Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_27.1054159158329590.0
CAGL0K12012g59158126840.0
Sklu_2357.258858326770.0
Scas_661.2862158226730.0
YDR037W (KRS1)59158126690.0
AGR037C58958326340.0
KLLA0F18392g58858426050.0
CAGL0J10230g5434866652e-79
KLLA0F04796g5174866473e-77
Kwal_23.47175275046362e-75
Scas_633.285925026272e-73
AER362W5254715733e-66
YNL073W (MSK1)5764865753e-66
ADL039C5564822281e-19
CAGL0D06556g5534832202e-18
Sklu_2189.35584892183e-18
YLL018C (DPS1)5574832076e-17
Scas_347.35524832069e-17
KLLA0D03839g5554801952e-15
Kwal_27.122356502031632e-11
YHR019C (DED81)5544781585e-11
KLLA0A08426g5544741561e-10
Sklu_2265.35603381462e-09
Kwal_14.23034752581407e-09
Sklu_1963.16551421344e-08
KLLA0A11484g4743541301e-07
AEL020W5523381311e-07
Scas_700.66582771302e-07
Scas_607.145553391282e-07
AGR206C6511291283e-07
YPL104W (MSD1)6581311248e-07
KLLA0E24486g6452601176e-06
CAGL0A02112g5483391158e-06
CAGL0H05907g6591291104e-05
Kwal_0.375428295810.081
CAGL0L08030g467334810.11
CAGL0K07656g49764790.18
AFR516W49950770.26
Scas_707.1449950770.28
KLLA0F25234g49950770.29
Kwal_47.1799849950760.42
YFL022C (FRS2)50350740.60
Scas_717.11128081731.1
KLLA0C18612g2140113731.2
KLLA0C15851g75153721.2
KLLA0F08371g581176702.0
KLLA0F24200g65263692.5
Kwal_34.1598950629674.2
YCR024C492425674.2
Scas_628.2448732674.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10541
         (583 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10541                                                        1144   0.0  
CAGL0K12012g 1159164..1160939 highly similar to sp|P15180 Saccha...  1038   0.0  
Sklu_2357.2 YDR037W, Contig c2357 1101-2867                          1035   0.0  
Scas_661.28                                                          1034   0.0  
YDR037W (KRS1) [890] chr4 (525435..527210) Lysyl-tRNA synthetase...  1032   0.0  
AGR037C [4347] [Homologous to ScYDR037W (KRS1) - SH] (775332..77...  1019   0.0  
KLLA0F18392g 1693928..1695694 highly similar to sp|P15180 Saccha...  1008   0.0  
CAGL0J10230g complement(998449..1000080) similar to sp|P32048 Sa...   260   2e-79
KLLA0F04796g complement(466476..468029) similar to sp|P32048 Sac...   253   3e-77
Kwal_23.4717                                                          249   2e-75
Scas_633.28                                                           246   2e-73
AER362W [2863] [Homologous to ScYNL073W (MSK1) - SH] complement(...   225   3e-66
YNL073W (MSK1) [4517] chr14 (488385..490115) Lysyl-tRNA syntheta...   226   3e-66
ADL039C [1702] [Homologous to ScYLL018C (DPS1) - SH] (620628..62...    92   1e-19
CAGL0D06556g 623770..625431 highly similar to sp|P04802 Saccharo...    89   2e-18
Sklu_2189.3 YLL018C, Contig c2189 5672-7348 reverse complement         89   3e-18
YLL018C (DPS1) [3401] chr12 complement(109901..111574) Aspartyl-...    84   6e-17
Scas_347.3                                                             84   9e-17
KLLA0D03839g 324274..325941 highly similar to sp|P04802 Saccharo...    80   2e-15
Kwal_27.12235                                                          67   2e-11
YHR019C (DED81) [2305] chr8 complement(141886..143550) Asparagin...    65   5e-11
KLLA0A08426g complement(745048..746712) similar to sp|P38707 Sac...    65   1e-10
Sklu_2265.3 YHR019C, Contig c2265 4970-6652                            61   2e-09
Kwal_14.2303                                                           59   7e-09
Sklu_1963.1 YPL104W, Contig c1963 1525-3492 reverse complement         56   4e-08
KLLA0A11484g 992734..994158 similar to sp|P25345 Saccharomyces c...    55   1e-07
AEL020W [2486] [Homologous to ScYHR019C (DED81) - SH] complement...    55   1e-07
Scas_700.6                                                             55   2e-07
Scas_607.14                                                            54   2e-07
AGR206C [4517] [Homologous to ScYPL104W (MSD1) - SH] (1144536..1...    54   3e-07
YPL104W (MSD1) [5340] chr16 (355695..357671) Aspartyl-tRNA synth...    52   8e-07
KLLA0E24486g complement(2173560..2175497) similar to sp|P15179 S...    50   6e-06
CAGL0A02112g 216596..218242 highly similar to sp|P38707 Saccharo...    49   8e-06
CAGL0H05907g complement(579444..581423) similar to sp|P15179 Sac...    47   4e-05
Kwal_0.375                                                             36   0.081
CAGL0L08030g 875106..876509 similar to sp|P25345 Saccharomyces c...    36   0.11 
CAGL0K07656g 761388..762881 highly similar to sp|P15625 Saccharo...    35   0.18 
AFR516W [3708] [Homologous to ScYFL022C (FRS2) - SH] complement(...    34   0.26 
Scas_707.14                                                            34   0.28 
KLLA0F25234g complement(2349192..2350691) highly similar to sp|P...    34   0.29 
Kwal_47.17998                                                          34   0.42 
YFL022C (FRS2) [1661] chr6 complement(93497..95008) Phenylalanyl...    33   0.60 
Scas_717.11                                                            33   1.1  
KLLA0C18612g 1646511..1652933 similar to sp|P25655 Saccharomyces...    33   1.2  
KLLA0C15851g complement(1378324..1380579) some similarities with...    32   1.2  
KLLA0F08371g 779264..781009 no similarity, hypothetical start          32   2.0  
KLLA0F24200g 2257007..2258965 similar to sp|P53918 Saccharomyces...    31   2.5  
Kwal_34.15989                                                          30   4.2  
YCR024C (YCR024C) [558] chr3 complement(160739..162217) Asparagi...    30   4.2  
Scas_628.24                                                            30   4.7  

>Kwal_27.10541
          Length = 591

 Score = 1144 bits (2959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/583 (94%), Positives = 553/583 (94%)

Query: 1   MSQEEAVKSANDAIANLHLDEATGEMVSKSELXXXXXXXXXXXXXXXXXXXXXXXXXXXX 60
           MSQEEAVKSANDAIANLHLDEATGEMVSKSEL                            
Sbjct: 1   MSQEEAVKSANDAIANLHLDEATGEMVSKSELKKRAKQRQVEAKKAAKKASAQPKPEPKK 60

Query: 61  XXNDAFADLDPSQYFEARSRQIQELKKTQSPNPYPHKFHVSIGLSEFLQKYAHLQRGETL 120
             NDAFADLDPSQYFEARSRQIQELKKTQSPNPYPHKFHVSIGLSEFLQKYAHLQRGETL
Sbjct: 61  KANDAFADLDPSQYFEARSRQIQELKKTQSPNPYPHKFHVSIGLSEFLQKYAHLQRGETL 120

Query: 121 PEEKVSIAGRVHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYGSESAYEADHDLIKRGDI 180
           PEEKVSIAGRVHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYGSESAYEADHDLIKRGDI
Sbjct: 121 PEEKVSIAGRVHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYGSESAYEADHDLIKRGDI 180

Query: 181 IGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHILPADHFGFKDQETRYRKRYLDLIM 240
           IGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHILPADHFGFKDQETRYRKRYLDLIM
Sbjct: 181 IGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHILPADHFGFKDQETRYRKRYLDLIM 240

Query: 241 NKDARPRFITRSKIISYIRKFLDERNFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFM 300
           NKDARPRFITRSKIISYIRKFLDERNFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFM
Sbjct: 241 NKDARPRFITRSKIISYIRKFLDERNFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFM 300

Query: 301 RIAPELFLKELVVGGMERVYEIGRQFRNEGIDMTHNPEFTTCEFYQAFADVYDLMDMTEV 360
           RIAPELFLKELVVGGMERVYEIGRQFRNEGIDMTHNPEFTTCEFYQAFADVYDLMDMTEV
Sbjct: 301 RIAPELFLKELVVGGMERVYEIGRQFRNEGIDMTHNPEFTTCEFYQAFADVYDLMDMTEV 360

Query: 361 LFSEMVKEITGSYVIKYHPDPRDPAKELELNFARPWKRINMIEELEKRLNVKFPAGDELH 420
           LFSEMVKEITGSYVIKYHPDPRDPAKELELNFARPWKRINMIEELEKRLNVKFPAGDELH
Sbjct: 361 LFSEMVKEITGSYVIKYHPDPRDPAKELELNFARPWKRINMIEELEKRLNVKFPAGDELH 420

Query: 421 TAETGEFLKRVLKENNLECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKKS 480
           TAETGEFLKRVLKENNLECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKKS
Sbjct: 421 TAETGEFLKRVLKENNLECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKKS 480

Query: 481 RDIPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNA 540
           RDIPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNA
Sbjct: 481 RDIPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNA 540

Query: 541 LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDTQK 583
           LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDTQK
Sbjct: 541 LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDTQK 583

>CAGL0K12012g 1159164..1160939 highly similar to sp|P15180
           Saccharomyces cerevisiae YDR037w KRS1 lysyl-tRNA
           synthetase, start by similarity
          Length = 591

 Score = 1038 bits (2684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/581 (85%), Positives = 518/581 (89%)

Query: 1   MSQEEAVKSANDAIANLHLDEATGEMVSKSELXXXXXXXXXXXXXXXXXXXXXXXXXXXX 60
           MSQEEA K+A + +ANLHLDE TGEMVSKSEL                            
Sbjct: 1   MSQEEATKAATEGVANLHLDEVTGEMVSKSELKKRMKARQVEAKKAAKKASAQPKPEPKK 60

Query: 61  XXNDAFADLDPSQYFEARSRQIQELKKTQSPNPYPHKFHVSIGLSEFLQKYAHLQRGETL 120
             ND  ADLDPSQYFEARSRQI EL+KT SPNPYPHKF VSI   EFL KYAHL+RGETL
Sbjct: 61  KKNDLLADLDPSQYFEARSRQILELRKTHSPNPYPHKFQVSISNPEFLAKYAHLKRGETL 120

Query: 121 PEEKVSIAGRVHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYGSESAYEADHDLIKRGDI 180
           P E VSIAGR+HAKRESGSKLKFYVLHGDGVEVQ+MSQLQDY    AYE DHDLIKRGDI
Sbjct: 121 PNEIVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYADAEAYENDHDLIKRGDI 180

Query: 181 IGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHILPADHFGFKDQETRYRKRYLDLIM 240
           +GVEGYVGRTQPKKGGEGEISVFV RI+LLTPCLH+LPADHFGFKDQETRYRKRYLDLIM
Sbjct: 181 VGVEGYVGRTQPKKGGEGEISVFVKRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIM 240

Query: 241 NKDARPRFITRSKIISYIRKFLDERNFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFM 300
           NKD+R RFITRSKII YIRKFLD R+FIEVETPMMNVIAGGATAKPFVTHHNDL+MDMFM
Sbjct: 241 NKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMFM 300

Query: 301 RIAPELFLKELVVGGMERVYEIGRQFRNEGIDMTHNPEFTTCEFYQAFADVYDLMDMTEV 360
           RIAPELFLKELVVGGM+RVYEIGRQFRNEGIDMTHNPEFTTCEFYQA+ADVYDLMDMTE+
Sbjct: 301 RIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL 360

Query: 361 LFSEMVKEITGSYVIKYHPDPRDPAKELELNFARPWKRINMIEELEKRLNVKFPAGDELH 420
           LFSEMVKEI GSYVIKYHPDP +P KE+ELNFARPWKRINMIEELEKR NV FPAGD+LH
Sbjct: 361 LFSEMVKEINGSYVIKYHPDPNNPEKEMELNFARPWKRINMIEELEKRFNVTFPAGDQLH 420

Query: 421 TAETGEFLKRVLKENNLECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKKS 480
           T ETGEFL++VLK+NNLECPPP+TNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAK S
Sbjct: 421 TKETGEFLQKVLKDNNLECPPPITNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYS 480

Query: 481 RDIPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNA 540
           RD PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQL+DETFCNA
Sbjct: 481 RDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNA 540

Query: 541 LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDT 581
           LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPD 
Sbjct: 541 LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDV 581

>Sklu_2357.2 YDR037W, Contig c2357 1101-2867
          Length = 588

 Score = 1035 bits (2677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/583 (84%), Positives = 525/583 (90%), Gaps = 1/583 (0%)

Query: 1   MSQEEAVKSANDAIANLHLDEATGEMVSKSELXXXXXXXXXXXXXXXXXXXXXXXXXXXX 60
           MSQEEA K+A +++ANLHLDE TGE VSKSEL                            
Sbjct: 1   MSQEEATKAATESVANLHLDEVTGEKVSKSELKKRIKQRQIEAKKAAKKANAQPKPETKK 60

Query: 61  XXNDAFADLDPSQYFEARSRQIQELKKTQSPNPYPHKFHVSIGLSEFLQKYAHLQRGETL 120
              D FADLDPSQYFEARSRQIQEL+K+  PNPYPHKFHVSI L +FL+KY +L+RGETL
Sbjct: 61  KV-DTFADLDPSQYFEARSRQIQELRKSHLPNPYPHKFHVSISLPDFLKKYENLKRGETL 119

Query: 121 PEEKVSIAGRVHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYGSESAYEADHDLIKRGDI 180
           P EKVSIAGR+HAKRESGSKLKFYVLHGDGVEVQ+MSQLQDY SE AYE DH L+KRGDI
Sbjct: 120 PNEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDI 179

