Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_27.105461041045482e-74
YBR062C1151103592e-45
AGR034W1591013535e-44
CAGL0H10274g1141103496e-44
Scas_560.6*1181023322e-41
KLLA0F18458g140973203e-39
Scas_625.11274721561e-13
Kwal_56.22522513941086e-07
Scas_644.6510801024e-06
YOL013C (HRD1)55137963e-05
ACL019C57578953e-05
ABL058C154678954e-05
KLLA0C14344g151873937e-05
KLLA0E17787g16262891e-04
Kwal_27.12327157454901e-04
KLLA0C05874g55372902e-04
Kwal_56.2311213582872e-04
Sklu_1684.114461863e-04
CAGL0E02299g54536866e-04
Kwal_56.2390058933857e-04
KLLA0E03960g70434830.001
Scas_696.17156458830.001
Scas_713.4557047810.003
Sklu_2317.249344800.004
YMR247C156278790.005
YDL008W (APC11)16565770.006
ABR104W32855780.007
YDR143C (SAN1)61032780.008
CAGL0B05049g147025780.008
CAGL0L01947g75759770.009
Sklu_2432.9147534750.018
KLLA0F25674g75724750.019
KLLA0F12166g152868740.023
Kwal_26.809975024740.024
YLR247C155665740.026
YKL034W (TUL1)75824740.026
Scas_615.1333052730.032
Kwal_14.1287151824730.033
Sklu_2102.175124730.034
YDR265W (PEX10)33784720.038
AER390W31650710.051
KLLA0E07139g11034690.055
Scas_573.9150224710.057
AAL030C153970710.059
Scas_625.476190710.060
Scas_665.139267710.064
CAGL0E01441g71732710.071
CAGL0H02651g154454710.072
CAGL0M08690g32824700.089
Kwal_55.2205411128670.096
CAGL0I04576g14960680.098
Sklu_2416.811028670.10
AFR275W75324680.15
AER016C14743670.17
ADL181W10828650.18
Scas_718.7712844650.22
Scas_585.5*10928640.31
Scas_705.4142858640.45
YOL133W (HRT1)12122630.50
KLLA0B08679g36378640.51
YBL079W (NUP170)150240621.1
AGL217W41469611.1
Sklu_1785.333138601.5
YHL010C58546601.6
KLLA0C15697g30448601.8
Sklu_2337.232264592.0
KLLA0E16720g30549592.0
YPR181C (SEC23)76831602.0
YPR093C28826592.1
KLLA0F07469g99242592.4
CAGL0I09988g38757592.4
Sklu_1676.310130572.6
AAR049C44326565.2
Kwal_55.2120627548566.0
Kwal_55.1999915234556.1
Scas_720.8946930566.6
YHR192W27820556.9
KLLA0C08756g42730557.0
Scas_699.51101242557.6
CAGL0G01848g15643549.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10546
         (104 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10546                                                         215   2e-74
YBR062C (YBR062C) [253] chr2 complement(365936..366283) Protein ...   142   2e-45
AGR034W [4344] [Homologous to ScYBR062C - SH] complement(772772....   140   5e-44
CAGL0H10274g complement(1003801..1004145) similar to sp|P38239 S...   139   6e-44
Scas_560.6*                                                           132   2e-41
KLLA0F18458g complement(1697871..1698293) some similarities with...   127   3e-39
Scas_625.11                                                            65   1e-13
Kwal_56.22522                                                          46   6e-07
Scas_644.6                                                             44   4e-06
YOL013C (HRD1) [4803] chr15 complement(301380..303035) E3 ubiqui...    42   3e-05
ACL019C [1030] [Homologous to ScYOL013C (HRD1) - SH] (328044..32...    41   3e-05
ABL058C [534] [Homologous to ScYMR247C - SH] (288355..292995) [4...    41   4e-05
KLLA0C14344g 1245226..1249782 similar to sp|Q04781 Saccharomyces...    40   7e-05
KLLA0E17787g complement(1571018..1571506) similar to sgd|S000216...    39   1e-04
Kwal_27.12327                                                          39   1e-04
KLLA0C05874g complement(520079..521740) weakly similar to sgd|S0...    39   2e-04
Kwal_56.23112                                                          38   2e-04
Sklu_1684.1 YDL008W, Contig c1684 226-660                              38   3e-04
CAGL0E02299g complement(219009..220646) similar to tr|Q08109 Sac...    38   6e-04
Kwal_56.23900                                                          37   7e-04
KLLA0E03960g 369201..371315 some similarities with sp|P22470 Sac...    37   0.001
Scas_696.17                                                            37   0.001
Scas_713.45                                                            36   0.003
Sklu_2317.2 YDR143C, Contig c2317 4002-5483                            35   0.004
YMR247C (YMR247C) [4203] chr13 complement(763350..768038) Protei...    35   0.005
YDL008W (APC11) [849] chr4 (433494..433991) Component of the ana...    34   0.006
ABR104W [696] [Homologous to ScYPR093C - SH] complement(574067.....    35   0.007
YDR143C (SAN1) [988] chr4 complement(742036..743868) Protein tha...    35   0.008
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    35   0.008
CAGL0L01947g 225999..228272 similar to sp|P36096 Saccharomyces c...    34   0.009
Sklu_2432.9 , Contig c2432 20306-24733 reverse complement              33   0.018
KLLA0F25674g 2384293..2386566 similar to sp|P36096 Saccharomyces...    33   0.019
KLLA0F12166g complement(1116715..1121301) weakly similar to sgd|...    33   0.023
Kwal_26.8099                                                           33   0.024
YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protei...    33   0.026
YKL034W (TUL1) [3222] chr11 (371472..373748) Protein containing ...    33   0.026
Scas_615.13                                                            33   0.032
Kwal_14.1287                                                           33   0.033
Sklu_2102.1 YKL034W, Contig c2102 417-2672 reverse complement          33   0.034
YDR265W (PEX10) [1098] chr4 (998856..999869) Peroxisomal biogene...    32   0.038
AER390W [2890] [Homologous to ScYDR265W (PEX10) - SH] complement...    32   0.051
KLLA0E07139g 651474..651806 similar to sgd|S0005493 Saccharomyce...    31   0.055
Scas_573.9                                                             32   0.057
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    32   0.059
Scas_625.4                                                             32   0.060
Scas_665.1                                                             32   0.064
CAGL0E01441g 135075..137228 weakly similar to sp|P22470 Saccharo...    32   0.071
CAGL0H02651g 238495..243129 similar to sp|Q04781 Saccharomyces c...    32   0.072
CAGL0M08690g complement(865182..866168) similar to sp|Q05568 Sac...    32   0.089
Kwal_55.22054                                                          30   0.096
CAGL0I04576g 408872..409321 similar to tr|Q12157 Saccharomyces c...    31   0.098
Sklu_2416.8 YOL133W, Contig c2416 15124-15456                          30   0.10 
AFR275W [3467] [Homologous to ScYKL034W (TUL1) - NSH] complement...    31   0.15 
AER016C [2521] [Homologous to ScYDL008W (APC11) - SH] (659572..6...    30   0.17 
ADL181W [1560] [Homologous to ScYOL133W (HRT1) - SH] complement(...    30   0.18 
Scas_718.77                                                            30   0.22 
Scas_585.5*                                                            29   0.31 
Scas_705.41                                                            29   0.45 
YOL133W (HRT1) [4690] chr15 (70324..70689) Activator of the Cdc5...    29   0.50 
KLLA0B08679g 767808..768899 weakly similar to sgd|S0005415 Sacch...    29   0.51 
YBL079W (NUP170) [121] chr2 (75256..79764) Nuclear pore protein ...    28   1.1  
AGL217W [4095] [Homologous to ScYOL054W - SH] complement(290043....    28   1.1  
Sklu_1785.3 YOL054W, Contig c1785 2663-3658 reverse complement         28   1.5  
YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein t...    28   1.6  
KLLA0C15697g 1360289..1361203 weakly similar to sgd|S0006297 Sac...    28   1.8  
Sklu_2337.2 YPR093C, Contig c2337 3730-4698 reverse complement         27   2.0  
KLLA0E16720g complement(1481372..1482289) similar to sp|Q05568 S...    27   2.0  
YPR181C (SEC23) [5595] chr16 complement(897355..899661) Componen...    28   2.0  
YPR093C (YPR093C) [5516] chr16 complement(719554..720420) Protei...    27   2.1  
KLLA0F07469g 703955..706933 similar to sp|Q02792 Saccharomyces c...    27   2.4  
CAGL0I09988g complement(951368..952531) similar to tr|Q12161 Sac...    27   2.4  
Sklu_1676.3 YDR265W, Contig c1676 2766-3071 reverse complement         27   2.6  
AAR049C [235] [Homologous to ScYCR066W (RAD18) - SH] (428904..43...    26   5.2  
Kwal_55.21206                                                          26   6.0  
Kwal_55.19999                                                          26   6.1  
Scas_720.89                                                            26   6.6  
YHR192W (YHR192W) [2477] chr8 (486824..487660) Protein of unknow...    26   6.9  
KLLA0C08756g complement(765847..767130) weakly similar to sp|P10...    26   7.0  
Scas_699.51                                                            26   7.6  
CAGL0G01848g complement(168200..168670) weakly similar to tr|Q06...    25   9.2  

