Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_27.105452022009741e-136
Sklu_2357.42041917491e-102
YDR041W (RSM10)2032016099e-81
CAGL0K12056g2352306032e-79
AGR035C2071695933e-78
KLLA0F18436g2072065779e-76
Scas_569.12411875633e-73
CAGL0L13332g103559633.9
AGL320C57663615.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10545
         (200 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10545                                                         379   e-136
Sklu_2357.4 YDR041W, Contig c2357 5034-5648                           293   e-102
YDR041W (RSM10) [894] chr4 (539798..540409) Component of the mit...   239   9e-81
CAGL0K12056g 1166627..1167334 similar to tr|Q03201 Saccharomyces...   236   2e-79
AGR035C [4345] [Homologous to ScYDR041W (RSM10) - SH] (773294..7...   233   3e-78
KLLA0F18436g 1697109..1697732 similar to sgd|S0002448 Saccharomy...   226   9e-76
Scas_569.1                                                            221   3e-73
CAGL0L13332g 1432034..1435141 some similarities with sp|P39712 S...    29   3.9  
AGL320C [3992] [Homologous to ScYBL039C (URA7) - SH; ScYJR103W (...    28   5.8  

>Kwal_27.10545
          Length = 202

 Score =  379 bits (974), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 185/200 (92%), Positives = 185/200 (92%)

Query: 1   MFRPSLLAPLRHFARFQSTSVASEAPNVAKKLPINVEAVYYAPLRIPITHGDLIADLQLR 60
           MFRPSLLAPLRHFARFQSTSVASEAPNVAKKLPINVEAVYYAPLRIPITHGDLIADLQLR
Sbjct: 1   MFRPSLLAPLRHFARFQSTSVASEAPNVAKKLPINVEAVYYAPLRIPITHGDLIADLQLR 60

Query: 61  SYDHENLDFFADFILRAGFYLGMPLTGPKPLPTRRERWTVIRSPFAQAKSKENFERHTHK 120
           SYDHENLDFFADFILRAGFYLGMPLTGPKPLPTRRERWTVIRSPFAQAKSKENFERHTHK
Sbjct: 61  SYDHENLDFFADFILRAGFYLGMPLTGPKPLPTRRERWTVIRSPFAQAKSKENFERHTHK 120

Query: 121 RLIRVWDTNPEVVELWLSYISKHSIPGVGIKCNLFQKEGXXXXXXXXXXXXXXXPGKSNS 180
           RLIRVWDTNPEVVELWLSYISKHSIPGVGIKCNLFQKEG               PGKSNS
Sbjct: 121 RLIRVWDTNPEVVELWLSYISKHSIPGVGIKCNLFQKEGLQLSQNLEQNSLLQSPGKSNS 180

Query: 181 LDEAVGERVLELLNSENFKK 200
           LDEAVGERVLELLNSENFKK
Sbjct: 181 LDEAVGERVLELLNSENFKK 200

>Sklu_2357.4 YDR041W, Contig c2357 5034-5648
          Length = 204

 Score =  293 bits (749), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 155/191 (81%), Gaps = 6/191 (3%)

Query: 10  LRHFARFQSTSVASEAPNVAKKLPINVEAVYYAPLRIPITHGDLIADLQLRSYDHENLDF 69
           LR F RFQST     A       PINV AVY+APL++PITHGDL+ADLQLRSYD+ENLDF
Sbjct: 18  LRQFTRFQSTVAPPNA------FPINVTAVYHAPLKLPITHGDLVADLQLRSYDNENLDF 71

Query: 70  FADFILRAGFYLGMPLTGPKPLPTRRERWTVIRSPFAQAKSKENFERHTHKRLIRVWDTN 129
           F+DFILRAGFYLGMPLTGPKPLPTRRERWTVIRSPFAQAKSKENFERHTHKRLIRVWDTN
Sbjct: 72  FSDFILRAGFYLGMPLTGPKPLPTRRERWTVIRSPFAQAKSKENFERHTHKRLIRVWDTN 131

Query: 130 PEVVELWLSYISKHSIPGVGIKCNLFQKEGXXXXXXXXXXXXXXXPGKSNSLDEAVGERV 189
           PEV+ELWLSY++KHSIPGVGIKCN++Q+EG                G + +LDEAVGERV
Sbjct: 132 PEVIELWLSYLTKHSIPGVGIKCNVYQREGVRLSDSIDTSVLPELEGNTKTLDEAVGERV 191

Query: 190 LELLNSENFKK 200
           +ELLN   FKK
Sbjct: 192 VELLNDPEFKK 202

>YDR041W (RSM10) [894] chr4 (539798..540409) Component of the
           mitochondrial ribosomal small subunit [612 bp, 203 aa]
          Length = 203

 Score =  239 bits (609), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 116/201 (57%), Positives = 143/201 (71%), Gaps = 20/201 (9%)