Query: 181 IGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHILPADHFGFKDQETRYRKRYLDLIM 240
           +GVEGYVGRTQPKKGGEGEISVFVSRI+LLTPCLH+LPADHFGFKDQETRYRKRYLDLIM
Sbjct: 180 VGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIM 239

Query: 241 NKDARPRFITRSKIISYIRKFLDERNFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFM 300
           NKDAR RFITRSKII++IRKFLDER+FIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFM
Sbjct: 240 NKDARSRFITRSKIITFIRKFLDERSFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFM 299

Query: 301 RIAPELFLKELVVGGMERVYEIGRQFRNEGIDMTHNPEFTTCEFYQAFADVYDLMDMTEV 360
           RIAPELFLK+LVVGGM+RVYEIGRQFRNEGIDMTHNPEFTTCEFYQA+ADVYDLMDMTE+
Sbjct: 300 RIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL 359

Query: 361 LFSEMVKEITGSYVIKYHPDPRDPAKELELNFARPWKRINMIEELEKRLNVKFPAGDELH 420
           LFSEMVKEITGSYVIKYHP+P++P  E+ELNFARPWKRINMIEELEKR NVKFPAGD+LH
Sbjct: 360 LFSEMVKEITGSYVIKYHPNPQNPELEMELNFARPWKRINMIEELEKRFNVKFPAGDQLH 419

Query: 421 TAETGEFLKRVLKENNLECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKKS 480
           TAETGEFLK +L EN +EC PPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAK S
Sbjct: 420 TAETGEFLKNILTENKMECTPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYS 479

Query: 481 RDIPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNA 540
           RD+PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDE QL+DETFCNA
Sbjct: 480 RDVPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEVQLIDETFCNA 539

Query: 541 LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDTQK 583
           LEYGLPPTGGWGCG+DRLAMFLTDSNTIREVLLFPTLKPD  K
Sbjct: 540 LEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFPTLKPDVLK 582

>Scas_661.28
          Length = 621

 Score = 1034 bits (2673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/582 (84%), Positives = 523/582 (89%), Gaps = 1/582 (0%)

Query: 1   MSQEEAVKSANDAIANLHLDEATGEMVSKSELXXXXXXXXXXXXXXXXXXXXXXXXXXXX 60
           MSQEEAV+   + +ANLHLDEATGEMVSKSEL                            
Sbjct: 31  MSQEEAVQKVAENVANLHLDEATGEMVSKSELKKRIKQRQVEAKKAAKKAAAQPKPESKK 90

Query: 61  XXN-DAFADLDPSQYFEARSRQIQELKKTQSPNPYPHKFHVSIGLSEFLQKYAHLQRGET 119
             N D FADLDPSQYFEARSRQIQEL+KTQSPNPYPHKF VSI   EFL+KYA+LQRGET
Sbjct: 91  KKNTDLFADLDPSQYFEARSRQIQELRKTQSPNPYPHKFKVSISNPEFLKKYAYLQRGET 150

Query: 120 LPEEKVSIAGRVHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYGSESAYEADHDLIKRGD 179
           LP EKV+IAGR+HAKRESGSKLKFYVLHGDGVEVQLMSQLQDY +E+ YE DHDL+KRGD
Sbjct: 151 LPNEKVAIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYNNEADYEKDHDLLKRGD 210

Query: 180 IIGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHILPADHFGFKDQETRYRKRYLDLI 239
           I+GVEGYVGRTQPKKGGEGEISVFVSRI+LLTPCLH+LPADHFGFKDQETRYRKRYLDLI
Sbjct: 211 IVGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLI 270

Query: 240 MNKDARPRFITRSKIISYIRKFLDERNFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMF 299
           MNKDAR RFI RS+II +IR+FLD+R FIEVETPMMNVIAGGATAKPFVTHHNDL+MDM+
Sbjct: 271 MNKDARGRFIKRSQIIRFIRRFLDQREFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMY 330

Query: 300 MRIAPELFLKELVVGGMERVYEIGRQFRNEGIDMTHNPEFTTCEFYQAFADVYDLMDMTE 359
           MRIAPELFLKELVVGGM+RVYEIGRQFRNEGIDMTHNPEFTTCEFYQA+ADVYDLMDMTE
Sbjct: 331 MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 390

Query: 360 VLFSEMVKEITGSYVIKYHPDPRDPAKELELNFARPWKRINMIEELEKRLNVKFPAGDEL 419
           ++FSEMVKEITGSY+IKYHPDP +P KE+ELNF RPWKR+NMIEELEKR NV FPAGD+L
Sbjct: 391 LMFSEMVKEITGSYIIKYHPDPNNPEKEMELNFTRPWKRMNMIEELEKRFNVTFPAGDQL 450

Query: 420 HTAETGEFLKRVLKENNLECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKK 479
           HTAETGEFLK+VL +N +ECPPPLTNARMLDKLVGELED CINPTFIFGHPQMMSPLAK 
Sbjct: 451 HTAETGEFLKKVLADNKMECPPPLTNARMLDKLVGELEDVCINPTFIFGHPQMMSPLAKY 510

Query: 480 SRDIPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCN 539
           SRD PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCN
Sbjct: 511 SRDTPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCN 570

Query: 540 ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDT 581
           ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPD 
Sbjct: 571 ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDV 612

>YDR037W (KRS1) [890] chr4 (525435..527210) Lysyl-tRNA synthetase,
           cytoplasmic [1776 bp, 591 aa]
          Length = 591

 Score = 1032 bits (2669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/581 (84%), Positives = 523/581 (90%), Gaps = 1/581 (0%)

Query: 1   MSQEEAVKSANDAIANLHLDEATGEMVSKSELXXXXXXXXXXXXXXXXXXXXXXXXXXXX 60
           MSQ++ VK+A + +ANLHLDEATGEMVSKSEL                            
Sbjct: 1   MSQQDNVKAAAEGVANLHLDEATGEMVSKSELKKRIKQRQVEAKKAAKKAAAQPKPASKK 60

Query: 61  XXNDAFADLDPSQYFEARSRQIQELKKTQSPNPYPHKFHVSIGLSEFLQKYAHLQRGETL 120
              D FADLDPSQYFE RSRQIQEL+KT  PNPYPHKFHVSI   EFL KYAHL++GETL
Sbjct: 61  K-TDLFADLDPSQYFETRSRQIQELRKTHEPNPYPHKFHVSISNPEFLAKYAHLKKGETL 119

Query: 121 PEEKVSIAGRVHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYGSESAYEADHDLIKRGDI 180
           PEEKVSIAGR+HAKRESGSKLKFYVLHGDGVEVQLMSQLQDY    +YE DHDL+KRGDI
Sbjct: 120 PEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYCDPDSYEKDHDLLKRGDI 179

Query: 181 IGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHILPADHFGFKDQETRYRKRYLDLIM 240
           +GVEGYVGRTQPKKGGEGE+SVFVSR+QLLTPCLH+LPADHFGFKDQETRYRKRYLDLIM
Sbjct: 180 VGVEGYVGRTQPKKGGEGEVSVFVSRVQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIM 239

Query: 241 NKDARPRFITRSKIISYIRKFLDERNFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFM 300
           NKDAR RFITRS+II YIR+FLD+R FIEVETPMMNVIAGGATAKPF+THHNDL+MDM+M
Sbjct: 240 NKDARNRFITRSEIIRYIRRFLDQRKFIEVETPMMNVIAGGATAKPFITHHNDLDMDMYM 299

Query: 301 RIAPELFLKELVVGGMERVYEIGRQFRNEGIDMTHNPEFTTCEFYQAFADVYDLMDMTEV 360
           RIAPELFLK+LVVGG++RVYEIGRQFRNEGIDMTHNPEFTTCEFYQA+ADVYDLMDMTE+
Sbjct: 300 RIAPELFLKQLVVGGLDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL 359

Query: 361 LFSEMVKEITGSYVIKYHPDPRDPAKELELNFARPWKRINMIEELEKRLNVKFPAGDELH 420
           +FSEMVKEITGSY+IKYHPDP DPAKELELNF+RPWKRINMIEELEK  NVKFP+GD+LH
Sbjct: 360 MFSEMVKEITGSYIIKYHPDPADPAKELELNFSRPWKRINMIEELEKVFNVKFPSGDQLH 419

Query: 421 TAETGEFLKRVLKENNLECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKKS 480
           TAETGEFLK++L +N LECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAK S
Sbjct: 420 TAETGEFLKKILVDNKLECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYS 479

Query: 481 RDIPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNA 540
           RD PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNA
Sbjct: 480 RDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNA 539

Query: 541 LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDT 581
           LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPD 
Sbjct: 540 LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDV 580

>AGR037C [4347] [Homologous to ScYDR037W (KRS1) - SH]
           (775332..777101) [1770 bp, 589 aa]
          Length = 589

 Score = 1019 bits (2634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/583 (82%), Positives = 520/583 (89%), Gaps = 1/583 (0%)

Query: 1   MSQEEAVKSANDAIANLHLDEATGEMVSKSELXXXXXXXXXXXXXXXXXXXXXXXXXXXX 60
           MS+E AV+   + +ANLHLDE TGEMVSKSEL                            
Sbjct: 1   MSEEAAVQQVAENVANLHLDEVTGEMVSKSELKKRIKQRQVEAKKAAKKATSKPKPEPKK 60

Query: 61  XXNDAFADLDPSQYFEARSRQIQELKKTQSPNPYPHKFHVSIGLSEFLQKYAHLQRGETL 120
              +  ADLDPS+YFEARSRQIQEL+KTQ PNPYPHKF+V+IGL  FL KYAHLQRGETL
Sbjct: 61  KVEN-MADLDPSKYFEARSRQIQELRKTQEPNPYPHKFNVTIGLPAFLNKYAHLQRGETL 119

Query: 121 PEEKVSIAGRVHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYGSESAYEADHDLIKRGDI 180
           PEE+VSIAGR+HAKRESGSKL+FYVLH DGVEVQ+MSQLQDY SE AYE DH L+KRGDI
Sbjct: 120 PEERVSIAGRIHAKRESGSKLRFYVLHADGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDI 179

Query: 181 IGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHILPADHFGFKDQETRYRKRYLDLIM 240
           +GVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLH+LPADHFGFKDQETRYRKRYLDLIM
Sbjct: 180 VGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIM 239

Query: 241 NKDARPRFITRSKIISYIRKFLDERNFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFM 300
           NKDAR RFITRSKII+YIRKFLD R+FIEVETPMMNVIAGGATAKPFVTHHNDL+M M+M
Sbjct: 240 NKDARGRFITRSKIITYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMQMYM 299

Query: 301 RIAPELFLKELVVGGMERVYEIGRQFRNEGIDMTHNPEFTTCEFYQAFADVYDLMDMTEV 360
           RIAPELFLK+LVVGGM+RVYEIGRQFRNEGIDMTHNPEFTTCEFYQA+ADVYDLMDMTE+
Sbjct: 300 RIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL 359

Query: 361 LFSEMVKEITGSYVIKYHPDPRDPAKELELNFARPWKRINMIEELEKRLNVKFPAGDELH 420
           LFSEMVKEITG Y IK+HPDP DP+KE ++NFARPWKRINMIEELEKR NV FPAGD+LH
Sbjct: 360 LFSEMVKEITGDYKIKFHPDPNDPSKEYDINFARPWKRINMIEELEKRFNVTFPAGDQLH 419

Query: 421 TAETGEFLKRVLKENNLECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKKS 480
           TAETGEFLK++L +N ++CPPPLTNARMLDKLVGELEDTCI+PTFIFGHPQMMSPLAK S
Sbjct: 420 TAETGEFLKKILSDNKMDCPPPLTNARMLDKLVGELEDTCIDPTFIFGHPQMMSPLAKHS 479

Query: 481 RDIPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNA 540
           RD PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQL+DETFCNA
Sbjct: 480 RDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNA 539

Query: 541 LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDTQK 583
           LEYGLPPTGGWGCG+DRLAMFLTDSNTIREVLLFPTLKPD  K
Sbjct: 540 LEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFPTLKPDVLK 582

>KLLA0F18392g 1693928..1695694 highly similar to sp|P15180
           Saccharomyces cerevisiae YDR037w KRS1 lysyl-tRNA
           synthetase, cytosolic, start by similarity
          Length = 588

 Score = 1008 bits (2605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/584 (83%), Positives = 516/584 (88%), Gaps = 1/584 (0%)

Query: 1   MSQEEAVKSANDAIANLHLDEATGEMVSKSELXXXXXXXXXXXXXXXXXXXXXXXXXXXX 60
           MSQ   V +A +A+AN+HLDE TGEMVSKSEL                            
Sbjct: 1   MSQPHEVAAATEAVANMHLDELTGEMVSKSELKKRIKQRQVEAKKAAKKATAKPTPEPKK 60

Query: 61  XXN-DAFADLDPSQYFEARSRQIQELKKTQSPNPYPHKFHVSIGLSEFLQKYAHLQRGET 119
             N DAFADLDPSQYFEARSRQI EL+KT SPNPYPHKF VS+ L EFL KYA+L+RGET
Sbjct: 61  KANTDAFADLDPSQYFEARSRQINELRKTHSPNPYPHKFQVSVTLPEFLSKYANLKRGET 120

Query: 120 LPEEKVSIAGRVHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYGSESAYEADHDLIKRGD 179
           LPEEKVSIAGR+HAKRESGSKLKFYVLHGDGVEVQ+MSQLQDY +ES+YE DH LIKRGD
Sbjct: 121 LPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHTESSYEDDHSLIKRGD 180

Query: 180 IIGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHILPADHFGFKDQETRYRKRYLDLI 239
           I+GVEGYVGRT PKKGGEGEISVFVSRIQLLTPCLH+LP DHFGFKDQE RYRKRYLDLI
Sbjct: 181 IVGVEGYVGRTSPKKGGEGEISVFVSRIQLLTPCLHMLPTDHFGFKDQELRYRKRYLDLI 240