>Kwal_27.10546
          Length = 104

 Score =  215 bits (548), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%)

Query: 1   MQEELLQEKQEGCPDTYIDSLPRVEKGKLKDAEACSICCCNYRDDKYPLVVELPHCNHRF 60
           MQEELLQEKQEGCPDTYIDSLPRVEKGKLKDAEACSICCCNYRDDKYPLVVELPHCNHRF
Sbjct: 1   MQEELLQEKQEGCPDTYIDSLPRVEKGKLKDAEACSICCCNYRDDKYPLVVELPHCNHRF 60

Query: 61  DLECVAVWLSKSRTCPLCRDDVLSHKPNVDVSQVEMEDDWGMYG 104
           DLECVAVWLSKSRTCPLCRDDVLSHKPNVDVSQVEMEDDWGMYG
Sbjct: 61  DLECVAVWLSKSRTCPLCRDDVLSHKPNVDVSQVEMEDDWGMYG 104

>YBR062C (YBR062C) [253] chr2 complement(365936..366283) Protein
           containing a C3HC4 type (RING) zinc finger, which may
           mediate protein-protein interactions, has moderate
           similarity to uncharacterized C. albicans Orf6.8878p
           [348 bp, 115 aa]
          Length = 115

 Score =  142 bits (359), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 85/110 (77%), Gaps = 6/110 (5%)

Query: 1   MQEELLQE----KQEGCPDTYIDSLPRVEKGKLKDAEACSICCCNYRDDKYPLVVELPHC 56
           +QEE LQE    K  GCPDT+  SLPR+ K KLK  + CSIC  NY +D+YPLVVELPHC
Sbjct: 6   LQEEWLQEMDKGKSAGCPDTFAASLPRINKKKLKATDNCSICYTNYLEDEYPLVVELPHC 65

Query: 57  NHRFDLECVAVWLSKSRTCPLCRDDVLSHK--PNVDVSQVEMEDDWGMYG 104
           +H+FDLEC++VWLS+S TCPLCRD+V+ H+    +D ++ E+E+DWGMYG
Sbjct: 66  HHKFDLECLSVWLSRSTTCPLCRDNVMGHRIINEIDTTEAELEEDWGMYG 115

>AGR034W [4344] [Homologous to ScYBR062C - SH]
           complement(772772..773251) [480 bp, 159 aa]
          Length = 159

 Score =  140 bits (353), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 78/101 (77%)

Query: 4   ELLQEKQEGCPDTYIDSLPRVEKGKLKDAEACSICCCNYRDDKYPLVVELPHCNHRFDLE 63
           +L+ E   G PD Y+D+LPRV K +L + + C+ICCC Y +D+YPLVVELP+C H FDL+
Sbjct: 59  QLIGEGDGGVPDGYMDTLPRVPKKRLAEGDNCAICCCGYLEDEYPLVVELPNCGHTFDLQ 118

Query: 64  CVAVWLSKSRTCPLCRDDVLSHKPNVDVSQVEMEDDWGMYG 104
           CV+VWLS+S TCP+CR DVL  KP +D S  E+E+DWGMYG
Sbjct: 119 CVSVWLSRSTTCPMCRSDVLVRKPEIDGSAAELEEDWGMYG 159

>CAGL0H10274g complement(1003801..1004145) similar to sp|P38239
           Saccharomyces cerevisiae YBR062c, hypothetical start
          Length = 114

 Score =  139 bits (349), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 84/110 (76%), Gaps = 6/110 (5%)

Query: 1   MQEELLQE----KQEGCPDTYIDSLPRVEKGKLKDAEACSICCCNYRDDKYPLVVELPHC 56
           +QE+L+Q      ++GC DT+IDSLPR+ + KLK  + C ICC N+  D+YPLVVELPHC
Sbjct: 5   LQEQLMQSMDSASKQGCSDTFIDSLPRIPQKKLKSDDTCPICCSNFIADEYPLVVELPHC 64

Query: 57  NHRFDLECVAVWLSKSRTCPLCRDDVLSHK--PNVDVSQVEMEDDWGMYG 104
            H+FD ECV++WL+K+ TCP+CRDDV   K  P +D S+VE+E+DWGMYG
Sbjct: 65  GHKFDFECVSMWLTKNTTCPMCRDDVTHKKELPELDTSKVELEEDWGMYG 114

>Scas_560.6*
          Length = 118

 Score =  132 bits (332), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 62/102 (60%), Positives = 80/102 (78%), Gaps = 2/102 (1%)

Query: 3   EELLQEKQEGCPDTYIDSLPRVEKGKLKDAEACSICCCNYRDDKYPLVVELPHCNHRFDL 62
           E++ ++ ++ C + +I SLPRV K K K+ E C ICCC + +DKYPL+VELP CNHRFDL
Sbjct: 19  EQMDEKNKKHCSEEFIASLPRV-KSKHKNDE-CPICCCKFSEDKYPLIVELPRCNHRFDL 76

Query: 63  ECVAVWLSKSRTCPLCRDDVLSHKPNVDVSQVEMEDDWGMYG 104
           EC++VWLSKS TCPLCRD+VL HK N+D S+ E E+ WGMYG
Sbjct: 77  ECISVWLSKSVTCPLCRDNVLEHKLNIDTSKTEFEEGWGMYG 118

>KLLA0F18458g complement(1697871..1698293) some similarities with
           sp|P38239 Saccharomyces cerevisiae YBR062c singleton,
           hypothetical start
          Length = 140

 Score =  127 bits (320), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 54/97 (55%), Positives = 74/97 (76%)

