjct: 123 SAPLRELMGKMRAVAAAAAPAARAHGGREDAGEVPE--TQLPFGGALATPASR------- 173

Query: 180 AFFLYNIDPALPEWAVVDAISEVVETPSWQEPVSASVAINHTARCGGIRFKNAELAQKFR 239
           +FF+Y +DPALPEW +VDA+S++V TP W++  S SV +   ARC GIRF+  ELAQ F 
Sbjct: 174 SFFIYGVDPALPEWELVDAVSQLVRTPDWRDAGSVSVVVRQDARCAGIRFRREELAQAFV 233

Query: 240 DSIETFKAESGLIKGKLLVQNSRVHVVSWPQFHRAALGTKNAECRKLALSLDKLVQKD 297
             +ET  A +G  KG L +++ R+HVV+WP+FH AA G    +   +A    K ++ D
Sbjct: 234 ARLETLPAAAGAPKGVLRIRHLRMHVVAWPEFHLAAFGETKQQTEGIARLATKTMRAD 291

>YBR065C (ECM2) [255] chr2 complement(368545..369639) Putative
           pre-mRNA splicing factor, also involved in cell wall
           structure or biosynthesis [1095 bp, 364 aa]
          Length = 364

 Score =  257 bits (657), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 132/321 (41%), Positives = 194/321 (60%), Gaps = 25/321 (7%)

Query: 3   PAICEACLGDQT--RLTRAVNGAECKICTLAFTVYHFKTHHKVN---RTVICHNCSKQRN 57
           P ICE CLGD+   R+T+   G+ECKICTL FT+YHFKT  + N   +T+IC  C+ QRN
Sbjct: 10  PNICEQCLGDEANIRMTKIPQGSECKICTLPFTLYHFKTSKRSNNIIKTLICVRCATQRN 69

Query: 58  ICQCCLLDLQWHIPVELRDRVLSLIQGSEVATEEAQNDMMKRFIALKDGSTYKVGGAKVT 117
           ICQCC+LD +WHIP++LRD ++SL+    V TEEA+NDMMKRF++LK+    K+GGA++T
Sbjct: 70  ICQCCMLDSRWHIPIQLRDHLISLVNEENVMTEEAKNDMMKRFLSLKN---VKLGGAQIT 126

Query: 118 SDASATADVIERIRDT-LQAVED--------------KDNSNANVKSAAIAPQSVTEVDI 162
           SD S   ++++++++  L+A  D              K+   AN         SV    I
Sbjct: 127 SDPSEADNIVDKLKNILLRATSDGPSTPLIKNTTALYKNEKGANEVKNLEKYASVDISHI 186

Query: 163 XXXXXXXXXXXXXXEGTAFFLYNIDPALPEWAVVDAISEVVETPSWQEPVSASVAINHTA 222
                            +FFLYNID ++PEW + D +S+++    W++  S S+ +NH A
Sbjct: 187 LKKLPLNESFLKNPSTKSFFLYNIDASIPEWKITDTVSQLLGIKKWKDGNSLSLIVNHKA 246

Query: 223 RCGGIRFKNAELAQKFRDSI-ETFKAESGLIKGKLLVQNSRVHVVSWPQ-FHRAALGTKN 280
           +CGG+RF+++EL ++F   I ET     GL +G LL+   R+ ++ W   F  A+ GT  
Sbjct: 247 KCGGLRFQSSELGERFVSKISETLVTPKGLKRGVLLIDRFRIFIIPWSSGFSAASFGTNT 306

Query: 281 AECRKLALSLDKLVQKDLTAS 301
           AE  KL+LSL+KL+Q +L  S
Sbjct: 307 AENIKLSLSLNKLIQLELGLS 327

>Scas_718.45
          Length = 376

 Score =  248 bits (633), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 137/341 (40%), Positives = 202/341 (59%), Gaps = 32/341 (9%)

Query: 3   PAICEACLGD--QTRLTRAVNGAECKICTLAFTVYHFKTHHK---VNRTVICHNCSKQRN 57
           P+IC+ CLGD    RLT+  NGA+CKICT+ FT YHFK   +   + +T+IC  C+ QRN
Sbjct: 11  PSICDVCLGDSPNIRLTKLPNGAQCKICTMTFTSYHFKQQERSSNLTKTLICLRCATQRN 70

Query: 58  ICQCCLLDLQWHIPVELRDRVLSLI-QGSEVATEEAQNDMMKRFIALKDGSTYKVGGAKV 116
           +CQCC+LD+ WHIPV+LRD ++SL+ Q   + T+EA+ND+MKRF+ALKDG   K+GGA+V
Sbjct: 71  VCQCCMLDMTWHIPVQLRDSIVSLVNQDKSMITKEAKNDIMKRFLALKDG---KLGGAQV 127

Query: 117 TSDASATADVIERIRDTLQAVEDKDN---------SNANVKSAAIAPQSVTEVDIXXXXX 167
           TSD+  T +++++++D L     K+N         S  +  S  +    +  +DI     
Sbjct: 128 TSDSKQTDELMQKLKDILLQNNSKENIHKKTEAISSGDSSNSTRLDNSKLKGIDISHIIR 187