Query: 240 MNKDARPRFITRSKIISYIRKFLDERNFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMF 299
           MNKDAR RFITRSKIISY+RKFLD RNFIEVETPMMNVIAGGATAKPFVTHHNDL+MDM+
Sbjct: 241 MNKDARNRFITRSKIISYVRKFLDTRNFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMY 300

Query: 300 MRIAPELFLKELVVGGMERVYEIGRQFRNEGIDMTHNPEFTTCEFYQAFADVYDLMDMTE 359
           MRIAPELFLKELVVGGM+RVYEIGRQFRNEGIDMTHNPEFTTCEFYQA+ADVYDLMDMTE
Sbjct: 301 MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 360

Query: 360 VLFSEMVKEITGSYVIKYHPDPRDPAKELELNFARPWKRINMIEELEKRLNVKFPAGDEL 419
           ++ SEMVKEITGSYVIKYHPDP D  KELELNF RPWKRINMIEELE R +V FPAGD+L
Sbjct: 361 IMISEMVKEITGSYVIKYHPDPNDETKELELNFTRPWKRINMIEELENRFHVTFPAGDQL 420

Query: 420 HTAETGEFLKRVLKENNLECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKK 479
           HTAETGEFLK+VLK+N ++C PPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAK 
Sbjct: 421 HTAETGEFLKKVLKDNKMDCAPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY 480

Query: 480 SRDIPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCN 539
           SRD PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQA QK QGDDEAQLVDETFCN
Sbjct: 481 SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQANQKAQGDDEAQLVDETFCN 540

Query: 540 ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDTQK 583
           ALEYGLPPTGGWGCGIDRLAMFL DSNTIREVLLFPTLKP+  K
Sbjct: 541 ALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLLFPTLKPEVVK 584

>CAGL0J10230g complement(998449..1000080) similar to sp|P32048
           Saccharomyces cerevisiae YNL073w MSK1, hypothetical
           start
          Length = 543

 Score =  260 bits (665), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 166/486 (34%), Positives = 271/486 (55%), Gaps = 20/486 (4%)

Query: 102 IGLSEFLQKYAHLQRGE-TLPEEKVSIAGRVHAKRESGSKLKFYVLHGDGVE-VQLMSQL 159
           + +  FL+KY      +     +K+S+ GR+ + R SG K+ F  L  DG+  +QL+   
Sbjct: 62  VSIDIFLKKYGSTSEDQLNKINQKISLCGRIKSIRFSGKKMAFIDLV-DGIHGIQLILNC 120

Query: 160 QDYGSESAYEADHDLIKRGDIIGVEGYVGRTQPKKGGEGEISVFVSRI-QLLTPCLHILP 218
           ++ G+ + +E++   +++GD +   G     +  K     IS+  + + ++L+     LP
Sbjct: 121 REIGNSATFESELSFLRKGDYVMTTGL---PRLSKSRMKNISLRCTDLPKILSVAQMPLP 177

Query: 219 ADHFGFKDQETRYRKRYLDLIMNKDARPRFITRSKIISYIRKFLDERNFIEVETPMMNVI 278
                  D       + +D  +N     R   RS I+  IR FL+ER+FIEVETP+++  
Sbjct: 178 PKLI---DTVKSNSNKVVDYQINGFQNIRI--RSSILKSIRNFLEERDFIEVETPILSSK 232

Query: 279 AGGATAKPFVTHHNDLNMDMFMRIAPELFLKELVVGGMERVYEIGRQFRNEGIDMTHNPE 338
           + GA AKPF++   D +  + +R+APEL+LK L++ G  +V+EIG+ FRNEGID +HNPE
Sbjct: 233 SNGAVAKPFMSSSKDFD-KLMLRVAPELWLKRLIISGCNKVFEIGKSFRNEGIDGSHNPE 291

Query: 339 FTTCEFYQAFADVYDLMDMTEVLFSEMVKEITGSYVIK-YHPDPRDPAKELELNFARPWK 397
           FTT EFYQ++  + DL+ + E LF +++ ++T +  IK Y P+     +++  +    +K
Sbjct: 292 FTTLEFYQSYLTMEDLIKLNEDLFKKIITDLTNNLTIKQYLPESLLELEDILKSNNWKFK 351

Query: 398 RINMIEELEKRLNVKFPAGDELHTAETGEFLKRVLKENNLECPPPLTNARMLDKLVGEL- 456
           R+  +  L K L V         + +  E + +  K          +++++L++L  EL 
Sbjct: 352 RVEFLPTLSKELGVDLSQVKIEDSKQLLEVIPQKYKGQFFGKSSSYSSSQILNRLCSELI 411

Query: 457 -EDTC--INPTFIFGHPQMMSPLAKKSRDIPGLCERFEVFVATKEICNAYTELNDPFDQR 513
            E  C   +PT I+ HP ++SPLAK + D     +RFE+F+  +E  NAY E N P  Q 
Sbjct: 412 EEKYCNSSHPTIIYHHPAVISPLAKSNPDDSRTTKRFELFIKGREYSNAYEEENCPQVQL 471

Query: 514 ARFEEQARQK-DQGD-DEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREV 571
            +FE+QAR K D GD D    +D+ + NA+++G+PP GG+G GIDRL M +T    I +V
Sbjct: 472 EKFEQQARMKEDYGDNDTLSSIDQEYINAMKWGMPPIGGFGLGIDRLCMLITGCQRIEQV 531

Query: 572 LLFPTL 577
           L F TL
Sbjct: 532 LPFGTL 537

>KLLA0F04796g complement(466476..468029) similar to sp|P32048
           Saccharomyces cerevisiae YNL073w MSK1 lysyl-tRNA
           synthetase, mitochondrial, hypothetical start
          Length = 517

 Score =  253 bits (647), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 168/486 (34%), Positives = 265/486 (54%), Gaps = 32/486 (6%)

Query: 101 SIGLSEFLQKYAHLQRGETLPEEKVSIAGRVHAKRESGSKLKFYVLHGDGVEVQLMSQLQ 160
           +I +S F+++Y  L+  +       ++ G++   R SG K+ F  L  D   +Q++  L 
Sbjct: 49  TIDVSRFIKEYDGLKVDDRSTTH--TLRGKITNMRFSGKKIGFINLLNDEKSLQVIVNLS 106

Query: 161 DYG-SESAYEADHDLIKRGDIIGVEGYVGRTQPKKGGEGEISVFV-SRIQLLTPCLHILP 218
           +   S   ++A     K GD I V G+ G +Q     +G +S+ V S +++L+P    +P
Sbjct: 107 NLPMSVGEFQAHMRKFKIGDHIQVTGFPGVSQK----QGTLSLKVNSELKMLSPAQIPIP 162

Query: 219 ADHFGFKDQETRYRKRYLDLIMNKDARPRFITRSKIISYIRKFLDERNFIEVETPMMNVI 278
                  D   R   + LD ++N         R  +   IR++L ++ FIEVETP+++  
Sbjct: 163 PKLL---DSSKRNSNKTLDYLVN--GTEAIYIRHLVTKRIREWLYKQEFIEVETPIISSK 217

Query: 279 AGGATAKPFVTHHNDLNMD--MFMRIAPELFLKELVVGGMERVYEIGRQFRNEGIDMTHN 336
           + GA AKPF+TH   ++ +    +RIAPEL+LK L +GGM +++EIG+ FRNEGID THN
Sbjct: 218 SNGANAKPFITHCTAIDKEQPFELRIAPELWLKRLCIGGMNKIFEIGKVFRNEGIDSTHN 277

Query: 337 PEFTTCEFYQAFADVYDLMDMTEVLFSEMVKEITGSYVIKYHPDPRDPAKELELNFARPW 396
           PEFTT EFYQ + ++  L++M+E L   + + I         P  ++   +++ N  + +
Sbjct: 278 PEFTTLEFYQCYINMEQLIEMSESLLIYVCQGID-------KPKAQELLDQIKANNGK-F 329

Query: 397 KRINMIEELEKRLNVKFPAGDELHTAETGEFLKRVLKENNLECP-PPLTNARMLDKLVGE 455
           KR+  +  L ++  + F   D        E LK  L++ N+      ++  ++LD+L G+
Sbjct: 330 KRLEFLPTLTQKTGIDFDNMD----LNNAELLKEKLRKANISISESSVSPQQILDELCGK 385

Query: 456 -LEDTC--INPTFIFGHPQMMSPLAKKSRDIPGLCERFEVFVATKEICNAYTELNDPFDQ 512
            +E  C  + PT I+ HP ++SPLAK   +   + +RFE+F+  KE  NAY E N P  Q
Sbjct: 386 YIESQCDTLLPTIIYHHPTVLSPLAKTDSNNVQITKRFEIFINRKEYMNAYEEENCPDLQ 445

Query: 513 RARFEEQARQKDQ-GDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREV 571
             +F  Q   K Q  DDE   VD  +  A++YG+PP GG+G GIDRL M L D+  I EV
Sbjct: 446 LEKFTNQLASKTQFKDDEMMAVDLPYVQAMKYGMPPIGGFGLGIDRLCMLLADTQRIEEV 505

Query: 572 LLFPTL 577
           L F TL
Sbjct: 506 LSFGTL 511

>Kwal_23.4717
          Length = 527

 Score =  249 bits (636), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 175/504 (34%), Positives = 268/504 (53%), Gaps = 44/504 (8%)

Query: 94  YPHKFHVS---IGLSEFLQKYAHLQRGETLPEEKVSIAGRVHAKRESGSKLKFYVLHGDG 150
           YP    +S     +SEF QKY  L   E  P+    +  R+ + R SG  + F  +    
Sbjct: 42  YPSLSKISPATTTVSEFKQKYQALH--EDQPQSSEVLRARIDSVRISGKNMCFVDVSNAR 99

Query: 151 VEVQLMSQLQDYGS---------ESAYEADHDLIKRGDIIGVEGYVGRTQPKKGGEGEIS 201
             VQL+       +         E  ++   DL + GD I   G+ G +Q     E  +S
Sbjct: 100 NSVQLILNYNVMKTAMPSSALTREQFFQHVQDL-RPGDHIQACGFPGLSQ----RERTLS 154

Query: 202 VFVSRI-QLLTPCLHILPADHFGFKDQETRYRKRYLDLIMNKDARPRFITRSKIISYIRK 260
           +  +++ ++L P L  +P       D   R   R LD ++N       + R ++ + IR+
Sbjct: 155 LKCTKLTEILAPALLAVPPK---LTDPAKRNTNRVLDYLVN--GHETLVVRHQVNTAIRE 209

Query: 261 FLDERNFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFMRIAPELFLKELVVGGMERVY 320
           FL+ R F+EVETP+++  A GA A+PF T     N ++ +R+APEL+LK LVV G+ RVY
Sbjct: 210 FLNMRGFLEVETPVLSSKANGAAAEPFSTRTKATNAELELRVAPELWLKRLVVAGVNRVY 269

Query: 321 EIGRQFRNEGIDMTHNPEFTTCEFYQAFADVYDLMDMTEVLFSEMVKEITGSYVIKYHPD 380
           E+G+ FRNEG+D THNPEFTT EFYQ++A + +L++++E L+  ++  +   +       
Sbjct: 270 ELGKVFRNEGVDATHNPEFTTLEFYQSYASMDELIELSEQLYLHVLNRVDNRFA------ 323

Query: 381 PRDPAKELELNFARPWKRINMIEELEKRLNVKFPAGDELHTAETGEFLKRVLKENNLECP 440
            R+   EL  N A  +KR+  +  L +   V F   D LH +   + + R L   N+   
Sbjct: 324 -RELKNELLAN-AGKFKRVEFLPTLLRETGVDFTQID-LHNS---DLISRALIAKNIHMD 377

Query: 441 PP-LTNARMLDKLVGELEDT--CIN--PTFIFGHPQMMSPLAKKSRDIPGL-CERFEVFV 494
               +  ++LD L G   +   C +  PT I+ HP +MSPLAK + D   L  +RFEVF+
Sbjct: 378 TTGKSPQQILDMLCGRFIENKYCTSSLPTVIYHHPTVMSPLAKGNPDDNMLTTKRFEVFI 437

Query: 495 ATKEICNAYTELNDPFDQRARFE-EQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGC 553
             KE  NAY E N P +Q  +FE +++ Q+  GD E+  VD ++  A+++G+PP GG+G 
Sbjct: 438 NGKEYINAYEEENCPQEQLQKFELQKSAQETYGDRESLAVDYSYVEAMKWGMPPIGGFGL 497

Query: 554 GIDRLAMFLTDSNTIREVLLFPTL 577
           GIDRL M LT +  I  VL F T+
Sbjct: 498 GIDRLCMLLTGNKRIERVLSFGTI 521

>Scas_633.28
          Length = 592

 Score =  246 bits (627), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 174/502 (34%), Positives = 270/502 (53%), Gaps = 35/502 (6%)

Query: 96  HKFHVSIGLSEFLQKY-AHLQR--GETLPEEKVSIAGRVHAKRESGSKLKFYVLHGDGVE 152
           H  +  I + +FL  +  + QR  GE   +  + + GR+   R SG K+ F  L      
Sbjct: 94  HDNYKQITVKKFLDTFEKNPQRLNGEDDYKSFLQLNGRIKNIRYSGKKIAFIDLFDSRYN 153

Query: 153 VQL-----MSQLQDYGSESAYEADHDLIKRGDIIGVEGYVGRTQPKKGGEGEISVFVSRI 207
           V++     +++L+   SE  ++    L+K+GD I   G  G ++ +      +S+  +++
Sbjct: 154 VKIQVILNLNKLKQETSEERFQEVVQLLKKGDYIKAFGIPGFSESRSHT---LSLKGTKL 210