Query: 8   EKQEGCPDTYIDSLPRVEKGKLKDAEACSICCCNYRDDKYPLVVELPHCNHRFDLECVAV 67
           ++Q+G  +TYIDSLPRV   KLK  + C+IC CN+ DD YPLV ++P CNH+FDLEC+++
Sbjct: 44  DQQKGMSETYIDSLPRVPNSKLKAEDTCAICQCNFLDDPYPLVAKVPRCNHKFDLECLSI 103

Query: 68  WLSKSRTCPLCRDDVLSHKPNVDVSQVEMEDDWGMYG 104
           WL  + TCP+CRDD+ S K  +D SQ E+E+D+ MYG
Sbjct: 104 WLQNNHTCPMCRDDLRSKKVEIDTSQCELEEDFNMYG 140

>Scas_625.11
          Length = 274

 Score = 64.7 bits (156), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 1/72 (1%)

Query: 13  CPDTYIDSLPRVEKGKLKDA-EACSICCCNYRDDKYPLVVELPHCNHRFDLECVAVWLSK 71
           C + +I+ LPR    +L ++ + C IC   Y DD    +  LP+C+H F  EC+ +WL K
Sbjct: 187 CTNEFIEQLPRTNCAELSNSSDECPICRIAYSDDFETEITCLPNCSHHFHFECIKLWLQK 246

Query: 72  SRTCPLCRDDVL 83
           +  CPLCRD+V+
Sbjct: 247 NSLCPLCRDNVM 258

>Kwal_56.22522
          Length = 513

 Score = 46.2 bits (108), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 29/94 (30%), Positives = 43/94 (45%), Gaps = 16/94 (17%)

Query: 19  DSLPRVEKGKL--KDAEACSIC---------CCNYRDDKYPLVVELPHCNHRFDLECVAV 67
           + LP V + +L   D + C +C         C N +         LP CNH   L C+  
Sbjct: 298 EKLPDVSEAQLAASDDKMCIVCMDDMLAPSECTNAKQKPK----RLP-CNHCLHLGCLKS 352

Query: 68  WLSKSRTCPLCRDDVLSHKPNVDVSQVEMEDDWG 101
           W+ +S+TCP+CR  V   K NV V+  +  +  G
Sbjct: 353 WMERSQTCPICRVPVFDKKGNVVVTSDQTNNQPG 386

>Scas_644.6
          Length = 510

 Score = 43.9 bits (102), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 5/80 (6%)

Query: 18  IDS-LPRVEKGKLKDAEACSICCCN---YRDDKYPLVVELPHCNHRFDLECVAVWLSKSR 73
           +DS LP +    L+D++   I C +     + K      LP C H   L C+  W+ +S+
Sbjct: 334 LDSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERSQ 392

Query: 74  TCPLCRDDVLSHKPNVDVSQ 93
           TCP+CR  V     NV  S+
Sbjct: 393 TCPICRLPVFDESGNVKESE 412

>YOL013C (HRD1) [4803] chr15 complement(301380..303035) E3 ubiquitin
           ligase required for endoplasmic reticulum-associated
           degradation of misfolded luminal and integral membrane
           proteins [1656 bp, 551 aa]
          Length = 551

 Score = 41.6 bits (96), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 53  LPHCNHRFDLECVAVWLSKSRTCPLCRDDVLSHKPNV 89
           LP C H   L C+  W+ +S+TCP+CR  V   K NV
Sbjct: 375 LP-CGHILHLSCLKNWMERSQTCPICRLPVFDEKGNV 410

>ACL019C [1030] [Homologous to ScYOL013C (HRD1) - SH]
           (328044..329771) [1728 bp, 575 aa]
          Length = 575

 Score = 41.2 bits (95), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 11/78 (14%)

Query: 19  DSLPRVEKGKLKDAEACSICCCNYRDDKYPLV--------VELPHCNHRFDLECVAVWLS 70
           + L  V + +L D ++  I C    DD  P           ++  C H     C+  W+ 
Sbjct: 303 EKLSDVSEEQLDDTDSMCIIC---MDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWME 359

Query: 71  KSRTCPLCRDDVLSHKPN 88
           +S+TCP+CR  V ++  N
Sbjct: 360 RSQTCPICRLSVFANDSN 377

>ABL058C [534] [Homologous to ScYMR247C - SH] (288355..292995) [4641
            bp, 1546 aa]
          Length = 1546

 Score = 41.2 bits (95), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 37/78 (47%), Gaps = 8/78 (10%)

Query: 12   GCPDTYIDSLPRVEKG---KLKDAEACSIC--CCNYRDDKYPLVVELPHCNHRFDLECVA 66
            G   + +DSL    K    +  D E C+IC    +  D K P  V  P C++RF   C+ 
Sbjct: 1466 GMNGSVVDSLELFTKNVRLQFADFEECAICYSILHVVDRKLPSKV-CPTCSNRFHGACLY 1524

Query: 67   VWLSKS--RTCPLCRDDV 82
             W   S   TCPLCR ++
Sbjct: 1525 KWFKSSGNNTCPLCRGEI 1542

>KLLA0C14344g 1245226..1249782 similar to sp|Q04781 Saccharomyces
            cerevisiae YMR247c singleton, start by similarity
          Length = 1518

 Score = 40.4 bits (93), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 35/73 (47%), Gaps = 8/73 (10%)

Query: 16   TYIDSLPRVEKG---KLKDAEACSIC--CCNYRDDKYPLVVELPHCNHRFDLECVAVWLS 70
            + +DSL  + K    +    E C+IC    +  D K P  V  P CN+RF   C+  W  
Sbjct: 1442 SVVDSLELLSKNVKLQFSGFEECAICYYVLHAIDRKLPTKV-CPTCNNRFHGACLYKWFK 1500

Query: 71   KS--RTCPLCRDD 81
             S   TCPLCR +
Sbjct: 1501 SSGNNTCPLCRGE 1513

>KLLA0E17787g complement(1571018..1571506) similar to sgd|S0002166
           Saccharomyces cerevisiae YDL008w APC11 subunit of the
           anaphase promoting complex, start by similarity
          Length = 162

 Score = 38.9 bits (89), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 6/62 (9%)

Query: 40  CNYRDDKYPLVVELPHCNHRFDLECVAVWLSKSRT---CPLCRDDVLSHKPNVDVSQVEM 96
           C+Y     P+V+ L  CNH F + C+  WLS   +   CPLCR      +PNV ++++  
Sbjct: 73  CDYPGSGCPIVLGL--CNHNFHVHCIKQWLSTETSKGLCPLCRQG-FQLRPNVLINKMHH 129

Query: 97  ED 98
           ++
Sbjct: 130 DE 131

>Kwal_27.12327
          Length = 1574

 Score = 39.3 bits (90), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 33   EACSIC--CCNYRDDKYPLVVELPHCNHRFDLECVAVWL--SKSRTCPLCRDDV 82
            E C+IC    +  D K P  V  P CN+RF   C+  W   S + TCPLCR ++
Sbjct: 1518 EECAICYSILHAVDRKLPSKV-CPTCNNRFHGACLYKWFRSSGNNTCPLCRSEI 1570

>KLLA0C05874g complement(520079..521740) weakly similar to
           sgd|S0005373 Saccharomyces cerevisiae YOL013c HRD1
           involved in degradation of HMG2P, start by similarity
          Length = 553

 Score = 39.3 bits (90), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 9/72 (12%)

