Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_27.1054330330016000.0
Sklu_2357.331530613240.0
KLLA0F18414g30130012781e-179
YBR061C (TRM7)31030712181e-170
CAGL0H10252g30930611961e-166
Scas_718.4630930611811e-164
AGR036W30630411211e-155
YCL054W (SPB1)8412474241e-46
Kwal_33.130548302134212e-46
Scas_642.128392474213e-46
AFR734C8452144187e-46
CAGL0B00484g8372704188e-46
Sklu_2421.108492974133e-45
KLLA0C00737g8332134063e-44
KLLA0B01980g2892502281e-21
CAGL0H08954g2812421798e-15
AFL117C303981781e-14
Sklu_2160.23151071648e-13
Scas_720.46321951649e-13
Kwal_56.241583071371594e-12
YGL136C (MRM2)3201051515e-11
Sklu_2115.6107987720.48
Scas_677.33168525672.0
YNL061W (NOP2)618137636.6
YDR465C (RMT2)412145627.0
Scas_694.23617137627.0
Kwal_23.288967995619.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10543
         (300 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10543                                                         620   0.0  
Sklu_2357.3 YBR061C, Contig c2357 3590-4537 reverse complement        514   0.0  
KLLA0F18414g complement(1695869..1696774) similar to sp|P38238 S...   496   e-179
YBR061C (TRM7) [252] chr2 complement(364747..365679) Methyltrans...   473   e-170
CAGL0H10252g complement(1002563..1003492) highly similar to sp|P...   465   e-166
Scas_718.46                                                           459   e-164
AGR036W [4346] [Homologous to ScYBR061C - SH] complement(774279....   436   e-155
YCL054W (SPB1) [493] chr3 (31449..33974) Putative S-adenosyl-met...   167   1e-46
Kwal_33.13054                                                         166   2e-46
Scas_642.12                                                           166   3e-46
AFR734C [3927] [Homologous to ScYCL054W (SPB1) - SH] (1785487..1...   165   7e-46
CAGL0B00484g 35991..38504 highly similar to sp|P25582 Saccharomy...   165   8e-46
Sklu_2421.10 YCL054W, Contig c2421 13526-16075 reverse complement     163   3e-45
KLLA0C00737g 53188..55689 similar to sp|P25582 Saccharomyces cer...   160   3e-44
KLLA0B01980g complement(173710..174579) similar to sp|P53123 Sac...    92   1e-21
CAGL0H08954g complement(875104..875949) similar to sp|P53123 Sac...    74   8e-15
AFL117C [3078] [Homologous to ScYGL136C (MRM2) - SH] (218993..21...    73   1e-14
Sklu_2160.2 YGL136C, Contig c2160 1404-2351                            68   8e-13
Scas_720.46                                                            68   9e-13
Kwal_56.24158                                                          66   4e-12
YGL136C (MRM2) [1851] chr7 complement(252900..253862) Methyltran...    63   5e-11
Sklu_2115.6 YGL156W, Contig c2115 5286-8525 reverse complement         32   0.48 
Scas_677.33                                                            30   2.0  
YNL061W (NOP2) [4529] chr14 (510538..512394) Nucleolar protein r...    29   6.6  
YDR465C (RMT2) [1283] chr4 complement(1393324..1394562) Protein ...    28   7.0  
Scas_694.23                                                            28   7.0  
Kwal_23.2889                                                           28   9.9  

>Kwal_27.10543
          Length = 303

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/300 (100%), Positives = 300/300 (100%)

Query: 1   MGKSSKDKRDLYYRKAKEEGYRARSAFKLLQLDEQFHFLDNVTRVVDLCAAPGSWSQVLS 60
           MGKSSKDKRDLYYRKAKEEGYRARSAFKLLQLDEQFHFLDNVTRVVDLCAAPGSWSQVLS
Sbjct: 1   MGKSSKDKRDLYYRKAKEEGYRARSAFKLLQLDEQFHFLDNVTRVVDLCAAPGSWSQVLS 60

Query: 61  RRLFEKDTENKGSKRIVSVDLQPMFPIENVTTIQADITHPKTLNKIMDLFDGEKADFVCS 120
           RRLFEKDTENKGSKRIVSVDLQPMFPIENVTTIQADITHPKTLNKIMDLFDGEKADFVCS
Sbjct: 61  RRLFEKDTENKGSKRIVSVDLQPMFPIENVTTIQADITHPKTLNKIMDLFDGEKADFVCS 120

Query: 121 DGAPDVTGLHDLDEYVQQQLILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQLSFLFE 180
           DGAPDVTGLHDLDEYVQQQLILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQLSFLFE
Sbjct: 121 DGAPDVTGLHDLDEYVQQQLILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQLSFLFE 180

Query: 181 RVVCAKPRSSRGTSLESFIVCLGYKPPKNWTPHLDVNMSVEDFFQGCDIGRLSLDDKLPD 240
           RVVCAKPRSSRGTSLESFIVCLGYKPPKNWTPHLDVNMSVEDFFQGCDIGRLSLDDKLPD
Sbjct: 181 RVVCAKPRSSRGTSLESFIVCLGYKPPKNWTPHLDVNMSVEDFFQGCDIGRLSLDDKLPD 240

Query: 241 YHVQPRSVAEFISCGGLDSFDSDATYHDVPVDRVTLNPVQPPTNPPYKRALELKRKGKLT 300
           YHVQPRSVAEFISCGGLDSFDSDATYHDVPVDRVTLNPVQPPTNPPYKRALELKRKGKLT
Sbjct: 241 YHVQPRSVAEFISCGGLDSFDSDATYHDVPVDRVTLNPVQPPTNPPYKRALELKRKGKLT 300

>Sklu_2357.3 YBR061C, Contig c2357 3590-4537 reverse complement
          Length = 315

 Score =  514 bits (1324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/306 (80%), Positives = 277/306 (90%), Gaps = 6/306 (1%)

Query: 1   MGKSSKDKRDLYYRKAKEEGYRARSAFKLLQLDEQFHFLDNVTRVVDLCAAPGSWSQVLS 60
           MGKSSKDKRDLYYRKAKE+GYRARSAFKLLQL++ FHFLDNVTRVVDLCAAPGSWSQVLS
Sbjct: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDHFHFLDNVTRVVDLCAAPGSWSQVLS 60

Query: 61  RRLF--EKDTENKGSKRIVSVDLQPMFPIENVTTIQADITHPKTLNKIMDLFDGEKADFV 118
           R+LF  E + ENK SK+IV+VDLQPM PI++VTT+QADITHP TL KI++LF G+KADFV
Sbjct: 61  RKLFDNELENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGTLAKILELFGGDKADFV 120

Query: 119 CSDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQLSFL 178
           CSDGAPDVTGLHDLDEYVQQQLILSALQLTTCLL+EGG FVAKIFRGRD+DMLYSQL +L
Sbjct: 121 CSDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLKEGGCFVAKIFRGRDVDMLYSQLGYL 180

Query: 179 FERVVCAKPRSSRGTSLESFIVCLGYKPPKNWTPHLDVNMSVEDFFQGCDIGRLSLDDKL 238
           FERVVCAKPRSSRG+SLESFIVCLGYKPP NWTPHLDVN S+EDFF+GCD+GRL+L D L
Sbjct: 181 FERVVCAKPRSSRGSSLESFIVCLGYKPPHNWTPHLDVNQSIEDFFRGCDLGRLTLQDNL 240

Query: 239 PDYHVQPRSVAEFISCGGLDSFDSDATYHDVPVDRVT----LNPVQPPTNPPYKRALELK 294
            +++ +PR++AEF+SCGGLDSFDSDATYH+V    VT    L+PVQ PTNPPYK+ALELK
Sbjct: 241 VEFYDEPRNIAEFVSCGGLDSFDSDATYHNVEGSDVTSKSALDPVQAPTNPPYKKALELK 300

Query: 295 RKGKLT 300
           R GKL 
Sbjct: 301 RSGKLA 306

>KLLA0F18414g complement(1695869..1696774) similar to sp|P38238
           Saccharomyces cerevisiae YBR061c, start by similarity
          Length = 301

 Score =  496 bits (1278), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 236/300 (78%), Positives = 265/300 (88%), Gaps = 2/300 (0%)

Query: 1   MGKSSKDKRDLYYRKAKEEGYRARSAFKLLQLDEQFHFLDNVTRVVDLCAAPGSWSQVLS 60
           MGKSSKDKRDLYYRKAKE+GYRARSAFKLLQLD+ FHFL    RVVDLCAAPGSWSQVLS
Sbjct: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLDDDFHFLQQAVRVVDLCAAPGSWSQVLS 60

Query: 61  RRLFEKDTENKGSKRIVSVDLQPMFPIENVTTIQADITHPKTLNKIMDLFDGEKADFVCS 120
           RRLF + ++N   ++IV+VDLQPM PI+NV T+QADITHPKTL  I +LF+G+KADF+CS
Sbjct: 61  RRLFPQSSDN-SDRKIVAVDLQPMSPIDNVITLQADITHPKTLQTITELFEGKKADFICS 119

Query: 121 DGAPDVTGLHDLDEYVQQQLILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQLSFLFE 180
           DGAPDVTGLHDLDEYVQQQLILSALQL+TCLLR+GG FVAKIFRGRDIDMLYSQL +LFE
Sbjct: 120 DGAPDVTGLHDLDEYVQQQLILSALQLSTCLLRKGGNFVAKIFRGRDIDMLYSQLGYLFE 179

Query: 181 RVVCAKPRSSRGTSLESFIVCLGYKPPKNWTPHLDVNMSVEDFFQGCDIGRLSLDDKLPD 240
           +V+CAKPRSSRGTSLESFIVCLGY PP NW P LDVN SVEDFFQGCDIG+L L+DK P+
Sbjct: 180 KVICAKPRSSRGTSLESFIVCLGYNPPANWEPKLDVNSSVEDFFQGCDIGKLRLEDKCPN 239

Query: 241 YHVQPRSVAEFISCGGLDSFDSDATYHDVPVDRVTLNPVQPPTNPPYKRALELKRKGKLT 300
           YH +PRS+A FI+CGGL SFDSDATYH V      L+PVQ PTNPPYK+ALELKR+GK+T
Sbjct: 240 YHEEPRSIATFIACGGLSSFDSDATYH-VDTSTPALDPVQSPTNPPYKKALELKRRGKMT 298

>YBR061C (TRM7) [252] chr2 complement(364747..365679)
           Methyltransferase that methylates 2-prime-O-riboses in
           tRNA anticodon loop, required for optimal protein
           synthesis activity, member of the 2-prime-O-RNA
           methyltransferase family which includes Spb1p, Mrm2p,
           and E. coli FtsJ protein [933 bp, 310 aa]
          Length = 310

 Score =  473 bits (1218), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 227/307 (73%), Positives = 265/307 (86%), Gaps = 7/307 (2%)

Query: 1   MGKSSKDKRDLYYRKAKEEGYRARSAFKLLQLDEQFHFLD--NVTRVVDLCAAPGSWSQV 58
           MGKSSKDKRDLYYRKAKE+GYRARSAFKLLQL++QFHFLD  N+ RVVDLCAAPGSWSQV
Sbjct: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLKRVVDLCAAPGSWSQV 60

Query: 59  LSRRLF-EKDTENKGSKRIVSVDLQPMFPIENVTTIQADITHPKTLNKIMDLFDGEKADF 117
           LSR+LF E  + +K  ++IVSVDLQPM PI +VTT+QADITHPKTL +I+ LF  EKADF
Sbjct: 61  LSRKLFDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNEKADF 120

Query: 118 VCSDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQLSF 177
           VCSDGAPDVTGLHDLDEYVQQQLI+SALQLT C+L++GG FVAKIFRGRDIDMLYSQL +
Sbjct: 121 VCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGY 180

Query: 178 LFERVVCAKPRSSRGTSLESFIVCLGYKPPKNWTPHLDVNMSVEDFFQGCDIGRLSLDDK 237
           LF+++VCAKPRSSRGTSLE+FIVCLGY PP NWTP LDVN SV++FFQGC + +L + DK
Sbjct: 181 LFDKIVCAKPRSSRGTSLEAFIVCLGYNPPSNWTPKLDVNTSVDEFFQGCFLNKLCISDK 240

Query: 238 LPDYHVQPRSVAEFISCGGLDSFDSDATYHDVPVDRV----TLNPVQPPTNPPYKRALEL 293
           L  ++ + R++AEF++CG L SFDSDATYHD+P        +L+PVQ PTNPPYK+ALEL
Sbjct: 241 LSHWNEEERNIAEFMACGSLQSFDSDATYHDLPSSVAGTSSSLDPVQSPTNPPYKKALEL 300

Query: 294 KRKGKLT 300
           KR GKLT
Sbjct: 301 KRSGKLT 307

>CAGL0H10252g complement(1002563..1003492) highly similar to
           sp|P38238 Saccharomyces cerevisiae YBR061c, start by
           similarity
          Length = 309