Query: 168 XXXXXXXXXEGTA----FFLYNIDPALPEWAVVDAISEVVETPSWQEPVSASVAINHTAR 223
                    + TA    FFLYNIDP++PEW V D IS +V T  W++P S S+ I H A+
Sbjct: 188 KLPLRESFLDTTASVKSFFLYNIDPSIPEWKVSDQISNIVGTKDWKDPTSLSLIIIHKAK 247

Query: 224 CGGIRFKNAELAQKFRDSI----ETFKAESGLI-KGKLLVQNSRVHVVSWPQFHRAALGT 278
           CGG+RFK+ EL  KF  ++       K+  G + +G L + + ++  + W      +   
Sbjct: 248 CGGVRFKSEELGSKFVKNMLASGSFMKSNDGKVQRGILKIDHFQIFAIPWRSGFSGSSFG 307

Query: 279 KNA-ECRKLALSLDKLVQKDLTASSKNTTLTKKQGRVAKKS 318
            N  E  KL+LS++KL+Q +  AS    T ++ Q   AKKS
Sbjct: 308 GNVNENIKLSLSMNKLIQLENGAS----TESELQSEPAKKS 344

>CAGL0L07458g complement(820608..821702) similar to sp|P38241
           Saccharomyces cerevisiae YBR065c ECM2, start by
           similarity
          Length = 364

 Score =  213 bits (542), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 114/328 (34%), Positives = 184/328 (56%), Gaps = 39/328 (11%)

Query: 3   PAICEACLG-----DQTRLTRAVNGAECKICTLAFTVYHFKTHHK---VNRTVICHNCSK 54
           P ICE CLG     +  R+    NGA CKICTL +T+YHFK  H+   + +T+IC  C+ 
Sbjct: 12  PQICEKCLGTSNTNENIRMNEVPNGAACKICTLPYTLYHFKKSHRSADIIKTLICKKCAI 71

Query: 55  QRNICQCCLLDLQWHIPVELRDRVLSLIQGSEVATEEAQNDMMKRFIALKDGSTYKVGGA 114
           QRN+CQCC+LD++ HI ++LRD+++S++ G E  TEEA+N MMK+FIA+K GS   +G A
Sbjct: 72  QRNVCQCCMLDMKLHISIQLRDKLMSIVSGKETITEEAKNIMMKKFIAMKGGS---LGSA 128

Query: 115 KVTSDASATADVIERIRDTLQ------------AVEDKD-NSNANVKSAAIAPQSVTEVD 161
            +T +  +  D++  +R+ L+            A+++K+   N ++KS  I P      D
Sbjct: 129 DLTRNVDSIEDILLNLREKLEGKPLNDENEPISALQNKELGDNPHLKSVDIQPY----WD 184

Query: 162 IXXXXXXXXXXXXXXEGT----AFFLYNIDPALPEWAVVDAISEVVETPSWQEPVSASVA 217
                          +G     +FF+YNID ++PEW + D I+E++ + SW+   S  + 
Sbjct: 185 KFPLQETFPNAIQIPKGNDSFKSFFIYNIDSSVPEWKISDKITELLGSDSWKTKESIPII 244

Query: 218 INHTARCGGIRFKNAELAQKFRDSIET------FKAESGLIKGKLLVQNSRVHVVSWPQ- 270
           INH A CG  R  N EL++KF  +I            +GL +G L V + ++ ++ W Q 
Sbjct: 245 INHKAMCGAFRIGNNELSEKFLQTINNSDNMIRINRSNGLRRGILKVDHFQLFIIPWKQG 304

Query: 271 FHRAALGTKNAECRKLALSLDKLVQKDL 298
           F   + G    E +K+A +L +++ +++
Sbjct: 305 FSVESFGRTPNESKKIAFALREIIVEEM 332

>KLLA0F18502g complement(1699447..1700355) some similarities with
           sp|P38241 Saccharomyces cerevisiae YBR065c ECM2 involved
           in cell wall biogenesis and architecture singleton,
           hypothetical start
          Length = 302

 Score =  100 bits (250), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 120/271 (44%), Gaps = 46/271 (16%)

Query: 2   EPAICEACL--GDQT-RLTRAVNGAECKICTLAFTVYHFKTHHKVNRTVICHNCSKQRNI 58
           E  ICE CL  G+ T  L R  NG ECK CT  F  Y +  +H    T+ C  C+ +  I
Sbjct: 7   ELKICERCLPLGENTPTLIRYPNGRECKFCTFPFDSYSYTINHTTFHTICCPKCATKNLI 66

Query: 59  CQCCLLDLQWHIPVELRDRVLSLIQGSEVATEEAQNDMMKRFIALKDGSTYKVGGAKVTS 118
           CQ CL D +  IP+ LR+ +  L+      +   +NDMMKRFI L   S+ +V  A +  
Sbjct: 67  CQVCLNDFEHGIPMHLRNSMKQLL-NENADSVIPKNDMMKRFIGL---SSKQV--APLNI 120