Query: 208 Q-LLTPCLHILPADHFGFKDQETRYRKRYLDLIMNKDARPRFITRSKIISYIRKFLDERN 266
             LL+   + LP+     KD+    + R LD  +N       + RS II  +R FLD++ 
Sbjct: 211 PVLLSAAQYPLPSQ---LKDELKARKNRVLDYQVN--GVSSLLLRSNIIRLLRSFLDKQE 265

Query: 267 FIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFMRIAPELFLKELVVGGMERVYEIGRQF 326
           FIEVETP+++  + GA A+PF+T    LN ++ +RIAPEL+LK L++ G++RVYEIG+ F
Sbjct: 266 FIEVETPILSSKSNGANARPFITKSGSLNENLELRIAPELWLKRLIISGLDRVYEIGKVF 325

Query: 327 RNEGIDMTHNPEFTTCEFYQAFADVYDLMDMTEVLFSEMVK--EITGSYVIKYHPDPRDP 384
           RNEG+D THNPEFT  EFY+ +  + DL++ +E LF  ++   E+  S   +YH  P   
Sbjct: 326 RNEGVDSTHNPEFTLLEFYERYLSMTDLIEKSEDLFKHILVNLELKKS---EYHFSPAFD 382

Query: 385 AKELELNFARPWK--RINMIEELEKRLNVKFPAGDELHTAETGEFLKRVLKENNLECPPP 442
                L  A  WK  RI  +  L + LN+ F   D     +  E L    ++   E  PP
Sbjct: 383 NLYRTLEQAN-WKFRRIEFLPTLSQELNIDFSLIDLNDAEKLLESLPAHSRKELFENVPP 441

Query: 443 --LTNARMLDKLVGELEDT----CINPTFIFGHPQMMSPLAKKSRDIPGLCERFEVFVAT 496
             L++ ++L+KL     ++     I+PT IF HP+++SPLAK       + +RFE+F+  
Sbjct: 442 GELSSQQILNKLCSFYLESRYCDTIHPTIIFHHPRIISPLAKAHPSNQQITKRFEMFING 501

Query: 497 KEICNAYTELNDPFDQRARFEEQARQ----KDQGDDEAQLVDETFCNALEYGLPPTGGWG 552
           KE  NAY E N P  Q   F+ Q       K++ +DE    DE F NA++ G+PP GG+G
Sbjct: 502 KEYINAYEEENCPQLQEKNFQLQQFSKETIKNKENDELISPDEGFINAMKSGMPPVGGFG 561

Query: 553 CGIDRLAMFLTDSNTIREVLLF 574
            G+DRL M L +   I +VL F
Sbjct: 562 LGVDRLCMLLMNKGRIEDVLPF 583

>AER362W [2863] [Homologous to ScYNL073W (MSK1) - SH]
           complement(1309431..1311008) [1578 bp, 525 aa]
          Length = 525

 Score =  225 bits (573), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 154/471 (32%), Positives = 241/471 (51%), Gaps = 40/471 (8%)

Query: 121 PEEKVSIAGRVHAKRESGSKLKFYVLHGDGVEVQLM-------SQLQDYGSESAYEADHD 173
           PE    I G++   R  G  + F  L   G  +QLM       +QL    ++  ++    
Sbjct: 75  PERTYVINGQIRGIRVVGRSMCFVDLQQQGSALQLMVNHSLVRAQLV---AKRPFQNAIA 131

Query: 174 LIKRGDIIGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHILPADHFGFKDQETRYRK 233
            ++ GD +   G+ G ++ ++     +S+   ++  +     I         D+  R + 
Sbjct: 132 GLRLGDHVQPTGFPGLSKTER----TLSLKCRKVPRMLAAAQIAIPQRL--TDRVKRQQN 185

Query: 234 RYLDLIMNKDARPRFITRSKIISYIRKFLDERNFIEVETPMMNVIAGGATAKPFVTHHND 293
           R LD ++N      F  R K ++ +R +L+ R F+EVETPM++  + GA A PFVTH   
Sbjct: 186 RTLDYLVNGLKVLEF--RHKALTALRAYLNRRGFLEVETPMLSAKSSGANATPFVTHLRG 243

Query: 294 LNMDMF-MRIAPELFLKELVVGGMERVYEIGRQFRNEGIDMTHNPEFTTCEFYQAFADVY 352
            +     +RIAPEL+LK L VGG +RVYEIG+ FRNEGID THNPEFTT E YQ +A + 
Sbjct: 244 QDKQALELRIAPELWLKRLCVGGAQRVYEIGKVFRNEGIDATHNPEFTTLELYQCYAPLD 303

Query: 353 DLMDMTEVLFSEMVKEITGSYVIKYHPDPRDPAKELELNFARPWKRINMIEELEKRLNVK 412
           +L+++ +VL  ++   +         P  R    E+  N    ++R+  +  L +   V 
Sbjct: 304 ELLELAQVLLRDICVAVD-------TPVSRQLLAEMAQNGG-AFRRVEFLPTLSRETGVD 355

Query: 413 FPAGDELHTAETGEFLKRVLKENNLECPPPLTN-ARMLDKLVGE-LED---TCINPTFIF 467
           + A D   +      ++  L    ++ P  + +  ++L+KL  + +ED     + PT I 
Sbjct: 356 WAAVDLADSTA----IRVALSGAGIDVPESIVSPQQILNKLCADYIEDRYCQSLLPTAIL 411

Query: 468 GHPQMMSPLAKKSRDIPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQ-G 526
            HP +MSPLAK +  +     RFE+FV  +E+ NAY E N P +Q  + + Q R ++Q  
Sbjct: 412 HHPAVMSPLAKSAGLV---ANRFELFVCGRELINAYEEENCPQEQLKKMQLQQRHREQFH 468

Query: 527 DDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTL 577
           D E+  +D  +  A++YG+PP GG G GIDRL M L     I EVL F  L
Sbjct: 469 DQESMQIDHHYIEAMKYGMPPIGGLGLGIDRLCMLLLAKARIEEVLPFGCL 519

>YNL073W (MSK1) [4517] chr14 (488385..490115) Lysyl-tRNA synthetase,
           mitochondrial [1731 bp, 576 aa]
          Length = 576

 Score =  226 bits (575), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 159/486 (32%), Positives = 250/486 (51%), Gaps = 47/486 (9%)

Query: 121 PEEKVSIAGRVHAKRESGSKLKFYVLHG------DGVEVQLMSQLQDYGSESAYEADH-- 172
           P   +SI GR+ + R SG K+ F  L+       +  ++QL+      G  S  +A+   
Sbjct: 97  PNLLLSINGRIKSIRFSGQKIVFIDLYNGSSGLKNDTQLQLIVNYNKIGGSSEDKANFSE 156

Query: 173 --DLIKRGDIIGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHI-LPADHFGFKDQET 229
             + +K+GD I   GY G +Q +      +S+  +++ ++     + LP+      D+  
Sbjct: 157 YMNFLKKGDYIKALGYPGFSQSR---VKMLSLICNKLPIVLSVSQLPLPSR---LNDETK 210

Query: 230 RYRKRYLDLIMNKDARPRFITRSKIISYIRKFLDERNFIEVETPMMNVIAGGATAKPFVT 289
               R +D  +N       + R++II  +RKFLD+RNF+EVETP+++  + GA AKPF+T
Sbjct: 211 IKSNRVVDYQLN--GTQTLLVRARIIKLLRKFLDDRNFVEVETPILSSKSNGAMAKPFIT 268

Query: 290 HHNDLNMDMFMRIAPELFLKELVVGGMERVYEIGRQFRNEGIDMTHNPEFTTCEFYQAFA 349
              D +  + +RIAPEL+LK L++ G+++VYEIG+ FRNEGID THN EF+T EFY+ + 
Sbjct: 269 SSKDFD-HLELRIAPELWLKRLIISGLQKVYEIGKVFRNEGIDSTHNAEFSTLEFYETYM 327

Query: 350 DVYDLMDMTEVLFSEMVKEITGSYVIKYHPDPRDPA----KELELNFA-RPWK--RINMI 402
            + D++  TE LF  ++  +      K+  D R P      EL L  +   WK  ++  +
Sbjct: 328 SMDDIVTRTEDLFKFLITNLQ-----KFFQDTRLPVPKTFSELHLALSENNWKFRKVEFL 382

Query: 403 EELEKRLNVKFPAGDELHTAETGEFLKRVLKENNLECPPPLTNARMLDKL--VGELEDTC 460
             L K L +       L   +  E LK + K+   +  P   N   L  L  + +L D  
Sbjct: 383 PTLNKELGIDL-MNSGLDINKPSELLKALPKDIAKKYFPSADNTGQLSSLQILNKLSDVF 441

Query: 461 IN--------PTFIFGHPQMMSPLAKKSRDIPGLCERFEVFVATKEICNAYTELNDPFDQ 512
           +         PT I+  P ++SPLAK       + +RFEVF+  KE  NAY E N P  Q
Sbjct: 442 LEQRHCQSTLPTVIYHQPAILSPLAKTDPQNKQVTKRFEVFIKGKEYINAYEEENCPQLQ 501

Query: 513 RARFEEQARQKDQGDDEAQ----LVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTI 568
             +F +Q +  +   ++ +    ++D  +   ++YG+PP GG+G GIDRL M   D   I
Sbjct: 502 LQKFLQQKQINELTGNKTETLSPVIDYQYVETMKYGMPPVGGFGLGIDRLCMLFCDKKRI 561

Query: 569 REVLLF 574
            EVL F
Sbjct: 562 EEVLPF 567

>ADL039C [1702] [Homologous to ScYLL018C (DPS1) - SH]
           (620628..622298) [1671 bp, 556 aa]
          Length = 556

 Score = 92.4 bits (228), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 113/482 (23%), Positives = 193/482 (40%), Gaps = 68/482 (14%)

Query: 123 EKVSIAGRVHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYGSESAYEADHDLIKRG---- 178
           ++V +  RVH  R+ G+ L F +L      +Q + +    G+ S       ++K      
Sbjct: 106 KEVLLRSRVHTVRQQGATLAFLMLRQRSSLIQALVKANAEGTVS-----KQMVKWAGSLN 160

Query: 179 --DIIGVEGYVGRTQP--KKGGEGEISVFVSRIQLLTPCLHILP------------ADHF 222
              I+ V G V + +   K     +  + ++++  ++     LP            A+  
Sbjct: 161 LESIVLVRGVVRKVEEPVKSATVQDFEIQITQLHTISETPQQLPILIEDASRSEAEAEAA 220

Query: 223 GFK--DQETRYRKRYLDL--IMNKDARPRFITRSKIISYIRKFLDERNFIEVETPMMNVI 278
           G    + +TR   R +DL  + N+     F  ++ +    R+F   RNF E+ TP +   
Sbjct: 221 GLPVVNLDTRLDARVIDLRTVTNQAI---FRIKAGVCGLFREFFQSRNFTEIHTPKLLAS 277

Query: 279 AGGATAKPFVTHHNDLNMDMFMRIAPELFLKELVVGGMERVYEIGRQFRNEGIDM-THNP 337
                A  F   +     + ++  +P+ + ++L+    ERV+E+   FR E  +   H  
Sbjct: 278 PSEGGANVFEVKY--FKGNAYLAQSPQFYKQQLIAADFERVFEVAPVFRAENSNTHRHMT 335

Query: 338 EFTTCEFYQAFADVYDLMDMTEVLFSEMVKEITGSYVIKYHPDPRDPAKELELNFARPWK 397
           EFT  +   AF + Y           E+++ +   ++  +         EL+  FAR   
Sbjct: 336 EFTGVDLEMAFEEHY----------HEVIEVMGEMFMFVF--------TELKKRFAREIA 377

Query: 398 RINMIEELEKRLNVKFPAGDE---LHTAETGEFLKRVLKENNLECPPPLTNARMLDKLVG 454
           ++     +E+    KFPA  +   LH  E    L+   KE          N R L KLV 
Sbjct: 378 QVRKQYPVEE---FKFPADGKMVILHYKEGIAMLREAGKEIGDFDDLSTENERFLGKLVR 434

Query: 455 ELEDTCINPTFIFGHPQMMSPLAKKSRDI-PGLCERFEVFVATKEICNAYTELNDPFDQR 513
           E  DT       F  P  + P         P     ++ F+  +EI +    ++DP   R
Sbjct: 435 EKYDTDFYILDKF--PAELRPFYTMPDPADPRYSNSYDFFMRGEEIMSGAQRIHDPELLR 492

Query: 514 ARFEEQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLL 573
            R +    Q +    +A   D  +C+A  YG PP  G G G++R+ MF  D   IR   L
Sbjct: 493 ERMKHHGLQPE----DAGFKD--YCDAFTYGCPPHAGGGIGLERIVMFYLDLKNIRRATL 546

Query: 574 FP 575
           FP
Sbjct: 547 FP 548

>CAGL0D06556g 623770..625431 highly similar to sp|P04802
           Saccharomyces cerevisiae YLL018c DPS1, start by
           similarity
          Length = 553

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 116/483 (24%), Positives = 199/483 (41%), Gaps = 67/483 (13%)

Query: 122 EEKVSIAGRVHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYGSESAYEADHDLIKRG--- 178
           +++V    RVH  R+ G+ L F  L      +Q + +    G + +     +++K     
Sbjct: 101 DKEVLFRARVHNTRQQGATLAFLTLRQQSSLIQALVKADKAGEKIS----KNMVKWAGSL 156

Query: 179 ---DIIGVEGYVGRT-QPKKGGE-GEISVFVSRIQLLTPCLHILP------------ADH 221
               I+ V G V    +P K     ++ + V++I  ++     LP            A+ 
Sbjct: 157 NLESIVLVRGIVKVVDEPIKSATIQDLEIHVTQIHTISETPETLPILIEDASRSEAEAEA 216