 Score =  465 bits (1196), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 222/306 (72%), Positives = 262/306 (85%), Gaps = 6/306 (1%)

Query: 1   MGKSSKDKRDLYYRKAKEEGYRARSAFKLLQLDEQFHFLDN--VTRVVDLCAAPGSWSQV 58
           MGKSSKDKRDLYYRKAKEEGYRARSA+KLLQL+E+FHFLD+  + RVVDLCAAPGSWSQV
Sbjct: 1   MGKSSKDKRDLYYRKAKEEGYRARSAYKLLQLNEEFHFLDDPELKRVVDLCAAPGSWSQV 60

Query: 59  LSRRLF-EKDTENKGS---KRIVSVDLQPMFPIENVTTIQADITHPKTLNKIMDLFDGEK 114
           LSR+LF E++    G    ++I++VDLQPM PI++V T+QADITHP+TL +I +LF  +K
Sbjct: 61  LSRKLFAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYELFGNQK 120

Query: 115 ADFVCSDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQ 174
           ADFVCSDGAPDVTGLHDLDEY+Q QLI+SALQLTTC+L+ GG FVAKIFRGRDIDMLYSQ
Sbjct: 121 ADFVCSDGAPDVTGLHDLDEYIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDIDMLYSQ 180

Query: 175 LSFLFERVVCAKPRSSRGTSLESFIVCLGYKPPKNWTPHLDVNMSVEDFFQGCDIGRLSL 234
           L +LFE++VCAKPRSSRGTSLE+FIVC+GY PP  W P LDVN SV +FF  CD+G+LS+
Sbjct: 181 LGYLFEKIVCAKPRSSRGTSLEAFIVCIGYNPPAGWEPKLDVNSSVTEFFATCDLGKLSI 240

Query: 235 DDKLPDYHVQPRSVAEFISCGGLDSFDSDATYHDVPVDRVTLNPVQPPTNPPYKRALELK 294
           DD L  +  QPRS+A+F++CG L S+DSDATYHD+P   V L+PVQ PTNPPYKRALELK
Sbjct: 241 DDTLQPWKDQPRSIADFMACGSLSSYDSDATYHDLPKYGVALDPVQAPTNPPYKRALELK 300

Query: 295 RKGKLT 300
           R GKLT
Sbjct: 301 RDGKLT 306

>Scas_718.46
          Length = 309

 Score =  459 bits (1181), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 220/306 (71%), Positives = 262/306 (85%), Gaps = 6/306 (1%)

Query: 1   MGKSSKDKRDLYYRKAKEEGYRARSAFKLLQLDEQFHFLD--NVTRVVDLCAAPGSWSQV 58
           MGK+SKDKRD+YYRKAKE+G+RARSAFKLLQL++ FHFLD  N+ RVVDLCAAPGSWSQV
Sbjct: 1   MGKNSKDKRDMYYRKAKEQGFRARSAFKLLQLNDDFHFLDDPNLKRVVDLCAAPGSWSQV 60

Query: 59  LSRRLFE-KDTENKGSKRIVSVDLQPMFPIENVTTIQADITHPKTLNKIMDLFDGEKADF 117
           LS++LF+ K  E    ++IV+VDLQPM PI +VTT+QADITHPKTL +I+DLF  EKADF
Sbjct: 61  LSQKLFDGKTAEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGNEKADF 120

Query: 118 VCSDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQLSF 177
           VCSDGAPDVTGLHDLDEYVQQQLI+SALQLT C+L++GG+FVAKIFRGRDIDMLYSQL +
Sbjct: 121 VCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGIFVAKIFRGRDIDMLYSQLGY 180

Query: 178 LFERVVCAKPRSSRGTSLESFIVCLGYKPPKNWTPHLDVNMSVEDFFQGCDIGRLSLDDK 237
           LF++VVCAKP+SSRGTSLE+FIVC+GY PP +W   LDVN SVE+FF GC + +LS+ DK
Sbjct: 181 LFDKVVCAKPKSSRGTSLEAFIVCIGYNPPSDWVSTLDVNSSVEEFFSGCHMSKLSIHDK 240

Query: 238 LPDYHVQPRSVAEFISCGGLDSFDSDATYH--DVPVD-RVTLNPVQPPTNPPYKRALELK 294
           LP +    R++A+F+SCG L+SFDSDATYH  D   D   +L+PVQ PTNPPYK+ALELK
Sbjct: 241 LPSWQEDERTIAKFMSCGNLESFDSDATYHLDDFKEDLNTSLDPVQSPTNPPYKKALELK 300

Query: 295 RKGKLT 300
           R GKLT
Sbjct: 301 RSGKLT 306

>AGR036W [4346] [Homologous to ScYBR061C - SH]
           complement(774279..775199) [921 bp, 306 aa]
          Length = 306

 Score =  436 bits (1121), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 224/304 (73%), Positives = 249/304 (81%), Gaps = 7/304 (2%)

Query: 1   MGKSSKDKRDLYYRKAKEEGYRARSAFKLLQLDEQFHFLDNVTRVVDLCAAPGSWSQVLS 60
           MGKSSKDKRDLYYRKAKE+G+RARSAFKLLQL+++FHFLD V RVVDLCAAPGSWSQVLS
Sbjct: 1   MGKSSKDKRDLYYRKAKEQGFRARSAFKLLQLNDEFHFLDGVQRVVDLCAAPGSWSQVLS 60

Query: 61  RRLFEKDTENKGSKRIVSVDLQPMFPIENVTTIQADITHPKTLNKIMDLFDGEKADFVCS 120
           R LF      K  KRIV+VDLQPM  IE+VTT+QADITHP+TL KI++LF GEKADFVCS
Sbjct: 61  RELFPDGKNTK--KRIVAVDLQPMSRIEHVTTLQADITHPRTLTKIIELFKGEKADFVCS 118

Query: 121 DGAPDVTGLHDLDEYVQQQLILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQLSFLFE 180
           DGAPDVTGLHDLDEYVQQQLILSAL+LT  LL  GG FVAKIFRGRDIDMLYSQL  LF+
Sbjct: 119 DGAPDVTGLHDLDEYVQQQLILSALKLTVSLLAPGGCFVAKIFRGRDIDMLYSQLGLLFD 178

Query: 181 RVVCAKPRSSRGTSLESFIVCLGYKPPKNWTPHLDVNMSV----EDFFQGCDIGR-LSLD 235
           +V CAKPRSSRGTSLESFIVC GY PP +W P+++ N+SV    E+FFQ   I + L+  
Sbjct: 179 KVTCAKPRSSRGTSLESFIVCQGYTPPLSWAPNIEKNVSVEEFFEEFFQNWSIQQPLTPG 238