Query: 23  RVEKGKLKDAEACSICCCNY-----RDDKYPLVVELPHCNHRFDLECVAVWLSKSRTCPL 77
           ++E G++   + C +C  ++     R      V  LP C H   L C+  W+++S TCP+
Sbjct: 344 QIESGEI---DICIVCMEDFLPSHQRKSDGKKVKILP-CTHALHLSCLKNWIARSPTCPI 399

Query: 78  CRDDVLSHKPNV 89
           CR  +     NV
Sbjct: 400 CRLPIFDENGNV 411

>Kwal_56.23112
          Length = 135

 Score = 38.1 bits (87), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 38/82 (46%), Gaps = 15/82 (18%)

Query: 28  KLKDAEACSIC---------CCNYRDDKYPLVVELPHCNHRFDLECVAVWLSKSRT---C 75
           ++ D + C IC          C +  D  PLV+    CNH F + C+  WL  +     C
Sbjct: 27  EIGDEDLCGICRVSYNGTCPGCRFPGDNCPLVIG--ECNHNFHVHCIQQWLETATAKGLC 84

Query: 76  PLCRDDVLSHKPNVDVSQVEME 97
           P+CR    S K  V +++ +M+
Sbjct: 85  PMCRQQ-FSLKRGVAINECQMD 105

>Sklu_1684.1 YDL008W, Contig c1684 226-660
          Length = 144

 Score = 37.7 bits (86), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 6/61 (9%)

Query: 40  CNYRDDKYPLVVELPHCNHRFDLECVAVWLSKSRT---CPLCRDDVLSHKPNVDVSQVEM 96
           C Y  D+ PLVV    CNH F + C+  WL  + +   CP+CR  + S K  V ++  ++
Sbjct: 50  CKYPGDECPLVV--GECNHNFHVHCIVQWLDTATSRGLCPMCR-QLFSLKRGVAINDSQL 106

Query: 97  E 97
           +
Sbjct: 107 D 107

>CAGL0E02299g complement(219009..220646) similar to tr|Q08109
           Saccharomyces cerevisiae YOL013c HRD1, start by
           similarity
          Length = 545

 Score = 37.7 bits (86), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 3/36 (8%)

Query: 44  DDKYPLVVELPHCNHRFDLECVAVWLSKSRTCPLCR 79
           D K P   +LP C H   L C+  W+ +S+TCP+CR
Sbjct: 368 DGKKP--KKLP-CGHVLHLSCLKNWMERSQTCPICR 400

>Kwal_56.23900
          Length = 589

 Score = 37.4 bits (85), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 14/33 (42%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 51  VELPHCNHRFDLECVAVWLSKSRTCPLCRDDVL 83
           V+LP C+H F  EC+  W +   TCP+CR +++
Sbjct: 223 VQLP-CSHVFGRECIRQWTNLHNTCPICRANIV 254

>KLLA0E03960g 369201..371315 some similarities with sp|P22470
           Saccharomyces cerevisiae YDR143c SAN1 mating-type
           regulation protein singleton, hypothetical start
          Length = 704

 Score = 36.6 bits (83), Expect = 0.001,   Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 53  LPHCNHRFDLECVAVWLSKSRTCPLCRDDVLSHK 86
           LP C H F  EC+  W ++  +CP+CR  +LS +
Sbjct: 217 LP-CGHVFGRECLYKWTTEHNSCPICRAPILSEE 249

>Scas_696.17
          Length = 1564

 Score = 36.6 bits (83), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 5/58 (8%)

Query: 33   EACSIC--CCNYRDDKYPLVVELPHCNHRFDLECVAVWL--SKSRTCPLCRDDVLSHK 86
            E C+IC    +  D K P     P C ++F   C+  W   S + TCPLCR ++  H+
Sbjct: 1508 EECAICYSILHAVDRKLP-TKTCPTCKNKFHGACLYKWFRSSGNNTCPLCRSEIPLHR 1564

>Scas_713.45
          Length = 570

 Score = 35.8 bits (81), Expect = 0.003,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 5/47 (10%)

Query: 52  ELPHCNHRFDLECVAVWLSKSRTCPLCRDDVLSHKPNVDVSQVEMED 98
           +LP C H F  EC+  W     TCPLCR  +      VD +Q + +D
Sbjct: 232 KLP-CGHIFGRECLYRWCKLENTCPLCRHVI----AEVDTTQHQAQD 273

>Sklu_2317.2 YDR143C, Contig c2317 4002-5483
          Length = 493

 Score = 35.4 bits (80), Expect = 0.004,   Method: Composition-based stats.
 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 56  CNHRFDLECVAVWLSKSRTCPLCRDDVLSHKP-NVDVSQVEMED 98
           C HRF   C+  W  +  +CP+CR +++  +  N D+   E  D
Sbjct: 141 CGHRFGRMCIYQWTKEHNSCPICRAEIVGREGLNRDLPDEETGD 184

>YMR247C (YMR247C) [4203] chr13 complement(763350..768038) Protein of
            unknown function, has weak similarity to uncharacterized
            C. albicans Orf6.3079p [4689 bp, 1562 aa]
          Length = 1562

 Score = 35.0 bits (79), Expect = 0.005,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 35/78 (44%), Gaps = 8/78 (10%)

Query: 12   GCPDTYIDSLPRVEKG---KLKDAEACSIC--CCNYRDDKYPLVVELPHCNHRFDLECVA 66
            G   + +DSL    K    +    E C+IC    +  D K P     P C ++F   C+ 
Sbjct: 1482 GMNGSVLDSLELFTKNVHLQFSGFEECAICYSILHAVDRKLPSKT-CPTCKNKFHGACLY 1540

Query: 67   VWL--SKSRTCPLCRDDV 82
             W   S + TCPLCR ++
Sbjct: 1541 KWFRSSGNNTCPLCRSEI 1558

>YDL008W (APC11) [849] chr4 (433494..433991) Component of the
          anaphase-promoting complex (APC), has ubiquitin ligase
          activity and is required for the metaphase-anaphase
          transition [498 bp, 165 aa]
          Length = 165

 Score = 34.3 bits (77), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 14/65 (21%)

Query: 27 GKLKDAEACSIC---------CCNYRDDKYPLVVELPHCNHRFDLECVAVWL---SKSRT 74
          G  +D + C IC          C +  D+ PLV+ L  C+H F   C+  WL   +    
Sbjct: 33 GNDEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGL--CHHNFHDHCIYRWLDTPTSKGL 90

Query: 75 CPLCR 79
          CP+CR
Sbjct: 91 CPMCR 95

>ABR104W [696] [Homologous to ScYPR093C - SH]
           complement(574067..575053) [987 bp, 328 aa]
          Length = 328

 Score = 34.7 bits (78), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 29/55 (52%), Gaps = 8/55 (14%)

Query: 56  CNHRFDLECVAVWL---SKSRTCPLCRDDV-----LSHKPNVDVSQVEMEDDWGM 102
           C H + L C+  W    S +R+CP+CR +        H+  +D+S  ++ D +G+
Sbjct: 35  CGHEYHLACIRKWFHLHSGNRSCPVCRTEASVLVDTDHEVKIDLSVGQLLDFYGL 89

>YDR143C (SAN1) [988] chr4 complement(742036..743868) Protein that
           may antagonize the function of Spt16p and Sir4p [1833
           bp, 610 aa]
          Length = 610