Query: 222 FGFK--DQETRYRKRYLDL--IMNKDARPRFITRSKIISYIRKFLDERNFIEVETPMMNV 277
            G    + +TR   R +DL  + N+     F  +  + +  R+FL  + F+EV TP M  
Sbjct: 217 AGLPVVNLDTRLDNRVIDLRTVTNQAI---FRIQHGVCALFREFLANKKFVEVHTPKMLG 273

Query: 278 IAGGATAKPF-VTHHNDLNMDMFMRIAPELFLKELVVGGMERVYEIGRQFRNEGIDM-TH 335
            A    A  F VT+        ++  +P+   ++L+V   E+V+EIG  FR E  +   H
Sbjct: 274 AASEGGANVFEVTY---FKGKAYLAQSPQFNKQQLIVADFEKVFEIGPVFRAENSNTHRH 330

Query: 336 NPEFTTCEFYQAFADVY-DLMDMTEVLFSEMVKEITGSYVIKYHPDPRD-PAKELELNFA 393
             EFT  +   AF + Y +++D+   LF  +  E+   Y  +     +  P +E +L   
Sbjct: 331 MTEFTGLDMEMAFEEHYHEVLDVLSELFVFLFTELKKRYAKEIELVRKQYPVEEFKLPKD 390

Query: 394 RPWKRINMIEELEKRLNVKFPAGD-ELHTAETGEFLKRVLKENNLECPPPLTNARMLDKL 452
               RI   E ++         GD E  + E  +FL ++++E         T+  +LDK 
Sbjct: 391 GKMVRITYKEGIQMLKEAGKDIGDFEDLSTENEKFLGKLVREKYD------TDFYILDKF 444

Query: 453 VGELEDTCINPTFIFGHPQMMSPLAKKSRDIPGLCERFEVFVATKEICNAYTELNDPFDQ 512
             E     I P +    P+            P     ++ F+  +EI +    ++D    
Sbjct: 445 PLE-----IRPFYTMPDPE-----------DPRYSNSYDFFMRGEEILSGAQRIHD---H 485

Query: 513 RARFEEQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVL 572
           +   E   R K  G D      + +C+   YG PP  G G G++R+ MF  D   IR   
Sbjct: 486 KMLME---RMKVHGLDPEDPGLKDYCDGFSYGCPPHAGGGIGLERVVMFFLDLKNIRRAS 542

Query: 573 LFP 575
           LFP
Sbjct: 543 LFP 545

>Sklu_2189.3 YLL018C, Contig c2189 5672-7348 reverse complement
          Length = 558

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 117/489 (23%), Positives = 200/489 (40%), Gaps = 82/489 (16%)

Query: 123 EKVSIAGRVHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYGSESAYEADH-DLIKRGDII 181
           ++V    RVH  R+ G+ L F  L      +Q + +    G+ S         I    I+
Sbjct: 108 KEVVFRARVHNSRQQGATLNFLTLRQQAELIQALVKSNKEGTVSKQMVKWTSSINLESIV 167

Query: 182 GVEGYVGRTQP--KKGGEGEISVFVSRIQLLTPCLHILP------------ADHFGFK-- 225
            V G V + +   K      + + +++I  ++     +P            A+  G    
Sbjct: 168 LVHGIVRKVEEPIKSATVQNLEIHITKIFTISETPQQMPILLEDASRSEAEAEAAGLPVV 227

Query: 226 DQETRYRKRYLDL--IMNKDARPRFITRSKIISYIRKFLDERNFIEVETPMMNVIAGGAT 283
           + +TR   R +DL  + N+     F  +S +    R+FL  R+F E+ TP +        
Sbjct: 228 NLDTRLDARVIDLRTVTNQAI---FKIQSGVCELFREFLRNRDFTEIHTPKLLGSPSEGG 284

Query: 284 AKPF-VTHHNDLNMDMFMRIAPELFLKELVVGGMERVYEIGRQFRNEGIDM-THNPEFTT 341
           A  F VT+      + ++  +P+++ +EL+    ERV+E+G  FR E  +   H  EFT 
Sbjct: 285 ANVFEVTY---FKGNSYLAQSPQIYKQELIAADFERVFEVGPVFRAENSNTHRHMTEFTG 341

Query: 342 CEFYQAFADVYD-LMDMTEVLFSEMVKEITGSY------VIKYHPD-----PRDPAKELE 389
            +   AF + YD ++D+   LF  +  E+   Y      V K +P      P+D  K + 
Sbjct: 342 LDLEMAFEEHYDEVLDVLSELFVFIFTELKSRYSKEIALVRKQYPVEDFKLPKD-GKMVR 400

Query: 390 LNFARPWKRINMIEELEKRLNVKFPAGDELHTAETGEFLKRVLKENNLECPPPLTNARML 449
           L+F      I M+ E  K++       D+     T                    N ++L
Sbjct: 401 LHFK---DGIAMLREAGKQV-------DDFEDLST-------------------ENEKLL 431

Query: 450 DKLVGELEDT---CINPTFIFGHPQMMSPLAKKSRDIPGLCERFEVFVATKEICNAYTEL 506
            KLV E  DT    ++   +   P    P  + SR        ++ F+  +EI +    +
Sbjct: 432 GKLVREKYDTDFYILDKFPLAVRPFYTMPDPEDSR----YSNSYDFFMRGEEILSGAQRI 487

Query: 507 NDPFDQRARFEEQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSN 566
           +D        +E+ +  +   ++  L D  +C+A  YG PP  G G G++R+ MF  D  
Sbjct: 488 HDS----EFLKERMKVHELSPEDPGLKD--YCDAFTYGCPPHAGGGIGLERVVMFYLDLK 541

Query: 567 TIREVLLFP 575
            IR   LFP
Sbjct: 542 NIRRASLFP 550

>YLL018C (DPS1) [3401] chr12 complement(109901..111574)
           Aspartyl-tRNA synthetase, cytoplasmic [1674 bp, 557 aa]
          Length = 557

 Score = 84.3 bits (207), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 111/483 (22%), Positives = 201/483 (41%), Gaps = 68/483 (14%)

Query: 122 EEKVSIAGRVHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYGSESAYEADHDLIKRG--- 178
           +++V    RVH  R+ G+ L F  L      +Q + +    G+ S      +++K     
Sbjct: 106 DKEVLFRARVHNTRQQGATLAFLTLRQQASLIQGLVKANKEGTIS-----KNMVKWAGSL 160

Query: 179 ---DIIGVEGYVGRT-QPKKGGEGE-ISVFVSRIQLLTPCLHILP------------ADH 221
               I+ V G V +  +P K    + + + +++I  ++     LP            A+ 
Sbjct: 161 NLESIVLVRGIVKKVDEPIKSATVQNLEIHITKIYTISETPEALPILLEDASRSEAEAEA 220

Query: 222 FGFK--DQETRYRKRYLDL--IMNKDARPRFITRSKIISYIRKFLDERNFIEVETP-MMN 276
            G    + +TR   R +DL  + N+     F  ++ +    R++L  + F EV TP ++ 
Sbjct: 221 AGLPVVNLDTRLDYRVIDLRTVTNQAI---FRIQAGVCELFREYLATKKFTEVHTPKLLG 277

Query: 277 VIAGGATAKPFVTHHNDLNMDMFMRIAPELFLKELVVGGMERVYEIGRQFRNEGIDM-TH 335
             + G ++   VT+        ++  +P+   ++L+V   ERVYEIG  FR E  +   H
Sbjct: 278 APSEGGSSVFEVTY---FKGKAYLAQSPQFNKQQLIVADFERVYEIGPVFRAENSNTHRH 334

Query: 336 NPEFTTCEFYQAFADVY-DLMDMTEVLFSEMVKEITGSYVIKYHPDPRD-PAKELELNFA 393
             EFT  +   AF + Y +++D    LF  +  E+   +  +     +  P +E +L   
Sbjct: 335 MTEFTGLDMEMAFEEHYHEVLDTLSELFVFIFSELPKRFAHEIELVRKQYPVEEFKLPKD 394

Query: 394 RPWKRINMIEELEKRLNVKFPAGD-ELHTAETGEFLKRVLKENNLECPPPLTNARMLDKL 452
               R+   E +E         GD E  + E  +FL +++++         T+  +LDK 
Sbjct: 395 GKMVRLTYKEGIEMLRAAGKEIGDFEDLSTENEKFLGKLVRDKYD------TDFYILDKF 448

Query: 453 VGELEDTCINPTFIFGHPQMMSPLAKKSRDIPGLCERFEVFVATKEICNAYTELNDPFDQ 512
             E     I P +    P             P     ++ F+  +EI +    ++D    
Sbjct: 449 PLE-----IRPFYTMPDPAN-----------PKYSNSYDFFMRGEEILSGAQRIHD---- 488

Query: 513 RARFEEQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVL 572
            A  +E+ +      ++  L D  +C+   YG PP  G G G++R+ MF  D   IR   
Sbjct: 489 HALLQERMKAHGLSPEDPGLKD--YCDGFSYGCPPHAGGGIGLERVVMFYLDLKNIRRAS 546

Query: 573 LFP 575
           LFP
Sbjct: 547 LFP 549

>Scas_347.3
          Length = 552

 Score = 84.0 bits (206), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 113/483 (23%), Positives = 194/483 (40%), Gaps = 70/483 (14%)

Query: 123 EKVSIAGRVHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYGSESAYEADHDLIKRG---- 178
           ++V    RVH  R+ G+ L F         +Q + ++Q  GS S       ++K      
Sbjct: 102 KEVVFRARVHNTRQQGATLSFLTFRQQHDLIQGLVKVQKDGSVSK-----QMVKWAGSLN 156

Query: 179 --DIIGVEGYVGRTQP--KKGGEGEISVFVSRIQLLTPCLHILP------------ADHF 222
              I+ V+G V R +   K     ++ + ++ I  ++     LP            A+  
Sbjct: 157 LESIVVVKGIVKRVEEPIKSATVQDLEIHITDIHSISETPETLPILLEDASRSEAEAEAA 216

Query: 223 GFK--DQETRYRKRYLDL--IMNKDARPRFITRSKIISYIRKFLDERNFIEVETPMMNVI 278
           G    + +TR   R +DL  + N+     F  +S +    R++L    F EV TP +   
Sbjct: 217 GLPVVNLDTRLDARVIDLRTVTNQAI---FKIQSGVCQLFREYLSGLKFTEVHTPKLLGA 273

Query: 279 AGGATAKPFVTHHNDLNMDMFMRIAPELFLKELVVGGMERVYEIGRQFRNEGIDM-THNP 337
                A  F   +       ++  +P+   ++L+V   E+V+EIG  FR E  +   H  
Sbjct: 274 PSEGGASVFEVSY--FKGKAYLAQSPQFNKQQLIVADFEKVFEIGPVFRAENSNTHRHMT 331

Query: 338 EFTTCEFYQAFADVY-DLMDMTEVLFSEMVKEITGSYVIKYHPDPRDPAKELELNFARPW 396
           EFT  +   AF + Y +++D+   LF  +  E+   +           +KE+E+      
Sbjct: 332 EFTGLDMEMAFEEHYHEVLDVLSDLFVFIFTELKKRF-----------SKEIEI-----V 375

Query: 397 KRINMIEELEKRLNVKFPAGDEL---HTAETGEFLKRVLKENNLECPPPLTNARMLDKLV 453
           ++   +E+       K PA  ++      E  + LK   KE          N + L KLV
Sbjct: 376 RKQYPVEDF------KLPADGKMVRIQYKEGIQMLKDAGKEIGDFDDLSTENEKFLGKLV 429

Query: 454 GELEDTCINPTFIFGHPQMMSPL-AKKSRDIPGLCERFEVFVATKEICNAYTELNDPFDQ 512
            E  DT       F  P  + P       + P     ++ F+  +EI +    ++D    
Sbjct: 430 REKYDTDFYILDKF--PLAIRPFYTMPDAEDPRYSNSYDFFMRGEEILSGAQRIHD---- 483

Query: 513 RARFEEQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVL 572
            A  +E+ +      ++  L D  +C+   YG PP  G G G++R+ MF  D   IR   
Sbjct: 484 HALLQERMKVHGLSSEDPGLKD--YCDGFSYGCPPHAGGGIGLERVVMFFLDLKNIRRAS 541

Query: 573 LFP 575
           LFP
Sbjct: 542 LFP 544

>KLLA0D03839g 324274..325941 highly similar to sp|P04802
           Saccharomyces cerevisiae YLL018c DPS1 aspartyl-tRNA
           synthetase, cytosolic, start by similarity
          Length = 555

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 114/480 (23%), Positives = 197/480 (41%), Gaps = 66/480 (13%)

Query: 124 KVSIAGRVHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYGSESAYEADH-DLIKRGDIIG 182
           +V    RVH  R+ G+ L F  L      +Q + +    G+ S         I    I+ 
Sbjct: 106 EVVFRARVHNSRQQGATLAFLTLRQQAELIQGLVKANKEGTVSKQMVKWVGSINLESIVV 165

Query: 183 VEGYVGRTQP--KKGGEGEISVFVSRIQLLTPCLHILP------------ADHFGFK--D 226
           V G V + +   K      + V +++I  ++     LP            A+  G    +
Sbjct: 166 VHGIVKKVEEPIKSATVQNLEVHITKIYTISETPEQLPILIEDASRSEAEAEAAGLPVVN 225

Query: 227 QETRYRKRYLDL--IMNKDARPRFITRSKIISYIRKFLDERNFIEVETP-MMNVIAGGAT 283
            +TR   R +DL  + N+     F  +S + +  R+FL  + F EV TP ++   + G +
Sbjct: 226 LDTRLDSRVIDLRTVTNQAI---FRIQSGVCALFREFLTNKKFTEVHTPKLLGAPSEGGS 282

Query: 284 AKPFVTHHNDLNMDMFMRIAPELFLKELVVGGMERVYEIGRQFRNEGIDM-THNPEFTTC 342
               VT+    +   ++  +P+L+ ++L+    ERV+E+   FR E  +   H  EFT  
Sbjct: 283 NVFEVTYFKGKS---YLAQSPQLYKQQLIAADFERVFEVAPVFRAENSNTHRHMTEFTGL 339