Query: 236 DKLPDYHVQPRSVAEFISCGGLDSFDSDATYHDVPVDRVTLNPVQPPTNPPYKRALELKR 295
             LP Y    R +A FISCGGLDSFDSDATYHD+P     L+PVQ PTNPPYKRALELKR
Sbjct: 239 RPLPMYSEGHRGIAPFISCGGLDSFDSDATYHDLPKSATALDPVQSPTNPPYKRALELKR 298

Query: 296 KGKL 299
            GKL
Sbjct: 299 SGKL 302

>YCL054W (SPB1) [493] chr3 (31449..33974) Putative
           S-adenosyl-methionine-dependent methyltransferase
           required for synthesis of the 60S ribosomal subunit,
           member of the 2-prime-O-RNA methyltransferase family,
           which includes Trm7p, Mrm2p, and E. coli FtsJ protein
           [2526 bp, 841 aa]
          Length = 841

 Score =  167 bits (424), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 101/247 (40%), Positives = 141/247 (57%), Gaps = 13/247 (5%)

Query: 3   KSSKDKRDLYYRKAKEEGYRARSAFKLLQLDEQF-HFLDNVTRVVDLCAAPGSWSQVLSR 61
           K+SK + D YY  AKE+GYRARS+FK++Q++E++ HFL+    V+DLCAAPGSW QV S+
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKYGHFLEKSKVVIDLCAAPGSWCQVASK 66

Query: 62  RLFEKDTENKGSKRIVSVDLQPMFPIENVTTIQADITHPKTLNKIMDLFDGEKADFVCSD 121
                      +  I+ VD+ PM P+ NV T Q+DIT     +K+       KAD V  D
Sbjct: 67  LC-------PVNSLIIGVDIVPMKPMPNVITFQSDITTEDCRSKLRGYMKTWKADTVLHD 119

Query: 122 GAPDVTGLHDLDEYVQQQLILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQLSFLFER 181
           GAP+V      D + Q QL L AL+L    L   G FV KIFR +D + L      LFE+
Sbjct: 120 GAPNVGLGWVQDAFTQSQLTLQALKLAVENLVVNGTFVTKIFRSKDYNKLIWVFQQLFEK 179

Query: 182 VVCAKPRSSRGTSLESFIVCLGYKPPKNWTPHLDVNMSVEDFFQGCDIGRLSLDDKL--P 239
           V   KP +SR  S E F+VC G+K PK   P L   +  ++ F+    G+ +++ K+  P
Sbjct: 180 VEATKPPASRNVSAEIFVVCKGFKAPKRLDPRL---LDPKEVFEELPDGQQNMESKIYNP 236

Query: 240 DYHVQPR 246
           +  V+ R
Sbjct: 237 EKKVRKR 243

>Kwal_33.13054
          Length = 830

 Score =  166 bits (421), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 95/213 (44%), Positives = 124/213 (58%), Gaps = 8/213 (3%)

Query: 3   KSSKDKRDLYYRKAKEEGYRARSAFKLLQLDEQF-HFLDNVTRVVDLCAAPGSWSQVLSR 61
           K+SK + D YY  AKE+GYRARS+FK++Q++E+F HF++    V+DLCAAPGSW QV S 
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFMEKSKVVIDLCAAPGSWCQVASN 66

Query: 62  RLFEKDTENKGSKRIVSVDLQPMFPIENVTTIQADITHPKTLNKIMDLFDGEKADFVCSD 121
                      +  I+ VD+ PM P+ NV T Q+DIT     +K+       KAD V  D
Sbjct: 67  LC-------PVNSLIIGVDIVPMKPMPNVITFQSDITTEDCRSKLRGYMKTWKADTVLHD 119

Query: 122 GAPDVTGLHDLDEYVQQQLILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQLSFLFER 181
           GAP+V      D + Q  L L AL+L    L  GG FV KIFR +D + L    S LF++
Sbjct: 120 GAPNVGLGWAQDAFTQSHLTLQALKLAVENLVVGGTFVTKIFRSKDYNKLIWVFSQLFDK 179

Query: 182 VVCAKPRSSRGTSLESFIVCLGYKPPKNWTPHL 214
           V   KP +SR  S E F+VC G+K PK   P L
Sbjct: 180 VEATKPPASRNVSAEIFVVCKGFKAPKKLDPRL 212

>Scas_642.12
          Length = 839

 Score =  166 bits (421), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 100/247 (40%), Positives = 140/247 (56%), Gaps = 13/247 (5%)

Query: 3   KSSKDKRDLYYRKAKEEGYRARSAFKLLQLDEQF-HFLDNVTRVVDLCAAPGSWSQVLSR 61
           K+SK + D YY  AKE+GYRARS+FK++Q++E+F HFL+    V+DLCAAPGSW QV S+
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFLEKSKVVIDLCAAPGSWCQVASK 66

Query: 62  RLFEKDTENKGSKRIVSVDLQPMFPIENVTTIQADITHPKTLNKIMDLFDGEKADFVCSD 121
                      +  I+ VD+ PM P+ N  T Q+DIT     +K+       KAD V  D
Sbjct: 67  LC-------PVNSLIIGVDIVPMKPMNNCITFQSDITTEDCRSKLRGYMKTWKADTVLHD 119

Query: 122 GAPDVTGLHDLDEYVQQQLILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQLSFLFER 181
           GAP+V      D + Q QL L AL+L    L  GG FV K+FR +D + L      LF++
Sbjct: 120 GAPNVGLGWVQDAFTQSQLTLQALKLAAENLVVGGTFVTKVFRSKDYNKLIWVFQQLFDK 179

Query: 182 VVCAKPRSSRGTSLESFIVCLGYKPPKNWTPHLDVNMSVEDFFQGCDIGRLSLDDKL--P 239
           V   KP +SR  S E F+VC G+K PK   P L   +  ++ F+    G  +++ K+  P
Sbjct: 180 VEATKPPASRNVSAEIFVVCKGFKAPKRLDPRL---LDPKEVFEELPDGPQNMESKIYNP 236

Query: 240 DYHVQPR 246
           +  V+ R
Sbjct: 237 EKKVRKR 243

>AFR734C [3927] [Homologous to ScYCL054W (SPB1) - SH]
           (1785487..1788024) [2538 bp, 845 aa]
          Length = 845

 Score =  165 bits (418), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 127/214 (59%), Gaps = 10/214 (4%)