 Score = 34.7 bits (78), Expect = 0.008,   Method: Composition-based stats.
 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 1/32 (3%)

Query: 51  VELPHCNHRFDLECVAVWLSKSRTCPLCRDDV 82
           ++LP C H F  EC+  W     +CPLCR  +
Sbjct: 253 IKLP-CGHIFGRECIYKWSRLENSCPLCRQKI 283

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 34.7 bits (78), Expect = 0.008,   Method: Composition-based stats.
 Identities = 11/25 (44%), Positives = 15/25 (60%)

Query: 55   HCNHRFDLECVAVWLSKSRTCPLCR 79
            +C H F   C+  WL   +TCPLC+
Sbjct: 1178 NCGHLFCTSCIFSWLKNRKTCPLCK 1202

>CAGL0L01947g 225999..228272 similar to sp|P36096 Saccharomyces
           cerevisiae YKL034w, start by similarity
          Length = 757

 Score = 34.3 bits (77), Expect = 0.009,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 19/59 (32%)

Query: 35  CSICCCNYRDDKYPLVVE-LPH-------------CNHRFDLECVAVWLSKSRTCPLCR 79
           C+IC       ++P+ VE LP              C+H F   C+  W+S    CP+CR
Sbjct: 698 CAICMA-----EFPVYVEELPETHQVDKDSYMITPCDHMFHTSCLESWMSYKLQCPVCR 751

>Sklu_2432.9 , Contig c2432 20306-24733 reverse complement
          Length = 1475

 Score = 33.5 bits (75), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 18/34 (52%)

Query: 49   LVVELPHCNHRFDLECVAVWLSKSRTCPLCRDDV 82
             V  +  C H F   C+  WL +  TCPLC+ +V
Sbjct: 1173 FVGSVVKCGHFFCYSCIHTWLKEHNTCPLCKTNV 1206

>KLLA0F25674g 2384293..2386566 similar to sp|P36096 Saccharomyces
           cerevisiae YKL034w singleton, start by similarity
          Length = 757

 Score = 33.5 bits (75), Expect = 0.019,   Method: Composition-based stats.
 Identities = 11/24 (45%), Positives = 15/24 (62%)

Query: 56  CNHRFDLECVAVWLSKSRTCPLCR 79
           C+H F  EC+  W+S    CP+CR
Sbjct: 728 CSHIFHTECLENWMSYKLQCPVCR 751

>KLLA0F12166g complement(1116715..1121301) weakly similar to
            sgd|S0004237 Saccharomyces cerevisiae YLR247c,
            hypothetical start
          Length = 1528

 Score = 33.1 bits (74), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 36/68 (52%), Gaps = 5/68 (7%)

Query: 17   YIDSLPRVEKGKLKDAEACSICCCNYRDDKYPLVVELPHCNHRFDLECVAVWLSKSRTCP 76
            Y+D+L ++ K  + + E  S   C Y D     +++   C H F  +CV  W  K+ +CP
Sbjct: 1189 YLDTLGQL-KTAIANGENISCAVC-YSDIYTGSILK---CGHFFCKDCVTHWFKKNTSCP 1243

Query: 77   LCRDDVLS 84
            +C++ + S
Sbjct: 1244 MCKNRMSS 1251

>Kwal_26.8099
          Length = 750

 Score = 33.1 bits (74), Expect = 0.024,   Method: Composition-based stats.
 Identities = 10/24 (41%), Positives = 15/24 (62%)

Query: 56  CNHRFDLECVAVWLSKSRTCPLCR 79
           C+H F  +C+  W+S    CP+CR
Sbjct: 721 CSHIFHTQCLESWMSYKLQCPVCR 744

>YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protein
            containing an SNF2 related N-terminal domain, a C3HC4
            type (RING) zinc finger, and a helicase conserved
            C-terminal domain, has a region of low similarity to a
            region of transcription termination factor RNA polymerase
            II (human TTF2) [4671 bp, 1556 aa]
          Length = 1556

 Score = 33.1 bits (74), Expect = 0.026,   Method: Composition-based stats.
 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 9/65 (13%)

Query: 17   YIDSLPRVEKGKLKDAE--ACSICCCNYRDDKYPLVVELPHCNHRFDLECVAVWLSKSRT 74
            Y+ +L R+ K  L D +  +CSIC           +  +  C H F   C+  WL     
Sbjct: 1220 YLKNLSRL-KDTLNDNQILSCSICLGEVE------IGAIIKCGHYFCKSCILTWLRAHSK 1272

Query: 75   CPLCR 79
            CP+C+
Sbjct: 1273 CPICK 1277

>YKL034W (TUL1) [3222] chr11 (371472..373748) Protein containing a
           C3HC4 type (RING) zinc finger, which may mediate
           protein-protein interactions, has low similarity to
           uncharacterized C. albicans Orf6.5365p [2277 bp, 758 aa]
          Length = 758

 Score = 33.1 bits (74), Expect = 0.026,   Method: Composition-based stats.
 Identities = 10/24 (41%), Positives = 14/24 (58%)

Query: 56  CNHRFDLECVAVWLSKSRTCPLCR 79
           CNH F   C+  W++    CP+CR
Sbjct: 729 CNHVFHTSCLENWMNYKLQCPVCR 752

>Scas_615.13
          Length = 330

 Score = 32.7 bits (73), Expect = 0.032,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 22/52 (42%), Gaps = 6/52 (11%)

Query: 30  KDAEACSICCCNYRDDKYPLVVELPHCNHRFDLECVAVWLSKSRTCPLCRDD 81
           +DA  C I C  Y  D          C H F  EC+  W  +   CPLCR +
Sbjct: 275 EDARKC-ILCLAYMTDP-----SCSPCGHIFCWECILDWCKERPECPLCRQE 320

>Kwal_14.1287
          Length = 1518

 Score = 32.7 bits (73), Expect = 0.033,   Method: Composition-based stats.
 Identities = 10/24 (41%), Positives = 14/24 (58%)

Query: 56   CNHRFDLECVAVWLSKSRTCPLCR 79
            C H F  +C+  WL    +CPLC+
Sbjct: 1204 CGHFFCQDCICSWLKNHSSCPLCK 1227

>Sklu_2102.1 YKL034W, Contig c2102 417-2672 reverse complement
          Length = 751

 Score = 32.7 bits (73), Expect = 0.034,   Method: Composition-based stats.
 Identities = 10/24 (41%), Positives = 14/24 (58%)

Query: 56  CNHRFDLECVAVWLSKSRTCPLCR 79
           C H F  +C+  W+S    CP+CR
Sbjct: 722 CGHIFHTQCLESWMSYKLQCPVCR 745

>YDR265W (PEX10) [1098] chr4 (998856..999869) Peroxisomal biogenesis
           protein (peroxin) [1014 bp, 337 aa]
          Length = 337

 Score = 32.3 bits (72), Expect = 0.038,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 34/84 (40%), Gaps = 11/84 (13%)

Query: 1   MQEELLQEKQEGCP-DTYIDSLPRVEKGKL----KDAEACSICCCNYRDDKYPLVVELPH 55
           +QE    E  EG P ++ +  +   +K +L    + +  C +C  N  D           
Sbjct: 247 LQERSEHESIEGIPKESQLTHINLSDKNQLPFIPEASRKCILCLMNMSDP------SCAP 300