Query: 343 EFYQAFADVYD-LMDMTEVLFSEMVKEITGSYVIKYHPDPRDPAKELELNFARPWKRINM 401
           +   AF + YD ++D    LF  +  ++   Y           AKE+ L      ++   
Sbjct: 340 DLEMAFEEHYDEVVDTLAELFVFIFSQLKTRY-----------AKEIAL-----VRKQYP 383

Query: 402 IEELE-----KRLNVKFPAGDELHTAETGEFLKRVLKENNLECPPPLTNARMLDKLVGEL 456
           +EE +     K + + F  G  L   E G   K V    +L       N ++L KLV + 
Sbjct: 384 VEEFKLPKDGKMVRIPFKEGIAL-LREAG---KDVDDFEDLST----ENEKLLGKLVRDK 435

Query: 457 EDTCINPTFIFGHPQMMSPL-AKKSRDIPGLCERFEVFVATKEICNAYTELNDPFDQRAR 515
            +T  +   +   P  + P       + P     ++ F+  +EI +    ++D       
Sbjct: 436 YET--DFYILDKFPLAIRPFYTMPDAEDPRYSNSYDFFMRGEEILSGAQRIHDA----DL 489

Query: 516 FEEQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
            +E+    +   ++  L D  +C A  YG PP  G G G++R+ MF  D   IR   LFP
Sbjct: 490 LKERMNAHEVHPEDPGLKD--YCEAFTYGCPPHAGGGIGLERVVMFYLDLKNIRRASLFP 547

>Kwal_27.12235
          Length = 650

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 96/203 (47%), Gaps = 15/203 (7%)

Query: 179 DIIGVEGYVGRTQPKKGGEG-EISVFVSRIQLLTPCLHILPADHFGFKDQETRY-RKRYL 236
           D++ +EG +   + K+     E  + +S+++ L       P+    FK+Q       RYL
Sbjct: 96  DVVQIEGQLSLKRAKQESSAPEYEIKLSKLRTLNKAGKK-PSQLLHFKEQGNYPPEHRYL 154

Query: 237 DLIMNKDARPRFIT----RSKIISYIRKFLDERNFIEVETPMMNVIAGGATAKPFVTHHN 292
            L +     P++ T    R +I +YIRK L+ + F E+ETP++         +  V   N
Sbjct: 155 QLRL-----PKYQTYLRKRHEIATYIRKHLNSKMFSEIETPILFKSTPEGAREFLVPARN 209

Query: 293 DL-NMDMFMRI--APELFLKELVVGGMERVYEIGRQFRNEGIDMTHNPEFTTCEFYQAFA 349
            L +   F  +  +P+ + + L+ GG+ R Y++ R FR+E +     PEFT  +   AFA
Sbjct: 210 KLSDKPTFYALPQSPQQYKQLLMAGGVSRYYQLARCFRDEDLRSDRQPEFTQVDLEMAFA 269

Query: 350 DVYDLMDMTEVLFSEMVKEITGS 372
               +MD+ E   +     ++ S
Sbjct: 270 SGSQVMDVVESTITNTWNSLSSS 292

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 49/111 (44%), Gaps = 9/111 (8%)

Query: 469 HPQMMSPLAKKSR--DIPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 524
           HP  M  L   S+    P LC  + ++  V   E+    T ++DP  Q   F+   +   
Sbjct: 514 HPFTMVQLKDLSKLSSNPLLCTGQHYDFVVNGTELGGGSTRIHDPELQNFIFKNILKI-- 571

Query: 525 QGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
               E + + E    A E G PP  G+  G DRL   +  ++ IR+V+ FP
Sbjct: 572 ---SEPEKLFEHLLTAFESGTPPHAGFAIGFDRLCAMICGTDNIRDVIAFP 619

>YHR019C (DED81) [2305] chr8 complement(141886..143550)
           Asparaginyl-tRNA synthetase, cytoplasmic [1665 bp, 554
           aa]
          Length = 554

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 115/478 (24%), Positives = 185/478 (38%), Gaps = 86/478 (17%)

Query: 123 EKVSIAGRVHAKRESGSKLKFYVLH-GDGV-------EVQLMSQLQDYGSESAYEADHDL 174
           ++V ++G +H  R S  K+ F VL  G G        ++ L  Q  D   ES       +
Sbjct: 130 QRVKVSGWIHRLR-SNKKVIFVVLRDGSGFIQCVLSGDLALAQQTLDLTLESTVTLYGTI 188

Query: 175 IKRGDIIGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHILPADHFGFKDQETRYRKR 234
           +K  +        G+T P   G  E++V    +  L P       D F  K  E      
Sbjct: 189 VKLPE--------GKTAP---GGVELNVDYYEVVGLAPG----GEDSFTNKIAEGSDPSL 233

Query: 235 YLD---LIMNKDARPRFI-TRSKIISYIRKFLDERNFIEVETPMM--NVIAGGATAKPFV 288
            LD   L +  DA    +  R+ ++  +R+  DE +  EV  P M    + GG+T    +
Sbjct: 234 LLDQRHLALRGDALSAVMKVRAALLKSVRRVYDEEHLTEVTPPCMVQTQVEGGST----L 289

Query: 289 THHNDLNMDMFMRIAPELFLKELVVGGMERVYEIGRQFRNEGIDM-THNPEFTTCEFYQA 347
              N    + ++  + +L+L E  +  +  VY I   FR E      H  E+T  E   A
Sbjct: 290 FKMNYYGEEAYLTQSSQLYL-ETCLASLGDVYTIQESFRAEKSHTRRHLSEYTHIEAELA 348

Query: 348 FADVYDLMDMTEVLFSEMVK-----EITGSYVIKYHPD---PRDPAKELELNFARPWKRI 399
           F    DL+   E L  + V+      I G  V + +P+   P+ P   L+   A  W   
Sbjct: 349 FLTFDDLLQHIETLIVKSVQYVLEDPIAGPLVKQLNPNFKAPKAPFMRLQYKDAITWLNE 408

Query: 400 NMIEELEKRLNVKFPAGDELHTAETGEFLKRVLKENNLECPPPLTNARMLDKLVGELEDT 459
           + I+  E      F  GD++  AE  E                            ++ DT
Sbjct: 409 HDIKNEEGE---DFKFGDDI--AEAAE---------------------------RKMTDT 436

Query: 460 CINPTFIFGHP-QMMSPLAKKSRDIPGLCERFEVFVA-TKEICNAYTELNDPFDQRARFE 517
              P F+   P ++ S   K+  D P + E  +V +    EI      ++D  +  A F+
Sbjct: 437 IGVPIFLTRFPVEIKSFYMKRCSDDPRVTESVDVLMPNVGEITGGSMRIDDMDELMAGFK 496

Query: 518 EQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
            +    D            F +  +YG  P GG+G G +R+  +L D  T+R+  L+P
Sbjct: 497 REGIDTD--------AYYWFIDQRKYGTCPHGGYGIGTERILAWLCDRFTVRDCSLYP 546

>KLLA0A08426g complement(745048..746712) similar to sp|P38707
           Saccharomyces cerevisiae YHR019c DED81
           asparaginyl-tRNA-synthetase, start by similarity
          Length = 554

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 107/474 (22%), Positives = 190/474 (40%), Gaps = 76/474 (16%)

Query: 122 EEKVSIAGRVHAKRESGSKLKFYVLHGDG-VEVQLMSQLQDYGSESAYEADHDLIKRGDI 180
           +++V ++G VH  R + S +   +  G G ++  L   L       +Y+  +  ++    
Sbjct: 129 DKRVKVSGWVHRLRNNKSVVFIILRDGTGFLQTVLTGDLA-----RSYQIVNLTLE--TT 181

Query: 181 IGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHILPADHFGFKD--QETRYRKRYLD- 237
           I + G +      K   G + +FV   +++ P     P+    F +  QE       LD 
Sbjct: 182 ITLYGTIKVVPESKSAPGGVELFVDYFEIVGPA----PSGENAFTNRVQENADPSILLDQ 237

Query: 238 ---LIMNKDARPRFITRSKIISYIRKFLDERNFIEVETPMM--NVIAGGATAKPFVTHHN 292
              ++  +        R+ ++  IR+  DE    EV  P M    + GG+T    +   +
Sbjct: 238 RHLMLRGETLSAVMKVRAALMKSIRRVYDEEGLTEVNPPCMVQTQVEGGST----LFKLD 293

Query: 293 DLNMDMFMRIAPELFLKELVVGGMERVYEIGRQFRNEGIDM-THNPEFTTCEFYQAFADV 351
               + F+  + +L+L E  +  +  VY I   FR E      H  E+T  E    F D 
Sbjct: 294 YYGEEAFLTQSSQLYL-ETCLAALGDVYCIQESFRAEKSHTRRHLSEYTHIEAELCFLDF 352

Query: 352 YDLMDMTEVLFSEMVK-----EITGSYVIKYHPD---PRDPAKELELNFARPWKRINMIE 403
            DL+   E + ++ ++      + G  V K +P+   P+ P K +E   A  W + + I+
Sbjct: 353 DDLLSHIERVITKTIQYVLEDPVAGPLVKKLNPNFQAPQLPFKRMEYKDAIEWLKEHGIK 412

Query: 404 ELEKRLNVKFPAGDELHTAETGEFLKRVLKENNLECPPPLTNARMLDKLVGELEDTCINP 463
             E +   +F  GD++  AE  E                            ++ DT   P
Sbjct: 413 NEEDK---EFQFGDDI--AEAAE---------------------------RKMTDTIGVP 440

Query: 464 TFIFGHP-QMMSPLAKKSRDIPGLCERFEVFVAT-KEICNAYTELNDPFDQRARFEEQAR 521
             +   P ++ S   K+  D   + E  +V + T  EI      ++D  +  A F     
Sbjct: 441 ILLTRFPLEIKSFYMKRCDDDKRVTESVDVLMPTVGEITGGSMRIDDTEELMAGF----- 495

Query: 522 QKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
            K +G D A      F +  +YG  P GG+G G +R+  +L D  T+R+  L+P
Sbjct: 496 -KREGIDPAPYY--WFIDQRKYGTCPHGGYGLGTERILAWLCDRFTVRDCSLYP 546

>Sklu_2265.3 YHR019C, Contig c2265 4970-6652
          Length = 560

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 82/338 (24%), Positives = 137/338 (40%), Gaps = 58/338 (17%)

Query: 251 RSKIISYIRKFLDERNFIEVETPMM--NVIAGGATAKPFVTHHNDLNMDMFMRIAPELFL 308
           R+ ++  IR+  +E    EV  P M    + GG+T    +   +    + ++  + +L+L
Sbjct: 260 RASLLRAIRRAYEEEQLTEVTPPCMVQTQVEGGST----LFKLDYYGEEAYLTQSSQLYL 315

Query: 309 KELVVGGMERVYEIGRQFRNEGIDMT-HNPEFTTCEFYQAFADVYDLMDMTEVLFSEMVK 367
            E  +  +  VY I   FR E      H  E+T  E    F D  DL+   E + ++ V+
Sbjct: 316 -ETCLASLGDVYCIQESFRAEKSHTRRHLSEYTHIEAELCFLDFDDLLSHIERVITKSVQ 374

Query: 368 -----EITGSYVIKYHPD---PRDPAKELELNFARPWKRINMIEELEKRLNVKFPAGDEL 419
                 I G  + + +PD   P+ P K LE   A  W + + I+  +     +F  GD++
Sbjct: 375 YVLEDPIAGPLIKQLNPDFQAPQLPFKRLEYKDAIEWLKEHGIKNEDGE---EFKFGDDI 431

Query: 420 HTAETGEFLKRVLKENNLECPPPLTNARMLDKLVGELEDTCINPTFIFGHP-QMMSPLAK 478
             AE  E                            ++ DT   P  +   P ++ S   K
Sbjct: 432 --AEAAE---------------------------RKMTDTIGVPILLTRFPVEIKSFYMK 462

Query: 479 KSRDIPGLCERFEVFVAT-KEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETF 537
           +  D P + E  +V + T  EI      ++   +  A F      K +G D A      F
Sbjct: 463 RCTDDPSVTESVDVLMPTVGEITGGSMRIDSIEELMAGF------KREGIDPAAYY--WF 514

Query: 538 CNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
            +   YG  P GG+G G +R+  +L D  T+R+  L+P
Sbjct: 515 IDQRRYGSCPHGGYGLGTERILAWLCDRFTVRDCSLYP 552

>Kwal_14.2303
          Length = 475

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 63/258 (24%), Positives = 110/258 (42%), Gaps = 24/258 (9%)

Query: 125 VSIAGRVHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYGSESAYEADHD-LIKRGDIIGV 183
           V +  RVH  R+ G+ L F  L      +Q + +    G+ S         I    I+ V
Sbjct: 121 VVLRARVHNSRQQGATLVFLTLRQQANLIQALVKSNAEGTISKQMVKWTGSISPESIVLV 180

Query: 184 EGYVGRTQP--KKGGEGEISVFVSRIQLLTPCLHILP------------ADHFGFK--DQ 227
            G V + +   K      + + +++I  ++     LP            A+  G    + 
Sbjct: 181 HGVVKKVEEPIKSATVQNLEIHITQIFTISEAPQQLPILIEDASRSDAEAEAAGLPVVNL 240

Query: 228 ETRYRKRYLDLIMNKDARPRFITRSKIISYIRKFLDERNFIEVETPMMNVIAGGATAKPF 287
           +TR   R +DL    + +  F  +S +    R+FL +R F+E+ TP +        A  F
Sbjct: 241 DTRLDARVIDLRTATN-QAIFRIQSGVCELFREFLTQRKFVEIHTPKLLGAPSEGGANVF 299