Query: 3   KSSKDKRDLYYRKAKEEGYRARSAFKLLQLDEQF-HFLDNVTRVVDLCAAPGSWSQVLSR 61
           K+SK + D YY  AKE+GYRARS+FK++Q++E+F HFL+    V+DLCAAPGSW QV S 
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFLEKSKVVIDLCAAPGSWCQVASN 66

Query: 62  RLFEKDTENKGSKRIVSVDLQPMFPIENVTTIQADITHPKTLNKIMDLFDGEKADFVCSD 121
                      +  I+ VD+ PM P+ NV T Q+DIT     +K+       KAD V  D
Sbjct: 67  LC-------PVNSLIIGVDIVPMQPMPNVITFQSDITTEDCRSKLRGYMKTWKADTVLHD 119

Query: 122 GAPDVTGLHDL-DEYVQQQLILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQLSFLFE 180
           GAP+V GL+ + D + Q  L L AL+L    L  GG FV KIFR +D + L      LF+
Sbjct: 120 GAPNV-GLNWVQDAFTQSHLTLQALKLAVENLVVGGTFVTKIFRSKDYNKLMWVFQQLFD 178

Query: 181 RVVCAKPRSSRGTSLESFIVCLGYKPPKNWTPHL 214
           +V   KP +SR  S E F+VC G+K PK   P L
Sbjct: 179 KVEATKPPASRNVSAEIFVVCKGFKAPKKLDPRL 212

>CAGL0B00484g 35991..38504 highly similar to sp|P25582 Saccharomyces
           cerevisiae YCL054w SPB1, start by similarity
          Length = 837

 Score =  165 bits (418), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 105/270 (38%), Positives = 146/270 (54%), Gaps = 19/270 (7%)

Query: 3   KSSKDKRDLYYRKAKEEGYRARSAFKLLQLDEQF-HFLDNVTRVVDLCAAPGSWSQVLSR 61
           K+SK + D YY  AKE+GYRARS+FK++Q++E+F HFL+    V+DLCAAPGSW QV S+
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFLEKSKVVIDLCAAPGSWCQVASK 66

Query: 62  RLFEKDTENKGSKRIVSVDLQPMFPIENVTTIQADITHPKTLNKIMDLFDGEKADFVCSD 121
                      +  I+ VD+ PM P+ NV T Q+DIT     +++       KAD V  D
Sbjct: 67  LC-------PVNSLIIGVDIVPMKPMPNVITFQSDITTEDCRSRLRGYMKTWKADTVLHD 119

Query: 122 GAPDVTGLHDLDEYVQQQLILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQLSFLFER 181
           GAP+V      D + Q  L L AL+L    L   G FV KIFR +D + L      LFE+
Sbjct: 120 GAPNVGLGWAQDAFTQSHLTLQALKLAVENLVVNGTFVTKIFRSKDYNKLIWVFQQLFEK 179

Query: 182 VVCAKPRSSRGTSLESFIVCLGYKPPKNWTPHLDVNMSVEDFFQGCDIGRLSLDDKL--P 239
           V   KP +SR  S E F+VC G+K PK   P L   +  ++ F+    G  +++ K+  P
Sbjct: 180 VEATKPPASRNVSAEIFVVCKGFKAPKKLDPRL---LDPKEVFEELPDGPQNMEAKIYNP 236

Query: 240 DYHVQPRSVAE------FISCGGLDSFDSD 263
           +  V+ R   E      +  C  LD   S+
Sbjct: 237 EKKVRKRQGYEEGDHLLYHECSVLDFVKSE 266

>Sklu_2421.10 YCL054W, Contig c2421 13526-16075 reverse complement
          Length = 849

 Score =  163 bits (413), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 109/297 (36%), Positives = 151/297 (50%), Gaps = 38/297 (12%)

Query: 3   KSSKDKRDLYYRKAKEEGYRARSAFKLLQLDEQF-HFLDNVTRVVDLCAAPGSWSQVLSR 61
           K+SK + D YY  AKE+GYRARS+FK++Q++E+F HFL+    V+DLCAAPGSW QV S 
Sbjct: 7   KNSKGRLDRYYFLAKEKGYRARSSFKIIQINEKFGHFLEKSKVVIDLCAAPGSWCQVASN 66

Query: 62  RLFEKDTENKGSKRIVSVDLQPMFPIENVTTIQADITHPKTLNKIMDLFDGEKADFVCSD 121
                      +  I+ VD+ PM  + NV T Q+DIT     +++       KAD V  D
Sbjct: 67  LC-------PVNSLIIGVDIVPMKSMPNVITFQSDITTEDCRSRLRGYMKTWKADTVLHD 119

Query: 122 GAPDVTGLHDLDEYVQQQLILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQLSFLFER 181
           GAP+V      D + Q  L L AL+L    L  GG FV K+FR +D + L      LFER
Sbjct: 120 GAPNVGLGWVQDAFTQSHLTLQALKLAVENLVVGGTFVTKVFRSKDYNKLIWLFQQLFER 179

Query: 182 VVCAKPRSSRGTSLESFIVCLGYKPPKNWTPHLDVNMSVEDFFQGCDIGRLSLDDKLPD- 240
           V   KP +SR  S E F+VC G+K PK   P L   +  ++ F+    G  +++ K+ + 
Sbjct: 180 VEATKPPASRNVSAEIFVVCKGFKAPKKLDPRL---LDPKEVFEELPDGPQNMEAKVYNP 236

Query: 241 -----------------YHVQPRSVAEFISC-------GGLDSFDSDATYHDVPVDR 273
                            YHV P  + EF+         G L+ F  D   H+  + R
Sbjct: 237 EKKTRKRDGYAEGDYLLYHVAP--IMEFVRTEDPITMLGELNKFTVDKEEHEWKIVR 291

>KLLA0C00737g 53188..55689 similar to sp|P25582 Saccharomyces
           cerevisiae YCL054w SPB1 required for ribosome synthesis,
           putative methylase, start by similarity
          Length = 833

 Score =  160 bits (406), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 93/213 (43%), Positives = 121/213 (56%), Gaps = 8/213 (3%)

Query: 3   KSSKDKRDLYYRKAKEEGYRARSAFKLLQLDEQF-HFLDNVTRVVDLCAAPGSWSQVLSR 61
           K+SK + D YY  AKE+GYRARS+FK++Q++E++ HFL+    V+DLCAAPGSW QV S 
Sbjct: 8   KNSKGRLDKYYYLAKEKGYRARSSFKIIQINEKYGHFLEKSKVVIDLCAAPGSWCQVASN 67