Query: 56  CNHRFDLECVAVWLSKSRTCPLCR 79
           C H F   C+  W  +   CPLCR
Sbjct: 301 CGHLFCWSCLMSWCKERPECPLCR 324

>AER390W [2890] [Homologous to ScYDR265W (PEX10) - SH]
           complement(1370316..1370364,1370423..1371324) [951 bp,
           316 aa]
          Length = 316

 Score = 32.0 bits (71), Expect = 0.051,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 6/50 (12%)

Query: 30  KDAEACSICCCNYRDDKYPLVVELPHCNHRFDLECVAVWLSKSRTCPLCR 79
           + +  C +C  +  D        LP C H F   CV  W ++   CPLCR
Sbjct: 261 EQSRKCILCLADMTDPSC-----LP-CGHMFCWACVMQWCNERNECPLCR 304

>KLLA0E07139g 651474..651806 similar to sgd|S0005493 Saccharomyces
          cerevisiae YOL133w HRT1, start by similarity
          Length = 110

 Score = 31.2 bits (69), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 16/34 (47%)

Query: 44 DDKYPLVVELPHCNHRFDLECVAVWLSKSRTCPL 77
          + ++  V     CNH F L C+  W+     CPL
Sbjct: 65 NSEHECVAAWGECNHAFHLHCITQWIKSRNVCPL 98

>Scas_573.9
          Length = 1502

 Score = 32.0 bits (71), Expect = 0.057,   Method: Composition-based stats.
 Identities = 9/24 (37%), Positives = 13/24 (54%)

Query: 56   CNHRFDLECVAVWLSKSRTCPLCR 79
            C H F   C+  WL   + CP+C+
Sbjct: 1206 CGHFFCKRCITSWLKNKKNCPMCK 1229

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 32.0 bits (71), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 9/70 (12%)

Query: 17   YIDSLPRVEKGKLKDAEA--CSICCCNYRDDKYPLVVELPHCNHRFDLECVAVWLSKSRT 74
            Y+ +L ++E+  LKD     C+IC C+  D        +    H +  EC++ WL   ++
Sbjct: 1200 YLQNLTKLEQA-LKDNMRFNCTICLCDICDGA------IIGRGHFYCQECISSWLETKQS 1252

Query: 75   CPLCRDDVLS 84
            CPLC+    S
Sbjct: 1253 CPLCKTQTKS 1262

>Scas_625.4
          Length = 761

 Score = 32.0 bits (71), Expect = 0.060,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 35/90 (38%), Gaps = 25/90 (27%)

Query: 10  QEGCPDTYID----SLPRVEK--GKLKDAEACSICCCNYRDDKYPLVVE----------- 52
           Q   P+ YI     SL  + K  G  K    C+IC       + P+ +E           
Sbjct: 671 QHSIPEGYIYFKPVSLAHLAKHEGASKHTADCAICM-----SEVPVYIEEAEETHNIDQH 725

Query: 53  ---LPHCNHRFDLECVAVWLSKSRTCPLCR 79
              +  C+H F  +C+  W+     CP+CR
Sbjct: 726 SYMVTPCDHIFHTDCLENWMGYKLQCPVCR 755

>Scas_665.1
          Length = 392

 Score = 32.0 bits (71), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 11/67 (16%)

Query: 28 KLKDAEACSICCCNYRDDKYPLVVELPHCNHRFDLECVAVWLS----KSRTCPLCRDDVL 83
          KL ++  C+IC       +Y  V  +  C H +   C+  W+S    K   CP CR D+ 
Sbjct: 23 KLLESAICTICS------EYMFVPMMTSCGHNYCYGCLKSWISTNSKKELACPQCRSDI- 75

Query: 84 SHKPNVD 90
          +  PN++
Sbjct: 76 TDTPNLN 82

>CAGL0E01441g 135075..137228 weakly similar to sp|P22470
           Saccharomyces cerevisiae YDR143c mating-type regulation
           protein, hypothetical start
          Length = 717

 Score = 32.0 bits (71), Expect = 0.071,   Method: Composition-based stats.
 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 1/32 (3%)

Query: 51  VELPHCNHRFDLECVAVWLSKSRTCPLCRDDV 82
           V++P C H F   C+  W     +CPLCR  +
Sbjct: 291 VKIP-CGHIFGRSCLYEWTRLENSCPLCRKKI 321

>CAGL0H02651g 238495..243129 similar to sp|Q04781 Saccharomyces
            cerevisiae YMR247c, start by similarity
          Length = 1544

 Score = 32.0 bits (71), Expect = 0.072,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 5/54 (9%)

Query: 33   EACSIC--CCNYRDDKYPLVVELPHCNHRFDLECVAVWL--SKSRTCPLCRDDV 82
            E C+IC    +  D K P       C ++F   C+  W   S + TCPLCR ++
Sbjct: 1488 EECAICYSILHAVDRKLP-TKTCSTCKNKFHGACLYKWFRSSGNNTCPLCRSEI 1540

>CAGL0M08690g complement(865182..866168) similar to sp|Q05568
           Saccharomyces cerevisiae YDR265w peroxisomal assembly
           protein - peroxin, hypothetical start
          Length = 328

 Score = 31.6 bits (70), Expect = 0.089,   Method: Composition-based stats.
 Identities = 10/24 (41%), Positives = 14/24 (58%)

Query: 56  CNHRFDLECVAVWLSKSRTCPLCR 79
           C H F  +C+  W  ++  CPLCR
Sbjct: 292 CGHVFCWDCITDWTKENPECPLCR 315

>Kwal_55.22054
          Length = 111

 Score = 30.4 bits (67), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 13/28 (46%)

Query: 50 VVELPHCNHRFDLECVAVWLSKSRTCPL 77
          V     CNH F L C+  WL     CPL
Sbjct: 72 VAAWGTCNHAFHLHCINKWLQTRNACPL 99

>CAGL0I04576g 408872..409321 similar to tr|Q12157 Saccharomyces
          cerevisiae YDL008w APC11 subunit of the anaphase
          promoting complex, start by similarity
          Length = 149

 Score = 30.8 bits (68), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 10/60 (16%)

Query: 30 KDAEACSICCCNYRDD----KYP---LVVELPHCNHRFDLECVAVWL---SKSRTCPLCR 79
          +D + C IC  +Y       +YP     + L  C H F + C++ W+   +    CP+CR
Sbjct: 32 EDEDVCGICRASYHAPCPNCRYPGESCAIVLGRCGHNFHVHCISRWVDTPTSKGLCPMCR 91

>Sklu_2416.8 YOL133W, Contig c2416 15124-15456
          Length = 110

 Score = 30.4 bits (67), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 13/28 (46%)

Query: 50 VVELPHCNHRFDLECVAVWLSKSRTCPL 77
          V     CNH F L C+  WL     CPL
Sbjct: 71 VAAWGTCNHAFHLHCINKWLQTRNACPL 98

>AFR275W [3467] [Homologous to ScYKL034W (TUL1) - NSH]
           complement(928488..930749) [2262 bp, 753 aa]
          Length = 753

 Score = 30.8 bits (68), Expect = 0.15,   Method: Composition-based stats.
 Identities = 10/24 (41%), Positives = 14/24 (58%)

Query: 56  CNHRFDLECVAVWLSKSRTCPLCR 79
           C+H F   C+  W+S    CP+CR
Sbjct: 724 CSHLFHTGCLENWMSYKLQCPVCR 747

>AER016C [2521] [Homologous to ScYDL008W (APC11) - SH]
          (659572..660015) [444 bp, 147 aa]
          Length = 147