Query: 10  LRHFARFQSTSVASEAPNVAKKLPINVEAVYYAPLRIPITHGDLIADLQLRSYDHENLDF 69
           LR F R QST          +  P+NVEAVYYAPL++PI +GDL+AD+QLRSYD+ENLDF
Sbjct: 8   LRSFIRTQST----------RPYPVNVEAVYYAPLKLPIKYGDLVADIQLRSYDNENLDF 57

Query: 70  FADFILRAGFYLGMPLTGPKPLPTRRERWTVIRSPFAQAKSKENFERHTHKRLIRVWDTN 129
           ++DFILR G+YLG+PLTGPKPLPTRRERWTVI+SPF  AKSKENFERHTHKRLIR WDTN
Sbjct: 58  YSDFILRTGYYLGIPLTGPKPLPTRRERWTVIKSPFVHAKSKENFERHTHKRLIRAWDTN 117

Query: 130 PEVVELWLSYISKHSIPGVGIKCNLFQKEGXXXXXXXXXXXXXXXPGKSNSL-------- 181
           PEV+++ ++YI+KHS+ GVG+KCN FQ+                     + L        
Sbjct: 118 PEVLQMLIAYITKHSMAGVGMKCNFFQRSEISLDLGSDANGLEKSLSNIDELYSLRNDDK 177

Query: 182 --DEAVGERVLELLNSENFKK 200
               AVG++VLELL+S +FKK
Sbjct: 178 AQTSAVGQKVLELLDSPDFKK 198

>CAGL0K12056g 1166627..1167334 similar to tr|Q03201 Saccharomyces
           cerevisiae YDR041w RSM10, hypothetical start
          Length = 235

 Score =  236 bits (603), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 122/230 (53%), Positives = 152/230 (66%), Gaps = 30/230 (13%)

Query: 1   MFRPSLLAPLRHFA---RFQSTSVASEAPNVAK----------------------KLPIN 35
           M R S+ +PL +     RFQST+V   +  V                        +LP+N
Sbjct: 1   MLRTSVRSPLLYRCLSKRFQSTAVPLSSKAVQNDLELTPKQQTNSSTTTSTNIPPQLPVN 60

Query: 36  VEAVYYAPLRIPITHGDLIADLQLRSYDHENLDFFADFILRAGFYLGMPLTGPKPLPTRR 95
           VEA+YYAPL+ P+THG L+ADLQLR+YD+ENLDFF DFILRAG+YLG+P+TGPKPLPTRR
Sbjct: 61  VEALYYAPLKNPVTHGHLVADLQLRAYDNENLDFFCDFILRAGYYLGLPMTGPKPLPTRR 120

Query: 96  ERWTVIRSPFAQAKSKENFERHTHKRLIRVWDTNPEVVELWLSYISKHSIPGVGIKCNLF 155
           ERWTVIRSPF  AKSKENFERHTHKRLIRVWD+NPEVV++ + YI+K+SI GVG+KC  +
Sbjct: 121 ERWTVIRSPFVHAKSKENFERHTHKRLIRVWDSNPEVVQMLVDYITKNSIAGVGLKCTTY 180

Query: 156 QKEGXXXXXXXXXXXXXXXPGKSN---SL--DEAVGERVLELLNSENFKK 200
           Q+                     N   SL  +E +G +V+ELLN+  FKK
Sbjct: 181 QRTTVDAKSGKISDAIEEINSTHNINPSLKENEEIGAKVVELLNTPTFKK 230

>AGR035C [4345] [Homologous to ScYDR041W (RSM10) - SH]
           (773294..773917) [624 bp, 207 aa]
          Length = 207

 Score =  233 bits (593), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 104/169 (61%), Positives = 133/169 (78%), Gaps = 2/169 (1%)

Query: 32  LPINVEAVYYAPLRIPITHGDLIADLQLRSYDHENLDFFADFILRAGFYLGMPLTGPKPL 91
           LP +V A+Y+ PL++P+ H DL+ADLQLR++D+++LDFFA+F LR G+YLG+P+TGPKPL
Sbjct: 39  LPKSVHALYFQPLKLPVKHHDLVADLQLRAFDNQSLDFFANFALRVGYYLGIPMTGPKPL 98

Query: 92  PTRRERWTVIRSPFAQAKSKENFERHTHKRLIRVWDTNPEVVELWLSYISKHSIPGVGIK 151
           PTRRERWTVIR+PFA AKSKENFERHTHKRL+R+WD NPEVVE++LSYI+KHS+ GVG+K
Sbjct: 99  PTRRERWTVIRAPFAHAKSKENFERHTHKRLLRLWDANPEVVEMFLSYITKHSMAGVGMK 158

Query: 152 CNLFQKEGXXXXXXXXXXXXXXXPGKSNSLDEAVGERVLELLNSENFKK 200
           CN+FQ+E                PG   + DE VG +V EL+ S  FKK
Sbjct: 159 CNMFQRES--VQLAQELADVPLAPGAPQTADEVVGAKVAELMQSPEFKK 205

>KLLA0F18436g 1697109..1697732 similar to sgd|S0002448 Saccharomyces
           cerevisiae YDR041w RSM10 component of the mitochondrial
           ribosomal small subunit, hypothetical start
          Length = 207