Query: 62  RLFEKDTENKGSKRIVSVDLQPMFPIENVTTIQADITHPKTLNKIMDLFDGEKADFVCSD 121
                      +  I+ VD+ PM  + NV T Q+DIT     +K+       KAD V  D
Sbjct: 68  LC-------PVNSLIIGVDIVPMKTMPNVITFQSDITTEDCRSKLRGYMKTWKADTVLHD 120

Query: 122 GAPDVTGLHDLDEYVQQQLILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQLSFLFER 181
           GAP+V      D + Q  L L AL+L    L  GG FV KIFR +D + L      LFE+
Sbjct: 121 GAPNVGLSWAQDAFTQSHLTLQALKLAVENLVVGGTFVTKIFRSKDYNKLIWVFQQLFEK 180

Query: 182 VVCAKPRSSRGTSLESFIVCLGYKPPKNWTPHL 214
           V   KP +SR  S E F+VC  +K PK   P L
Sbjct: 181 VEATKPPASRNVSAEIFVVCKNFKAPKKLDPRL 213

>KLLA0B01980g complement(173710..174579) similar to sp|P53123
           Saccharomyces cerevisiae YGL136c singleton, start by
           similarity
          Length = 289

 Score = 92.4 bits (228), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 70/250 (28%), Positives = 112/250 (44%), Gaps = 56/250 (22%)

Query: 5   SKDKRDLYYRKAKEEGYRARSAFKLLQLDEQFHFLDNVTRVVDLCAAPGSWSQVLSRRLF 64
           ++ K D + + AKE+ +R+R+AFKL+ +D+++ F     +V+DL  APG+WSQV  +R+ 
Sbjct: 35  ARQKNDHFTKAAKEQQFRSRAAFKLMDIDDKYRFFKQNQKVLDLGFAPGAWSQVARKRI- 93

Query: 65  EKDTENKGSKRIVSVDLQPMFPIENVTTIQADITHPKT-------------LNK------ 105
                      I+ VDL    P + V ++QA+I   KT             LNK      
Sbjct: 94  ------GSGGMIMGVDLLRCTPPKGVYSLQANILSKKTHELIRLCFARHIQLNKHDQLHK 147

Query: 106 ----IMDLFDGE--------------------------KADFVCSDGAPDVTGLHDLDEY 135
               +  + + E                            D V SD   + TG+   D Y
Sbjct: 148 DHGYLQHMLEEELNHLKETEEYKELFSQTDISQNIERYPVDVVLSDMMANTTGIQSKDHY 207

Query: 136 VQQQLILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQLSFLFERVVCAKPRSSRGTSL 195
           +   L  +AL +   LL+ GG F  K++ G +  +L  +L  +F++V   KP +SR  S 
Sbjct: 208 MSMDLCDAALIVAIDLLKPGGSFTCKLYAGSEDTLLEKRLKKVFKKVDRFKPNASRNESK 267

Query: 196 ESFIVCLGYK 205
           E + V  G K
Sbjct: 268 ELYFVARGKK 277

>CAGL0H08954g complement(875104..875949) similar to sp|P53123
           Saccharomyces cerevisiae YGL136c, hypothetical start
          Length = 281

 Score = 73.6 bits (179), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 62/242 (25%), Positives = 101/242 (41%), Gaps = 54/242 (22%)

Query: 6   KDKRDLYYRKAKEEGYRARSAFKLLQLDEQFHFLDNVT--RVVDLCAAPGSWSQVLSRRL 63
           + K+D Y R++K +  R+R+ FKL QLD+ +H        R++DL  APG+WSQV  +R 
Sbjct: 32  RQKQDFYTRESKLDNLRSRAGFKLAQLDDVYHVFHKSVPQRILDLGYAPGAWSQVARKRT 91

Query: 64  FEKDTENKGSKRIVSVDLQPMFPIENVTTIQADITHPKTLNKIMDLF------------- 110
                       ++ VD+ P  P   V+++QA+I   +T   I   F             
Sbjct: 92  HPDSI-------VLGVDILPCDPPFGVSSMQANILSKRTHQLIRQFFMEQIFMNDSQVES 144

Query: 111 ------DGEK-----ADFVCSDG-------APDVTGLHDLDEYVQQQ------------- 139
                 D E+      + + SD        +P +  L ++  Y                 
Sbjct: 145 MARNDSDTEQQPQFPVNIILSDMYEPFPQLSPSLNNLTNMPYYRMSNTSGLNFKDHLNSI 204

Query: 140 -LILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQLSFLFERVVCAKPRSSRGTSLESF 198
            L  +AL     LL   G F+ K F G +  +   ++  +F+RV   KP +SR  S E +
Sbjct: 205 DLCDAALITAVDLLEPAGSFICKQFSGAETSLFEKRMKKVFDRVEITKPSASRDESKEIY 264

Query: 199 IV 200
            +
Sbjct: 265 FI 266

>AFL117C [3078] [Homologous to ScYGL136C (MRM2) - SH]
           (218993..219904) [912 bp, 303 aa]
          Length = 303

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 61/98 (62%), Gaps = 7/98 (7%)

Query: 5   SKDKRDLYYRKAKEEGYRARSAFKLLQLDEQFHFLDNVTRVVDLCAAPGSWSQVLSRRLF 64
           S+ +RD Y R+AK +  R+R+AFKL+++DEQF       RV+DL  APG+WSQV  +R  
Sbjct: 32  SRQRRDPYTREAKVQELRSRAAFKLIEIDEQFRLFRAGQRVLDLGFAPGAWSQVAQQR-- 89

Query: 65  EKDTENKGSKRIVSVDLQPMFPIENVTTIQADITHPKT 102
              T+  G  +++ VD+ P  P   V++IQA+    KT
Sbjct: 90  ---TQPGG--KVMGVDVLPCKPPTGVSSIQANALSRKT 122

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 84/189 (44%), Gaps = 27/189 (14%)

Query: 23  ARSAFKLLQLDEQFHFLDNVTRVVDLCAAPGSWSQVLSRRLFEKDTENKGSKRIVSVDLQ 82
           +R   +L++L    HF  N+    +L    G +  +L  RL E   +N           Q
Sbjct: 119 SRKTHELVRLYFSRHFQLNMHD--ELHKKHGYFQHMLEERLEELQKDN---------SFQ 167

Query: 83  PMFPIENVTTIQADITHPKTLNKIM-DLFD------GEKADFVCSDGA--PDVTGLHDLD 133
           P++ +       AD  H   L+ ++ D+++      G   +F  +  +   + +G+   D
Sbjct: 168 PLYGM-------ADPVHEHPLDVVLSDMYEPWPQVTGFWNNFTNAAYSRMANTSGVAVKD 220