 Score = 30.4 bits (67), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 5/43 (11%)

Query: 40 CNYRDDKYPLVVELPHCNHRFDLECVAVWLSKSRT---CPLCR 79
          C    +  PL+V    C+H F + C+  WL+ S +   CP+CR
Sbjct: 52 CKLPGETCPLIVG--SCHHNFHVHCIYQWLNTSTSKGLCPMCR 92

>ADL181W [1560] [Homologous to ScYOL133W (HRT1) - SH]
          complement(379684..380010) [327 bp, 108 aa]
          Length = 108

 Score = 29.6 bits (65), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 13/28 (46%)

Query: 50 VVELPHCNHRFDLECVAVWLSKSRTCPL 77
          V     CNH F L C+  WL     CPL
Sbjct: 69 VAAWGTCNHAFHLHCINKWLLTRNACPL 96

>Scas_718.77
          Length = 128

 Score = 29.6 bits (65), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 5/44 (11%)

Query: 40  CNYRDDKYPLVVELPHCNHRFDLECVAVWLSKSR---TCPLCRD 80
           C++     P+VV    C H F + CV  WL+ +     CP+CR 
Sbjct: 60  CSHPGVTCPVVVGT--CQHAFHVHCVVPWLATAAARGACPMCRQ 101

>Scas_585.5*
          Length = 109

 Score = 29.3 bits (64), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 13/28 (46%)

Query: 50 VVELPHCNHRFDLECVAVWLSKSRTCPL 77
          V     CNH F L C+  W+     CPL
Sbjct: 70 VAAWGTCNHAFHLHCINKWIKTRDACPL 97

>Scas_705.41
          Length = 428

 Score = 29.3 bits (64), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 3/58 (5%)

Query: 24 VEKGKLKDAEACSICCCNYRDDKYPLVVELPHCNHRFDLECVAVW--LSKSRTCPLCR 79
          ++   L+    C IC  +  D    L  +L  CNH++  +C+  W   S +  CPLCR
Sbjct: 1  MKSSALEGDNICPICFDDLNDTDI-LQGKLKPCNHKYHYDCIRRWHGYSDNSDCPLCR 57

>YOL133W (HRT1) [4690] chr15 (70324..70689) Activator of the
           Cdc53p-containing SCF-Cdc4p ubiquitin ligase required
           for ubiquitination of Sic1p and for the G1 to S cell
           cycle transition; RING-box protein [366 bp, 121 aa]
          Length = 121

 Score = 28.9 bits (63), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 12/22 (54%)

Query: 56  CNHRFDLECVAVWLSKSRTCPL 77
           CNH F L C+  W+     CPL
Sbjct: 88  CNHAFHLHCINKWIKTRDACPL 109

>KLLA0B08679g 767808..768899 weakly similar to sgd|S0005415
          Saccharomyces cerevisiae YOL054w, start by similarity
          Length = 363

 Score = 29.3 bits (64), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 43/78 (55%), Gaps = 13/78 (16%)

Query: 27 GKLKDAEACSICCCNYRDDKYPLVVELPHCNHRFDLECVAVWLSKSR------TCPLCRD 80
          G++ D+  C+IC        Y  V  +  C H +  EC+  WL+ +R      TCP CR 
Sbjct: 22 GRVLDSTVCTIC------HDYMFVPVMTSCGHNYCYECLNNWLNNNRSNVSELTCPQCR- 74

Query: 81 DVLSHKPNVDVSQVEMED 98
          +V++++P+++V+  ++ D
Sbjct: 75 NVITNEPSLNVALQQIVD 92

>YBL079W (NUP170) [121] chr2 (75256..79764) Nuclear pore protein
           (nucleoporin) with similarity to mammalian Nup155p,
           affects nuclear pore complex permeability, may function
           in chromosome segregation [4509 bp, 1502 aa]
          Length = 1502

 Score = 28.5 bits (62), Expect = 1.1,   Method: Composition-based stats.
 Identities = 15/40 (37%), Positives = 21/40 (52%)

Query: 60  FDLECVAVWLSKSRTCPLCRDDVLSHKPNVDVSQVEMEDD 99
           F+ +C  V L+KS    L   ++LS  P VD  Q   ED+
Sbjct: 305 FNSKCSKVCLTKSALLSLLPTNMLSQIPGVDFIQALFEDN 344

>AGL217W [4095] [Homologous to ScYOL054W - SH]
          complement(290043..291287) [1245 bp, 414 aa]
          Length = 414

 Score = 28.1 bits (61), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 33/69 (47%), Gaps = 11/69 (15%)

Query: 28 KLKDAEACSICCCNYRDDKYPLVVELPHCNHRFDLECVAVWLSKSRT----CPLCRDDVL 83
          KL +   C+IC        Y  V  +  C H +   C++ WL+ + +    CP CR  + 
Sbjct: 31 KLLETTICTIC------HDYMYVPVMTGCGHNYCYFCISNWLNNTSSTELNCPQCRSSIT 84

Query: 84 SHKPNVDVS 92
          S  P+++V+
Sbjct: 85 S-MPSLNVT 92

>Sklu_1785.3 YOL054W, Contig c1785 2663-3658 reverse complement
          Length = 331

 Score = 27.7 bits (60), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 4/38 (10%)

Query: 49 LVVELPHCNHRFDLECVAVWLSKSR----TCPLCRDDV 82
          LV  +  C H +  +C++ WL+ +     TCP CR  V
Sbjct: 2  LVPVMTSCGHNYCYDCISNWLNNNNATELTCPQCRTSV 39

>YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein that
           binds in vitro to proteins containing canonical nuclear
           localization signal, has similarity to human BRAP2
           breast cancer-associated protein which may regulate
           protein import into the nucleus [1758 bp, 585 aa]
          Length = 585

 Score = 27.7 bits (60), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 3/46 (6%)

Query: 38  CCCNYRDDKYPLVVELPHCNHRFDLECVAVWLSKSRTCPLCRDDVL 83
            C    D +   +V +P C H F  +C+  W  K+  CP+CR   L
Sbjct: 242 VCLERMDSETTGLVTIP-CQHTFHCQCLNKW--KNSRCPVCRHSSL 284

>KLLA0C15697g 1360289..1361203 weakly similar to sgd|S0006297
          Saccharomyces cerevisiae YPR093c, start by similarity
          Length = 304

 Score = 27.7 bits (60), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 2/48 (4%)

Query: 52 ELPHCNHRFDLECVAVW--LSKSRTCPLCRDDVLSHKPNVDVSQVEME 97
          EL  C HR+ + C+  W   S    CP CR +  S +   D  +++++
Sbjct: 19 ELLPCEHRYHVSCIRKWHLYSNDFKCPTCRKESKSLRRKHDDIEIDLK 66

>Sklu_2337.2 YPR093C, Contig c2337 3730-4698 reverse complement
          Length = 322

 Score = 27.3 bits (59), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 9/64 (14%)

Query: 34 ACSICCCNYRDDKYPLVVELPHCNHRFDLECVAVWLSKSR--TCPLCR---DDVLSHKPN 88
           CSIC      +   LV     C H + LEC+  W + S+   CP CR   + +L  + N
Sbjct: 5  TCSICLEALGQNIGRLVT----CQHEYHLECIREWHNHSQDFKCPTCRVESNKLLDVENN 60