 Score =  226 bits (577), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 146/206 (70%), Gaps = 10/206 (4%)

Query: 1   MFRPSLLAPLRHFARFQSTSVASEA--PNVAKKLPI--NVEAVYYAPLRIPITHGDLIAD 56
           MFR ++    R F R+QST+  +    P  AK+ PI   VEAVY+APL+I  TH DLIAD
Sbjct: 3   MFRQAV----RSFVRYQSTTSLNPKILPFNAKETPIPKCVEAVYHAPLKIEPTHRDLIAD 58

Query: 57  LQLRSYDHENLDFFADFILRAGFYLGMPLTGPKPLPTRRERWTVIRSPFAQAKSKENFER 116
           +QLRSYD+ENLDFF+ F+LRAG+YLG+P+ GPKPLPT+R+RWTVIR+PF  AKSKENFER
Sbjct: 59  IQLRSYDNENLDFFSSFVLRAGYYLGIPMKGPKPLPTKRKRWTVIRAPFVMAKSKENFER 118

Query: 117 HTHKRLIRVWDTNPEVVELWLSYISKHSIPGVGIKCNLFQKE--GXXXXXXXXXXXXXXX 174
           HTH RLIR++D N E+VE  LSYISKH I GVGIKCNL+Q+E                  
Sbjct: 119 HTHARLIRLYDCNTELVETLLSYISKHGISGVGIKCNLYQREPIDLDSKKDGPELENIDI 178

Query: 175 PGKSNSLDEAVGERVLELLNSENFKK 200
             +   LD+ VG +V+ELLN+  FKK
Sbjct: 179 SSQLQGLDDVVGAKVVELLNNPEFKK 204

>Scas_569.1
          Length = 241

 Score =  221 bits (563), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 135/187 (72%), Gaps = 12/187 (6%)

Query: 26  PNVAKKLPINVEAVYYAPLRIPITHGDLIADLQLRSYDHENLDFFADFILRAGFYLGMPL 85
           P  A  +PIN++AVY+APLR PI +GDL+A++QLRSYD+ENLDF++DF LR GFYLG+PL
Sbjct: 53  PVDAPIVPINIKAVYHAPLRNPIKYGDLVAEIQLRSYDNENLDFYSDFALRVGFYLGIPL 112

Query: 86  TGPKPLPTRRERWTVIRSPFAQAKSKENFERHTHKRLIRVWDTNPEVVELWLSYISKHSI 145
           TGPKPLPTRRERWTVI+SPF  AKSKENFERHTHKR+I+VWDTN E++E+W+SYI+KH++
Sbjct: 113 TGPKPLPTRRERWTVIKSPFVHAKSKENFERHTHKRIIKVWDTNSELIEMWISYITKHAM 172

Query: 146 PGVGIKCNLFQKE----------GXXXXXXXXXXXXXXXPGKSNSL--DEAVGERVLELL 193
            GVG+KC +FQ+           G                     L  ++ V E+++ELL
Sbjct: 173 AGVGMKCTVFQRSPIASKEDATNGVSSSDSSSVLKSIVNQKDDVKLTDNDLVNEKIVELL 232

Query: 194 NSENFKK 200
             E FKK
Sbjct: 233 GREEFKK 239

>CAGL0L13332g 1432034..1435141 some similarities with sp|P39712
           Saccharomyces cerevisiae YAL063c FLO9, hypothetical
           start
          Length = 1035

 Score = 28.9 bits (63), Expect = 3.9,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 3/59 (5%)

Query: 26  PNVAKKLPINVEAVYYAPLRIPITHGDLIADLQLRSYDHENLDFFADFILRAGFYLGMP 84
           P V K + + +E+  Y PLR+   + D IA L    Y +++     DF   +G +  +P
Sbjct: 188 PGVNKNVTVYLESGIYYPLRLFFNNRDAIAQLDFAYYFNDSPIRQTDF---SGMFFSIP 243

>AGL320C [3992] [Homologous to ScYBL039C (URA7) - SH; ScYJR103W
           (URA8) - SH] (105701..107431) [1731 bp, 576 aa]
          Length = 576

 Score = 28.1 bits (61), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 31/63 (49%), Gaps = 14/63 (22%)

Query: 98  WTVIRSPFAQAKSKENFERHTHKRLIRVWDTNPEVV----ELWLSYISKHSIPGVGIKCN 153
           W++IR  +  A S E  ERH H+     ++ NP++V    E  L ++ +      G +C 
Sbjct: 470 WSIIRKLYGSASSVE--ERHRHR-----YEINPKMVQKLEEHGLKFVGRDE---TGTRCE 519

Query: 154 LFQ 156
           + +
Sbjct: 520 ILE 522

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.138    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,216,853
Number of extensions: 240694
Number of successful extensions: 483
Number of sequences better than 10.0: 10
Number of HSP's gapped: 478
Number of HSP's successfully gapped: 10
Length of query: 200
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 104
Effective length of database: 13,272,781
Effective search space: 1380369224
Effective search space used: 1380369224
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)