Query: 134 EYVQQQLILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQLSFLFERVVCAKPRSSRGT 193
            Y+   L  +AL     LLR GG FV K++ G++  +L  +L  +F +V   KP + R  
Sbjct: 221 HYMSMDLCDAALLCAIALLRPGGSFVCKLYTGKEDQLLERRLRKVFTKVRRFKPEACRSE 280

Query: 194 SLESFIVCL 202
           S E + V L
Sbjct: 281 SKELYFVGL 289

>Sklu_2160.2 YGL136C, Contig c2160 1404-2351
          Length = 315

 Score = 67.8 bits (164), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 65/107 (60%), Gaps = 10/107 (9%)

Query: 6   KDKRDLYYRKAKEEGYRARSAFKLLQLDEQFHFL--DNVTRVVDLCAAPGSWSQVLSRRL 63
           + + D Y ++AK +  R+R+AFKL++LD++F F   +   RV+DL  APG+WSQV   R 
Sbjct: 36  RQRNDFYTKEAKNQDLRSRAAFKLIELDDRFKFFLKNKSQRVLDLGFAPGAWSQVAFDR- 94

Query: 64  FEKDTENKGSKRIVSVDLQPMFPIENVTTIQADITHPKTLNKIMDLF 110
                  K +  ++ VD+ P  P   V++IQA+I   KT ++++ LF
Sbjct: 95  ------TKPNGMVLGVDILPCKPPRGVSSIQANILSRKT-HELIRLF 134

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 43/79 (54%)

Query: 125 DVTGLHDLDEYVQQQLILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQLSFLFERVVC 184
           + TG+   D Y+   L  +AL +   LLR GG F  K++ G++  +L  ++  +F +V  
Sbjct: 224 NTTGVAIKDHYMSMDLCDAALVVAIDLLRPGGSFACKVYTGKEDKLLEKRMKMVFSKVCR 283

Query: 185 AKPRSSRGTSLESFIVCLG 203
            KP SSR  S E + V LG
Sbjct: 284 FKPDSSRNESKELYFVGLG 302

>Scas_720.46
          Length = 321

 Score = 67.8 bits (164), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 56/95 (58%), Gaps = 9/95 (9%)

Query: 10  DLYYRKAKEEGYRARSAFKLLQLDEQFHFLD--NVTRVVDLCAAPGSWSQVLSRRLFEKD 67
           D Y R+AK   +R+R+AFKL ++D++FH  +   + RV+DL  APG+WSQV   R  ++ 
Sbjct: 42  DPYTREAKINNFRSRAAFKLTEIDDKFHIFNKSKIQRVLDLGFAPGAWSQVARERTSKES 101

Query: 68  TENKGSKRIVSVDLQPMFPIENVTTIQADITHPKT 102
                   I+ VD+ P  P   V+ IQA+I   KT
Sbjct: 102 M-------ILGVDILPCDPPHGVSAIQANILSKKT 129

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 41/81 (50%)

Query: 125 DVTGLHDLDEYVQQQLILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQLSFLFERVVC 184
           + +GL   D      L  +AL     LLR  G FV K+F G +  +   ++  +F++ + 
Sbjct: 230 NTSGLTVRDHQHSIDLCDAALVTALDLLRPKGSFVCKLFTGVEDKLFEKRVKMVFKKTIR 289

Query: 185 AKPRSSRGTSLESFIVCLGYK 205
            KP+SSR  S E +I+ +  K
Sbjct: 290 FKPKSSRNESKEVYIIGMDKK 310

>Kwal_56.24158
          Length = 307

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/137 (35%), Positives = 71/137 (51%), Gaps = 16/137 (11%)

Query: 6   KDKRDLYYRKAKEEGYRARSAFKLLQLDEQFHFLDNVTR--VVDLCAAPGSWSQVLSRRL 63
           + K D + R AK +G R+R+AFKL+Q+D++ H      R  V+DL  APG+WSQV   R 
Sbjct: 35  RQKNDSFTRDAKVQGLRSRAAFKLMQIDDKVHLFRKNARQNVLDLGYAPGAWSQVAFDR- 93

Query: 64  FEKDTENKGSKRIVSVDLQPMFPIENVTTIQADITHPKTLNKIMDLFDGEKADFVCSDGA 123
               T   G   I+ VD+ P  P   V++IQA+I   KT ++++ LF   +      D  
Sbjct: 94  ----TGPDGV--ILGVDILPCAPPRGVSSIQANILSRKT-HELIRLFFSRQFQLYYED-- 144

Query: 124 PDVTGLHDLDEYVQQQL 140
                LH  + Y Q  L
Sbjct: 145 ----RLHKDNGYFQHML 157

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 43/85 (50%)

Query: 121 DGAPDVTGLHDLDEYVQQQLILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQLSFLFE 180
           D   + +G+   D Y    L  +AL     LL+ GG FV K++ G++  +L ++L  +F 
Sbjct: 210 DRMANTSGVAIKDHYASMDLCDAALVAAIDLLKPGGSFVCKLYTGKEDRILENRLKQVFN 269

Query: 181 RVVCAKPRSSRGTSLESFIVCLGYK 205
            V   KP +SR  S E + V L  K
Sbjct: 270 EVQRFKPTASRDESKELYFVGLKKK 294

>YGL136C (MRM2) [1851] chr7 complement(252900..253862)
           Methyltransferase that methylates mitochondrial 21S rRNA
           at nucleotide U2791, member of the 2-prime-O-RNA
           methyltransferase family, which includes Trm7p, Spb1p,
           and E. coli FtsJ protein [963 bp, 320 aa]
          Length = 320

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 62/105 (59%), Gaps = 10/105 (9%)

Query: 9   RDLYYRKAKEEGYRARSAFKLLQLDEQFH-FLDNVT--RVVDLCAAPGSWSQVLSRRLFE 65
           +D Y ++AK +  R+R+AFKL+Q+D+++  F  N T  R++DL  APG+WSQV  +R   
Sbjct: 37  KDPYTKEAKVQNLRSRAAFKLMQIDDKYRLFSKNRTDQRILDLGYAPGAWSQVARQR--- 93

Query: 66  KDTENKGSKRIVSVDLQPMFPIENVTTIQADITHPKTLNKIMDLF 110
               +  +  I+ VD+ P  P   V +IQA+I   +T + I   F
Sbjct: 94  ----SSPNSMILGVDILPCEPPHGVNSIQANILAKRTHDLIRLFF 134

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 40/81 (49%)