Query: 288 -VTHHNDLNMDMFMRIAPELFLKELVVGGMERVYEIGRQFRNEGIDM-THNPEFTTCEFY 345
            VT+    +   ++  +P+ + +EL+    ERV+E+   FR E  +   H  EFT  +  
Sbjct: 300 EVTYFKGKS---YLAQSPQFYKQELIAADFERVFEVAPVFRAENSNTHRHMTEFTGLDLE 356

Query: 346 QAFADVYD-LMDMTEVLF 362
            AF + YD ++D+   LF
Sbjct: 357 MAFEEHYDEVIDVLSDLF 374

>Sklu_1963.1 YPL104W, Contig c1963 1525-3492 reverse complement
          Length = 655

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 69/142 (48%), Gaps = 4/142 (2%)

Query: 234 RYLDLIMNKDARPRFITRSKIISYIRKFLDERNFIEVETPMM-NVIAGGATAKPFVTHHN 292
           RYL L + K  +    TR +    IRK LD   F EVETPM+      GA      T  +
Sbjct: 152 RYLQLRLPK-YQNFLRTRYEASKLIRKDLDTYRFTEVETPMLFKSTPEGAREFLVPTRRS 210

Query: 293 DLNMDMFMRI--APELFLKELVVGGMERVYEIGRQFRNEGIDMTHNPEFTTCEFYQAFAD 350
           +     F  +  +P+ + + L+  G+ R ++I R FR+E +     PEFT  +   AFA 
Sbjct: 211 ESKHPTFYALPQSPQQYKQLLMASGVHRYFQIARCFRDEDLRSDRQPEFTQVDLEMAFAS 270

Query: 351 VYDLMDMTEVLFSEMVKEITGS 372
             ++MD+ E + ++    ++ +
Sbjct: 271 GNEVMDVVEDMVTKAWSNLSSN 292

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 44/93 (47%), Gaps = 5/93 (5%)

Query: 483 IPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNALE 542
           I  L + +++ V+  E+    T ++DP  Q   F+E  +       + + +      A E
Sbjct: 537 ISCLGQHYDLVVSGVELGGGSTRIHDPELQNYIFKEILKIH-----QPERLFGHLLTAFE 591

Query: 543 YGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
            G PP  G+  G DR+   +  + +IR+V+ FP
Sbjct: 592 MGTPPHAGFAIGFDRMCAMMCGTESIRDVIAFP 624

>KLLA0A11484g 992734..994158 similar to sp|P25345 Saccharomyces
           cerevisiae YCR024c asn-tRNA synthetase, mitochondrial,
           start by similarity
          Length = 474

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 86/354 (24%), Positives = 148/354 (41%), Gaps = 49/354 (13%)

Query: 228 ETRYRKRYLDLIMNKDARPRFITRSKIISYIRKFLDERNFIEVETPMMNVIAGGATAKPF 287
           E ++R  YL  ++      RF  R K+ S + K LD  +F  V  P++  I      + F
Sbjct: 154 EFKHRTTYLSNLL------RF--RHKVESQLTKTLDGLDFTMVRPPILTSIDCEGAGEMF 205

Query: 288 VTHHNDLNMDMFMRIAPELFLKELVVGGMERVYEIGRQFRNEGIDMT-HNPEFTTCEFYQ 346
               +  +  + + ++ +L L E+++ G+ RVY +   FR E  D   H  EF   E   
Sbjct: 206 NLKQDHWDEIVNLTVSSQLHL-EVLMMGLGRVYCLQPCFRAEKSDTNRHLCEFWMLEVEA 264

Query: 347 AFADVYD-LMDMTEVLFSEMVKEITGSYVI-KYHPDPRD-PAKELELNFARPWKRINMIE 403
           +F D  + LMD+ E++   +V  ++ +  + KY P   +           + WKRI   +
Sbjct: 265 SFVDKNESLMDLVELMVKSVVLSLSETKDLPKYFPVGCNIDITSRWAKLLQDWKRITYTD 324

Query: 404 ELEKRLN--VKFPAGDELHTAETGEFLKRVLKENNLECPPPLTNARMLDKLVGELEDTCI 461
            +E  L+  VKF      H    G       K+ N E      + R L    G       
Sbjct: 325 AVEALLSSGVKFE-----HDLAWG-------KDLNSE------HERWLCDHFG------- 359

Query: 462 NPTFIFGHPQMMSPLAKKSRDIPGLCERFEV-FVATKEICNAYTELNDPFDQRARFEEQA 520
            P F+  +P+       K R      E F++ F    EI       +D +D     +++ 
Sbjct: 360 GPVFVTNYPRDCKAFYMKLRPDGTTVECFDLLFPEIGEIVGGSVREDD-YDT---LKQEI 415

Query: 521 RQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLF 574
            ++D   ++     + + N  + G  P GG+G GI+RL  +L  +  IR+ + F
Sbjct: 416 ERRDMASNQL----DWYLNLRKEGTVPHGGFGIGIERLVSYLYGNPNIRDSIPF 465

>AEL020W [2486] [Homologous to ScYHR019C (DED81) - SH]
           complement(598366..600024) [1659 bp, 552 aa]
          Length = 552

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 79/338 (23%), Positives = 133/338 (39%), Gaps = 56/338 (16%)

Query: 250 TRSKIISYIRKFLDERNFIEVETPMM--NVIAGGATAKPFVTHHNDLNMDMFMRIAPELF 307
            R+  +  IR+  ++   +EV  P M    + GG+T    +   +    + F+  + +L+
Sbjct: 251 VRAAFLRAIRRVYEDEGLLEVTPPCMVQTQVEGGST----LFKLDYYGEEAFLTQSSQLY 306

Query: 308 LKELVVGGMERVYEIGRQFRNEGIDMT-HNPEFTTCEFYQAFADVYDLMDMTEVLFSEMV 366
           L E  +  +  V+ I   FR E      H  E+T  E    F D   L+  TE + + +V
Sbjct: 307 L-ETCLPALGDVFCIQESFRAEKSHTRRHLSEYTHIEAELGFVDFDQLLRHTERVITSLV 365

Query: 367 K-----EITGSYVIKYHPD---PRDPAKELELNFARPWKRINMIEELEKRLNVKFPAGDE 418
           +      + G  V + +PD   P+ P   LE   A  W   + I+  E     +F  GD+
Sbjct: 366 RYVLEDPVAGPLVKQLNPDFVPPQMPFMRLEYKDAITWLNEHGIKNEEGE---EFKFGDD 422

Query: 419 LHTAETGEFLKRVLKENNLECPPPLTNARMLDKLVGELEDTCINPTFIFGHP-QMMSPLA 477
           +  AE  E                            ++ DT   P F+   P ++ S   
Sbjct: 423 I--AEAAER---------------------------KMTDTIGKPIFLTRFPLELKSFYM 453

Query: 478 KKSRDIPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETF 537
           K+  D P + E F+V + T       +   D  D     E  A  K +G +        F
Sbjct: 454 KRCADDPRVTESFDVLMPTVGEVTGGSMRIDSLD-----ELMAGFKREGVNPEPYY--WF 506

Query: 538 CNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
            +   YG  P GG+G G +R+  +L +   +R+  L+P
Sbjct: 507 SDQRRYGSCPHGGYGLGTERILAWLCNRYPVRDCSLYP 544

>Scas_700.6
          Length = 658

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/277 (24%), Positives = 116/277 (41%), Gaps = 29/277 (10%)

Query: 97  KFHVSIGLSEFLQKYAHLQRGETLPEEKVSIAGRVHAK-RESGSKLKFYVLH---GDGVE 152
           KFH S       Q Y     G  +     ++ G +  K +  G  L F  L    GD V 
Sbjct: 32  KFHFSKETKSIKQLYETQNTGSRV---TCTVNGWIDTKPKRIGKNLTFSQLRDVKGDTV- 87

Query: 153 VQLMSQLQDYGSESAYEADHDLIKRGDIIGVEGYVGRTQPKKGGEGE----ISVFVSRIQ 208
                QL D GS+         + R D+I V G + + + K     E      + V +I 
Sbjct: 88  -----QLVDSGSQLK------ALNREDVIQVNGTLMKKKEKSVSSAENIFEYEIQVEKIS 136

Query: 209 LLTPCLHILPADHFGFKDQETRYRKRYLDLIMNKDARPRFI-TRSKIISYIRKFLDERNF 267
           +L    +  P+    FK ++  Y   Y  L +       F+  R +I   +R+ L+E  F
Sbjct: 137 VLNSS-NEKPSQLHEFK-KDGNYPPEYRFLQLRHHKYQEFLRKRYQISCKLRQLLNEEEF 194

Query: 268 IEVETPMM-NVIAGGAT--AKPFVTHHNDLNMDMFMRIAPELFLKELVVGGMERVYEIGR 324
           +E+ETP++      GA     P  T  N       +  +P+ + + L+  G+ + +++ R
Sbjct: 195 LEIETPILFKPTPEGAREFLVPTRTKENSTPSFYSLTQSPQQYKQLLMASGVFKYFQVAR 254

Query: 325 QFRNEGIDMTHNPEFTTCEFYQAFADVYDLMDMTEVL 361
            FR+E +     PEFT  +   +F++  D+M + E L
Sbjct: 255 CFRDEDLRADRQPEFTQIDMEMSFSNGEDVMALLERL 291

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 51/111 (45%), Gaps = 9/111 (8%)

Query: 469 HPQMMSPLA--KKSRDIPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 524
           HP  M  L   +K    P  C  + +++ +   E+    T ++DP  Q   FE   + ++
Sbjct: 522 HPFTMVQLQDYEKLNSNPSQCRGQHYDLVINGVELGGGSTRVHDPILQDYIFENILKIEN 581

Query: 525 QGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
             +    L+      A E G PP  G+  G DR+   L+ + +IR+V+ FP
Sbjct: 582 AEELFGHLL-----RAFEMGTPPHAGFAIGFDRMCAMLSGTESIRDVIAFP 627

>Scas_607.14
          Length = 555

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 80/339 (23%), Positives = 138/339 (40%), Gaps = 58/339 (17%)

Query: 250 TRSKIISYIRKFLDERNFIEVETPMM--NVIAGGATAKPFVTHHNDLNMDMFMRIAPELF 307
            R+ ++  +R+  +E   +EV  P M    + GG+T    +   +    + F+  + +L+
Sbjct: 254 VRAALLRAVRRVYEEEGLLEVTPPCMVQTQVEGGST----LFKLDYYGEEAFLTQSSQLY 309

Query: 308 LKELVVGGMERVYEIGRQFRNEGIDM-THNPEFTTCEFYQAFADVYDLMDMTEVLFSEMV 366
           L E  +  +  V+ +   FR E      H  E+T  E   AF    +L++  E L  + V
Sbjct: 310 L-ETCLPALGDVFCVQESFRAEKSHTRRHLSEYTHIEAELAFLTFEELLEHIETLIVKSV 368

Query: 367 K-----EITGSYVIKYHPD---PRDPAKELELNFARPWKRINMIEELEKRLNVKFPAGDE 418
           +      + G  V + HP    P+ P   LE   A  W + + I+  E   + KF  GD+
Sbjct: 369 QYVMEDPVAGPIVNQLHPHFVPPKGPFMRLEYKDAITWLQEHNIKN-EDGEDFKF--GDD 425

Query: 419 LHTAETGEFLKRVLKENNLECPPPLTNARMLDKLVGELEDTCINPTFIFGHP-QMMSPLA 477
           +  AE  E                            ++ DT   P  +   P ++ S   
Sbjct: 426 I--AEAAE---------------------------RKMTDTLNVPILLTRFPVEIKSFYM 456

Query: 478 KKSRDIPGLCERFEVFVAT-KEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDET 536
            K +D P + E  +V + T  EI      ++D  +  A F      K +G D        
Sbjct: 457 PKCKDDPRVTESVDVLMPTVGEITGGSMRISDIDELMAGF------KREGIDPKPYY--W 508

Query: 537 FCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
           F +  +YG  P GG+G G +R+  +L +  T+R+  L+P
Sbjct: 509 FIDQRKYGTCPHGGYGLGTERILAWLCNRFTVRDCSLYP 547

>AGR206C [4517] [Homologous to ScYPL104W (MSD1) - SH]
           (1144536..1146491) [1956 bp, 651 aa]
          Length = 651

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 60/129 (46%), Gaps = 3/129 (2%)

Query: 247 RFITRSKIISYIRKFLDERNFIEVETPMM-NVIAGGATAKPFVTHHNDLNMDMFMRI--A 303
           R   R      +R  L++  F+EVETP++      GA      T H      +F  +  +
Sbjct: 164 RMKMRHNASKTVRASLEKLGFMEVETPLLFKSTPEGAREFLVPTRHKQGKDPLFYALPQS 223

Query: 304 PELFLKELVVGGMERVYEIGRQFRNEGIDMTHNPEFTTCEFYQAFADVYDLMDMTEVLFS 363
           P+ + + L+ GG+ + Y++ R FR+E +     PEFT  +   AFA+  D+M + E    
Sbjct: 224 PQQYKQLLMAGGVSKYYQLARCFRDEDLRSDRQPEFTQVDLEMAFANGDDVMRVVESTVL 283

Query: 364 EMVKEITGS 372
               E+  S
Sbjct: 284 NTWNEVALS 292

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 41/90 (45%), Gaps = 5/90 (5%)

Query: 486 LCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNALEYGL 545
           L + ++  V   E+    T ++DP  QR  F +  +  ++      L++     A   G 
Sbjct: 534 LGQHYDFVVNGVELGGGSTRVHDPVLQRYIFNQILKINNEDQVFGHLLE-----AFSMGT 588

Query: 546 PPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
           PP  G+  G DR+   +    +IR+V+ FP
Sbjct: 589 PPHAGFAIGFDRMVAMMCAKESIRDVIAFP 618