Query: 89 VDVS 92
          V ++
Sbjct: 61 VTIN 64

>KLLA0E16720g complement(1481372..1482289) similar to sp|Q05568
           Saccharomyces cerevisiae YDR265w PAS4 peroxisomal
           assembly protein - peroxin singleton, start by
           similarity
          Length = 305

 Score = 27.3 bits (59), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 6/49 (12%)

Query: 31  DAEACSICCCNYRDDKYPLVVELPHCNHRFDLECVAVWLSKSRTCPLCR 79
           D+  C + C NY  D          C H F  +C+  W  + + CPLCR
Sbjct: 251 DSRKC-VLCLNYMLDP-----SATPCGHLFCWDCIMEWTLERQECPLCR 293

>YPR181C (SEC23) [5595] chr16 complement(897355..899661) Component
          of COPII coat of vesicles involved in endoplasmic
          reticulum to Golgi transport, has GTPase-activation
          (GAP) activity for Sar1p [2307 bp, 768 aa]
          Length = 768

 Score = 27.7 bits (60), Expect = 2.0,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 16/31 (51%)

Query: 48 PLVVELPHCNHRFDLECVAVWLSKSRTCPLC 78
          P+V   PHC    +  CV    + S +CP+C
Sbjct: 53 PVVCSGPHCKSILNPYCVIDPRNSSWSCPIC 83

>YPR093C (YPR093C) [5516] chr16 complement(719554..720420) Protein
          containing a C3HC4 type (RING) zinc finger, which may
          mediate protein-protein interactions [867 bp, 288 aa]
          Length = 288

 Score = 27.3 bits (59), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 56 CNHRFDLECVAVW--LSKSRTCPLCR 79
          C H+F L C+  W   S +  CP+CR
Sbjct: 23 CGHKFHLNCIREWHKYSINLKCPICR 48

>KLLA0F07469g 703955..706933 similar to sp|Q02792 Saccharomyces
           cerevisiae YOR048c RAT1 5 -3 exoribonuclease, start by
           similarity
          Length = 992

 Score = 27.3 bits (59), Expect = 2.4,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 4/42 (9%)

Query: 53  LPHCNHRFDLE-CVAVWLSKSRTCPLCRDDVLSHKPNVDVSQ 93
           +PH + +FD E  +  W+     C  C +D L H P +DV +
Sbjct: 307 IPHLSFQFDFERAIDDWVF---MCFFCGNDFLPHLPCLDVRE 345

>CAGL0I09988g complement(951368..952531) similar to tr|Q12161
          Saccharomyces cerevisiae YOL054w, start by similarity
          Length = 387

 Score = 27.3 bits (59), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 21/57 (36%), Gaps = 11/57 (19%)

Query: 28 KLKDAEACSICCCNYRDDKYPLVVELPHCNHRFDLECVAVWLSKSR-----TCPLCR 79
          KL D   CSIC        Y  V     C H +   C+  W S        +CP CR
Sbjct: 23 KLLDTTICSICH------DYMFVPMTTECGHSYCYTCLKTWFSSDTNRGGLSCPECR 73

>Sklu_1676.3 YDR265W, Contig c1676 2766-3071 reverse complement
          Length = 101

 Score = 26.6 bits (57), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 13/30 (43%)

Query: 56 CNHRFDLECVAVWLSKSRTCPLCRDDVLSH 85
          C H F   C+  W  +   CPLCR   L  
Sbjct: 66 CGHIFCWNCIINWCKERSECPLCRQKCLKQ 95

>AAR049C [235] [Homologous to ScYCR066W (RAD18) - SH]
          (428904..430235) [1332 bp, 443 aa]
          Length = 443

 Score = 26.2 bits (56), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 14/26 (53%)

Query: 53 LPHCNHRFDLECVAVWLSKSRTCPLC 78
          L  C H F   C+  +L+K   CPLC
Sbjct: 44 LTQCGHTFCSLCIREYLNKESRCPLC 69

>Kwal_55.21206
          Length = 275

 Score = 26.2 bits (56), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 3/48 (6%)

Query: 53  LPHCNHRFDLECVAVWLSKSRT-CPLCRDDVLSHKPNVDVSQVEMEDD 99
           L  CNH F   C+  W+ ++   CPLC+       P V   QV   DD
Sbjct: 135 LLGCNHVFHTYCIDQWICRNSACCPLCKRSY--SLPRVFHPQVRYIDD 180

>Kwal_55.19999
          Length = 152

 Score = 25.8 bits (55), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 2/34 (5%)

Query: 56  CNHRFDLECVAVWLSKSRTCPLCRDDVLSHKPNV 89
           C H F  +C+  W ++   CPLCR     H  NV
Sbjct: 117 CGHVFCWKCLLSWCNERPECPLCRQTC--HAQNV 148

>Scas_720.89
          Length = 469

 Score = 26.2 bits (56), Expect = 6.6,   Method: Composition-based stats.
 Identities = 10/30 (33%), Positives = 17/30 (56%)

Query: 53 LPHCNHRFDLECVAVWLSKSRTCPLCRDDV 82
          L  C+H F   C+  +L  +  CPLC +++
Sbjct: 40 LTPCSHTFCSLCIREYLKDNSKCPLCLNEL 69

>YHR192W (YHR192W) [2477] chr8 (486824..487660) Protein of unknown
           function [837 bp, 278 aa]
          Length = 278

 Score = 25.8 bits (55), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 9/20 (45%), Positives = 12/20 (60%)

Query: 42  YRDDKYPLVVELPHCNHRFD 61
           YR    P++   PHCNH+ D
Sbjct: 233 YRLASKPIIFICPHCNHKID 252

>KLLA0C08756g complement(765847..767130) weakly similar to
          sp|P10862 Saccharomyces cerevisiae YCR066w RAD18 DNA
          repair protein singleton, start by similarity
          Length = 427

 Score = 25.8 bits (55), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 15/30 (50%)

Query: 53 LPHCNHRFDLECVAVWLSKSRTCPLCRDDV 82
          L  C H F   C+  +L K   CPLC  D+
Sbjct: 44 LTPCGHSFCSICIRKYLQKESKCPLCLSDL 73

>Scas_699.51
          Length = 1012

 Score = 25.8 bits (55), Expect = 7.6,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 4/42 (9%)

Query: 53  LPHCNHRFDLE-CVAVWLSKSRTCPLCRDDVLSHKPNVDVSQ 93
           +P  +  FDLE  +  W+     C  C +D L H P++DV +
Sbjct: 307 IPRLSFPFDLERAIDDWVF---MCFFCGNDFLPHLPSLDVRE 345

>CAGL0G01848g complement(168200..168670) weakly similar to
          tr|Q06091 Saccharomyces cerevisiae YPR101w SNT309,
          hypothetical start
          Length = 156

 Score = 25.4 bits (54), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 3  EELLQEKQEGCP-DTYIDSLPRVEKGKLKDAEACSICCCNYRD 44
          +EL++E+    P + Y   +PRV   K +DAE+  I    Y D
Sbjct: 22 DELVEEECGAMPSEGYHPEVPRVMAAKGRDAESGGIDLARYND 64

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.138    0.458 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,720,908
Number of extensions: 143538
Number of successful extensions: 381
Number of sequences better than 10.0: 96
Number of HSP's gapped: 374
Number of HSP's successfully gapped: 96
Length of query: 104
Length of database: 16,596,109
Length adjustment: 75
Effective length of query: 29
Effective length of database: 13,999,759
Effective search space: 405993011
Effective search space used: 405993011
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)