Query: 125 DVTGLHDLDEYVQQQLILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQLSFLFERVVC 184
           + +G+   D Y    L  +AL     LLR  G FV K++ G + ++   ++  +F  V  
Sbjct: 228 NTSGVSIRDHYQSIDLCDAALVTAIDLLRPLGSFVCKLYTGEEENLFKKRMQAVFTNVHK 287

Query: 185 AKPRSSRGTSLESFIVCLGYK 205
            KP +SR  S E++ + L  K
Sbjct: 288 FKPDASRDESKETYYIGLKKK 308

>Sklu_2115.6 YGL156W, Contig c2115 5286-8525 reverse complement
          Length = 1079

 Score = 32.3 bits (72), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 38/87 (43%), Gaps = 19/87 (21%)

Query: 231 RLSLDDKL-PDYHVQPRSVAEFISCGG-----------------LDSFDSDATYHDVPVD 272
           R++LD +  P  H+    + +F   GG                 LD       ++ VP D
Sbjct: 5   RMNLDPQFKPVDHIYESRLQQFTDAGGDYRDLNLPHFYDKKRIPLDQDLVKVEWYQVPFD 64

Query: 273 RVTLNPVQPPTNPPYKRALELKRKGKL 299
           + T +PV P   P YK+ ++  RKG+L
Sbjct: 65  KNT-SPVSPEKRPSYKQVIDADRKGQL 90

>Scas_677.33
          Length = 1685

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 17/25 (68%), Gaps = 2/25 (8%)

Query: 206 PPK--NWTPHLDVNMSVEDFFQGCD 228
           PP+  NW PH+D+ + VE ++Q  D
Sbjct: 813 PPRRINWKPHIDIKLKVELYYQLLD 837

>YNL061W (NOP2) [4529] chr14 (510538..512394) Nucleolar protein
           required for pre-rRNA processing and 60S ribosome
           synthesis, has strong similarity to human
           proliferation-associated p120 nucleolar antigen [1857
           bp, 618 aa]
          Length = 618

 Score = 28.9 bits (63), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 56/137 (40%), Gaps = 31/137 (22%)

Query: 44  RVVDLCAAPGSWSQVLSRRL------FEKDTENKGSKRIVSVDLQPMFPIENVTTIQADI 97
           R++D+ AAPG  +  +S  +      F  D     +K +++     +  +    TI  + 
Sbjct: 348 RILDMAAAPGGKTTYISAMMKNTGCVFANDANKSRTKSLIA----NIHRLGCTNTIVCNY 403

Query: 98  THPKTLNKIMDLFDGEKADFVCSDGAPDVTGLHDLDE---------------YVQQQLIL 142
              +   K++  FD    D  CS      TG+   D+               ++Q+QL+L
Sbjct: 404 -DAREFPKVIGGFDRILLDAPCSG-----TGVIGKDQSVKVSRTEKDFIQIPHLQKQLLL 457

Query: 143 SALQLTTCLLREGGVFV 159
           SA+    C  + GGV V
Sbjct: 458 SAIDSVDCNSKHGGVIV 474

>YDR465C (RMT2) [1283] chr4 complement(1393324..1394562) Protein
           arginine methyltransferase, has similarity to human
           guanidinoacetate N-methyltransferase [1239 bp, 412 aa]
          Length = 412

 Score = 28.5 bits (62), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 63/145 (43%), Gaps = 16/145 (11%)

Query: 117 FVCSDGAPDVTGLHDLDEYVQQQ--LILSALQLTTC--LLREGGVFVAKIFRGRDIDMLY 172
           ++C +  PDV     +D + ++   +IL      T   LL +G VF   I+        Y
Sbjct: 268 YIC-EAHPDVLAKMKMDGWYEKDNVVILEGRWQDTLNNLLDKGEVFFDGIYYDT-FSEHY 325

Query: 173 SQLSFLFERVV-CAKPRSSRGTSLESFIVCLGYKPPKNWTPHLD-VNMSVEDFFQGCDIG 230
             +  L++ VV   KP       + SF   LG      +  + + V + V  +   CD  
Sbjct: 326 QDILDLYDVVVGLIKPEG-----VFSFFNGLGADRSLCYDVYKEIVEIDVATYGMKCDYT 380

Query: 231 RLSLDDKLPDYHVQPRSVAEFISCG 255
           R SLD++LPD++   RS   + +C 
Sbjct: 381 RYSLDEQLPDWNDVKRS---YFNCN 402

>Scas_694.23
          Length = 617

 Score = 28.5 bits (62), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 56/137 (40%), Gaps = 31/137 (22%)

Query: 44  RVVDLCAAPGSWSQVLSRRL------FEKDTENKGSKRIVSVDLQPMFPIENVTTIQADI 97
           R++D+ AAPG  +  +S  +      F  D     +K +++     +  +    TI  + 
Sbjct: 347 RILDMAAAPGGKTTYISAMMKNTGCVFANDANKNRTKSLIA----NIHRLGCTNTIVCNY 402

Query: 98  THPKTLNKIMDLFDGEKADFVCSDGAPDVTGLHDLDE---------------YVQQQLIL 142
              +   K++  FD    D  CS      TG+   D+               ++Q+QL+L
Sbjct: 403 D-AREFPKVIGGFDRILLDAPCSG-----TGVIGKDQSVKVSRTEKDFIQIPHLQKQLLL 456

Query: 143 SALQLTTCLLREGGVFV 159
           SA+    C  + GGV V
Sbjct: 457 SAIDSVDCNSKHGGVIV 473

>Kwal_23.2889
          Length = 679

 Score = 28.1 bits (61), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 39/95 (41%), Gaps = 6/95 (6%)

Query: 87  IENVTTIQADITHPKTLNKIMDLFDGEKA------DFVCSDGAPDVTGLHDLDEYVQQQL 140
           I++V  +      PK    +   FDG+KA      D   + GA    G+   +E V+  +
Sbjct: 375 IDDVVLVGGSTRIPKVQTLLEAFFDGKKASKGINPDEAVAWGAAVQAGVLSGEESVEDIV 434

Query: 141 ILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQL 175
           +L    LT  +   GGV    I R   I    SQ+
Sbjct: 435 LLDVNALTLGIETTGGVMTPLIKRNTAIPTKKSQM 469

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.138    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,198,189
Number of extensions: 436707
Number of successful extensions: 1066
Number of sequences better than 10.0: 32
Number of HSP's gapped: 1021
Number of HSP's successfully gapped: 39
Length of query: 300
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 199
Effective length of database: 13,099,691
Effective search space: 2606838509
Effective search space used: 2606838509
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)