Query: 119 DASATADVIERIRDTLQAVEDKDNSNANVKSAAIAPQSVTEVDIXXXXXXXXXXXXXXEG 178
           D    A+ I + R      E   NSN N                                
Sbjct: 121 DKLKQAESIRKWR----VRELPFNSNVN-----------------------------DTK 147

Query: 179 TAFFLYNIDPALPEWAVVDAISEVVETPSWQEPVSASVAINHTARCGGIRFK-NAEL-AQ 236
             FFLYNIDP L E  +V  +  +V T +  E  + S+ +N   R   + FK + +L  Q
Sbjct: 148 DTFFLYNIDPNLTESQIVSQL--IVATNNNLERENTSLKLNSKLRIATLTFKQDPDLWTQ 205

Query: 237 KFRDSIETFKAESGLIKGKLLVQNSRVHVVS 267
           K    +  FK    + K  LL++ +R+H+ S
Sbjct: 206 KLISILPKFKVGPTVEKCYLLMKGNRIHITS 236

>Scas_704.16*
          Length = 983

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 30/47 (63%), Gaps = 6/47 (12%)

Query: 57  NICQCCLLDLQWHIPVELRDR--VLSLIQGSEVATEEAQNDMMKRFI 101
           N+C   LL L++ I +ELRDR  +L++++     TE+ QN  M+R +
Sbjct: 793 NVCFVDLLQLEYEIALELRDRDKILTILE----KTEQYQNGEMERLL 835

>YAL013W (DEP1) [55] chr1 (129273..130535) Regulator of phospholipid
           metabolism [1263 bp, 420 aa]
          Length = 420

 Score = 30.0 bits (66), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 43  VNRTV-ICHNCSKQRNICQCCLLDLQWHIPVELRDRVLSLIQG 84
           +NRT    ++ +K+R      + D+ +H+P++L ++ LS I G
Sbjct: 279 LNRTTQTWYDINKERRDMDIVIPDVNYHVPIKLDNKTLSCITG 321

>CAGL0H06347g 625360..627138 similar to sp|P31385 Saccharomyces
           cerevisiae YAL013w DEP1, hypothetical start
          Length = 592

 Score = 29.6 bits (65), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 35/76 (46%), Gaps = 5/76 (6%)

Query: 9   CLGDQTRLTRAVNGAECKICTLAFTVYHFKTHHKVNRTVICHNCSKQRNICQCCLLDLQW 68
           C+  +TR TR +       C     V   ++    + T   ++ +K+R      + D+ +
Sbjct: 437 CIDIETRATRTMIHQNFLRC-----VNELRSQLLQDTTTKWYDINKERRDMDIIIPDINY 491

Query: 69  HIPVELRDRVLSLIQG 84
           H+PV+  ++ LS I G
Sbjct: 492 HVPVKTANKTLSCITG 507

>Scas_482.2
          Length = 423

 Score = 28.5 bits (62), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 26/52 (50%)

Query: 60  QCCLLDLQWHIPVELRDRVLSLIQGSEVATEEAQNDMMKRFIALKDGSTYKV 111
           +C L DL+     +L D  + + + +   T+  Q  +   FI L+DGS Y V
Sbjct: 217 KCFLTDLERFEKEKLADEDIQVEEFNYYVTKSYQPRIYNDFITLRDGSNYMV 268

>Scas_579.14d
          Length = 221

 Score = 28.1 bits (61), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query: 183 LYNIDPALPEWAVVDAISEVVETPSWQEPVS 213
           +Y++ PALP    ++ I EVVET   Q P +
Sbjct: 45  VYSLKPALPAGVTINNIQEVVETVVKQTPTA 75

>Scas_650.22
          Length = 993

 Score = 28.5 bits (62), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 44/87 (50%), Gaps = 8/87 (9%)

Query: 75  RDRVLSLIQGSEVATEEAQNDMMKRF-IALKDGSTYKVGGAKVTSDASATADVIERIRDT 133
           R++   L+Q S  A +EA  D ++R  ++  +  +Y    A  TS   + +D+ +  +D 
Sbjct: 441 REKTSPLLQSSSFARQEADTDDLQRSPVSFTNRDSYL---ATTTSSPGSISDLYDHYQDN 497

Query: 134 LQAVEDKDNSN----ANVKSAAIAPQS 156
            ++ +  DN N     ++  A+I+ +S
Sbjct: 498 AESKQGNDNDNEARQGDLSHASISQES 524

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.129    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,022,258
Number of extensions: 325254
Number of successful extensions: 1232
Number of sequences better than 10.0: 19
Number of HSP's gapped: 1222
Number of HSP's successfully gapped: 20
Length of query: 331
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 229
Effective length of database: 13,065,073
Effective search space: 2991901717
Effective search space used: 2991901717
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)