>YPL104W (MSD1) [5340] chr16 (355695..357671) Aspartyl-tRNA
           synthetase, mitochondrial [1977 bp, 658 aa]
          Length = 658

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 64/131 (48%), Gaps = 7/131 (5%)

Query: 234 RYLDLIMNKDARPRFITRSKIISYIRKFLDERNFIEVETPMMNVIAGGATAKPFV----T 289
           RYL L  N   +     RS I   IR   +  +F EVETPM+   A    A+ F+    T
Sbjct: 152 RYLQL-RNPKYQDFLKKRSSISKEIRNSFNNFDFTEVETPML-FKATPEGAREFLVPTRT 209

Query: 290 HHNDLNMDMF-MRIAPELFLKELVVGGMERVYEIGRQFRNEGIDMTHNPEFTTCEFYQAF 348
             +D     + +  +P+ + + L+  G+ + Y++ R FR+E +     PEFT  +   AF
Sbjct: 210 KRSDGKPSFYALDQSPQQYKQLLMASGVNKYYQMARCFRDEDLRADRQPEFTQVDMEMAF 269

Query: 349 ADVYDLMDMTE 359
           A+  D+M + E
Sbjct: 270 ANSEDVMKIIE 280

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 50/111 (45%), Gaps = 9/111 (8%)

Query: 469 HPQMMSPLA--KKSRDIPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 524
           HP  M  L   +K    P  C    +++ V   E+    T ++DP  Q   FE+  +   
Sbjct: 520 HPFTMVKLKDYEKLEKTPEKCLGRHYDLVVNGVELGGGSTRIHDPRLQDYIFEDILKI-- 577

Query: 525 QGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
              D A  +     NA + G PP  G+  G DR+   + ++ +IR+V+ FP
Sbjct: 578 ---DNAYELFGHLLNAFDMGTPPHAGFAIGFDRMCAMICETESIRDVIAFP 625

>KLLA0E24486g complement(2173560..2175497) similar to sp|P15179
           Saccharomyces cerevisiae YPL104w MSD1 aspartate--tRNA
           ligase, mitochondrial, start by similarity
          Length = 645

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 114/260 (43%), Gaps = 25/260 (9%)

Query: 124 KVSIAGRVHAK-RESGSKLKFYVLHG-DGVEVQLMSQLQDYGSESAYEADHDLIKRGDII 181
           KV + G + AK ++ G  L F  L   +G ++QL+   Q +  ES  E   D+++   II
Sbjct: 46  KVVLNGWIDAKPKKVGKNLIFGTLRDPNGEKIQLVDS-QSFLKESQVE---DVVQ---II 98

Query: 182 GVEGYVGRTQPKKGGEGEISVFVSRIQLLTPC------LHILPADHFGFKDQETRYRKRY 235
           G      +TQ +     E  + +  +Q L         L  L AD   F  +      RY
Sbjct: 99  GELSEKKQTQ-QSTVNIEYELKIIELQKLNQANKKPSQLQDLKADDGAFPPE-----YRY 152

Query: 236 LDLIMNKDARPRFITRSKIISYIRKFLDERNFIEVETPMMNVIAGGATAKPFVTHHNDLN 295
           L L + K  +     R +    +R  LD  NF EVETP++         +  V     ++
Sbjct: 153 LQLRLPK-YQNNLKLRYEASKNVRTVLDSLNFTEVETPLLFKSTPEGAREFLVPTRGKID 211

Query: 296 MDM-FMRI--APELFLKELVVGGMERVYEIGRQFRNEGIDMTHNPEFTTCEFYQAFADVY 352
            +  F  +  +P+ + + L+  G+ R +++ R FR+E +     PEFT  +   AF+   
Sbjct: 212 GEASFYALPQSPQQYKQLLIASGVNRYFQVARCFRDEDLRSDRQPEFTQVDLEMAFSSGK 271

Query: 353 DLMDMTEVLFSEMVKEITGS 372
           D+ ++ E + +    ++  S
Sbjct: 272 DVREVVEKVITSTWNKLHAS 291

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 42/88 (47%), Gaps = 5/88 (5%)

Query: 488 ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNALEYGLPP 547
           E +++ V   E+    T ++DP  Q   F E    K+  D    L+     NA + G PP
Sbjct: 534 EHYDLVVNGVELGGGSTRIHDPELQNYIFHEILNIKNPEDLFGHLL-----NAFKMGTPP 588

Query: 548 TGGWGCGIDRLAMFLTDSNTIREVLLFP 575
             G+  G DR+   L  S +IR+V+ FP
Sbjct: 589 HAGFAIGFDRMCAMLCGSESIRDVIAFP 616

>CAGL0A02112g 216596..218242 highly similar to sp|P38707
           Saccharomyces cerevisiae YHR019c DED81
           asparaginyl-tRNA-synthetase, hypothetical start
          Length = 548

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 77/339 (22%), Positives = 136/339 (40%), Gaps = 58/339 (17%)

Query: 250 TRSKIISYIRKFLDERNFIEVETPMM--NVIAGGATAKPFVTHHNDLNMDMFMRIAPELF 307
            R+ ++  IR+   E +  EV  P M    + GG+T    +   +      ++  + +L+
Sbjct: 247 VRAALMKSIRRVYTEESLTEVTPPCMVQTQVEGGST----LFKLDYYGEQAYLTQSSQLY 302

Query: 308 LKELVVGGMERVYEIGRQFRNEGIDMT-HNPEFTTCEFYQAFADVYDLMDMTEVLFSEMV 366
           L E  +  +  VY +   FR E      H  E+T  E   AF    +L+D  E +  + V
Sbjct: 303 L-ETCLPSLGDVYCVQESFRAEKSHTRRHLSEYTHIEAELAFLTFEELLDHIERVLCKTV 361

Query: 367 K-----EITGSYVIKYHPD---PRDPAKELELNFARPWKRINMIEELEKRLNVKFPAGDE 418
           +      I G  V + +PD   P+ P   LE   A  W + + I+  +     +F  GD+
Sbjct: 362 QYILEDPIAGPLVKQLNPDFQAPKMPFMRLEYKDAIEWLKEHDIKNEDGE---EFKFGDD 418

Query: 419 LHTAETGEFLKRVLKENNLECPPPLTNARMLDKLVGELEDTCINPTFIFGHP-QMMSPLA 477
           +  AE  E                            ++ DT   P  +   P ++ S   
Sbjct: 419 I--AEAAE---------------------------RKMTDTIGVPILLTKFPAEIKSFYM 449

Query: 478 KKSRDIPGLCERFEVFVAT-KEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDET 536
            + +D   + E  +V + T  EI      +N   +  A F     +++  D +A      
Sbjct: 450 PRCKDDNRVTESVDVLMPTVGEITGGSMRINTEEELLAGF-----KRENIDPKAYY---W 501

Query: 537 FCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
           F +  +YG  P GG+G G +R+  +L +  T+R+  L+P
Sbjct: 502 FIDQRKYGTCPHGGYGLGTERILAWLCNRFTVRDCSLYP 540

>CAGL0H05907g complement(579444..581423) similar to sp|P15179
           Saccharomyces cerevisiae YPL104w MSD1, hypothetical
           start
          Length = 659

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 62/129 (48%), Gaps = 11/129 (8%)

Query: 250 TRSKIISYIRKFLDERNFIEVETPMMNVIAGGATAKPFVT--------HHNDLNMDMFMR 301
           TR ++   +R+ LD+  F E+ETP +   A    A+ F+            D  + MF  
Sbjct: 166 TRYEVSKTLRQILDQDGFTEIETPTL-FKATPEGAREFMVPTRVSAKIKQVDKIVPMFYA 224

Query: 302 I--APELFLKELVVGGMERVYEIGRQFRNEGIDMTHNPEFTTCEFYQAFADVYDLMDMTE 359
           +  +P+ + + L+  G+ + ++  R +R+E +     PEFT  +   +FA   D+M + E
Sbjct: 225 LTQSPQQYKQLLMASGVPKYFQFARCYRDEDLRADRQPEFTQLDMEMSFASQKDVMSVIE 284

Query: 360 VLFSEMVKE 368
              + + K+
Sbjct: 285 KCITSVWKK 293

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 46/93 (49%), Gaps = 5/93 (5%)

Query: 483 IPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNALE 542
           I  L + +++ +   E+    T ++DP  Q+  FE   +  +      Q++     +A E
Sbjct: 538 IDCLGQHYDLVMNGIELGGGSTRIHDPELQKFMFENVLKISN-----YQILFGHLLSAFE 592

Query: 543 YGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
            G PP  G+  G DR+   L  +++IR+V+ FP
Sbjct: 593 TGTPPHAGFAIGYDRMCAMLCGTDSIRDVIPFP 625

>Kwal_0.375
          Length = 428

 Score = 35.8 bits (81), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 63/295 (21%), Positives = 117/295 (39%), Gaps = 38/295 (12%)

Query: 122 EEKVSIAGRVHAKRESGSKLKFYVLH-GDG-VEVQLMSQLQDYGSESAYEADHDLIKRGD 179
           +++V ++G +H +R S S L F VL  G G ++  L   L      S    +  +   G 
Sbjct: 129 DQRVKVSGWIHRQRSSKS-LVFIVLRDGTGYLQAVLTGDLARAHQTSTLTLESSITLYGK 187

Query: 180 IIGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHILPADHFGF-------KDQETRYR 232
           +  +    G+T P     G + + V   ++++    + P+    F        D      
Sbjct: 188 VCKLPE--GKTAP-----GGVELLVDYYEIIS----LAPSGDDAFTNKIAEGADPSLLLD 236

Query: 233 KRYLDLIMNKDARPRFITRSKIISYIRKFLDERNFIEVETPMM--NVIAGGATAKPFVTH 290
           +R+L L   +        R+ ++  +R+F D+    EV  P M    + GG+T      +
Sbjct: 237 QRHLAL-RGETLSAVMKVRAALLRSVRRFYDQEGLTEVTPPCMVQTQVEGGSTLFKLGYY 295

Query: 291 HNDLNMDMFMRIAPELFLKELVVGGMERVYEIGRQFRNEGIDM-THNPEFTTCEFYQAFA 349
                 + ++  + +L+L E  +  +  VY I   FR E      H  E+T  E    F 
Sbjct: 296 GE----EAYLTQSSQLYL-ETCLASLGDVYSIQESFRAEKSHTRRHLSEYTHIEAELCFL 350

Query: 350 DVYDLMDMTEVLFSEMVKE-----ITGSYVIKYHPD---PRDPAKELELNFARPW 396
              +++   E L +++V+      + G  V + +P    P  P   L+   A  W
Sbjct: 351 SFDEMLVHIEKLITQVVQSVLDDPVAGPLVQQLNPGFKAPTMPFMRLDYKDAIEW 405

>CAGL0L08030g 875106..876509 similar to sp|P25345 Saccharomyces
           cerevisiae YCR024c asn-tRNA synthetase, hypothetical
           start
          Length = 467

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 71/334 (21%), Positives = 126/334 (37%), Gaps = 33/334 (9%)

Query: 251 RSKIISYIRKFLDER-NFIEVETPMMNVIAGGATAKPFVTHHNDL-NMDMFMRIAPELFL 308
           RS +  Y   F +++ NF++V  P+          + F    + L N   F+ ++ +L L
Sbjct: 149 RSHMEEYAINFFNKQENFLKVSPPIFTTNDCEGAGEQFEVKSSVLENKKAFLTVSTQLHL 208

Query: 309 KELVVGGMERVYEIGRQFRNE-GIDMTHNPEFTTCEFYQAFADVYD-LMDMTEVLFSEMV 366
            E++   +   + +   FR E      H  EF   E   +F D  D L+D T      MV
Sbjct: 209 -EILSMAIANCWTLSPCFRAEKSATPRHLMEFWMLEAEMSFIDNLDQLLDFTRNFLQSMV 267

Query: 367 KEITGSYVIKYHPDPRDPAKELELNFARPWKRINMIEELEKRLNVKFPAGDELHTAETGE 426
              T  Y  +    P D    L +N  +  +R  M+   E    + +    +        
Sbjct: 268 ---TQCYENREDLLP-DNISTL-INKEKILERWQMLRNSENWKRITYTDAIQ-------- 314

Query: 427 FLKRVLKENNLECPPPLTNARMLDKLVGELEDTCI-----NPTFIFGHPQMMSPLAKKSR 481
               +LKE + + P P    +  + L  E E         +P F+  +P        KS 
Sbjct: 315 ----ILKEKHSQEPFPRYKPKWGEALQTEHEKWLAEKYFQSPVFVTDYPMDCKAFYMKSN 370

Query: 482 DIPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNAL 541
           +       F++ V         +   D ++       Q + K +G +    +D  + N  
Sbjct: 371 EDGKTVACFDLLVPEMGEIIGGSMREDNYESL-----QYQIKKRGMNNTGELD-WYVNLR 424

Query: 542 EYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
           + G+ P GG+G G +R   +L     I++ + FP
Sbjct: 425 KQGVAPHGGFGLGFERFISYLLGIQNIKDTIPFP 458

>CAGL0K07656g 761388..762881 highly similar to sp|P15625
           Saccharomyces cerevisiae YFL022c Phenylalanyl-tRNA
           synthetase alpha chain, start by similarity
          Length = 497

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 7/64 (10%)

Query: 318 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAFADVY--DLMDMTEVLFSEMVKEITGSYVI 375
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F++M   +TG   +
Sbjct: 345 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIKFMEDFFAKM--GVTG---L 399

Query: 376 KYHP 379
           K+ P
Sbjct: 400 KFKP 403

>AFR516W [3708] [Homologous to ScYFL022C (FRS2) - SH]
           complement(1358569..1360068) [1500 bp, 499 aa]
          Length = 499

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 318 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAFADVY--DLMDMTEVLFSEM 365
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F++M
Sbjct: 347 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIQFMEDFFAKM 396

>Scas_707.14
          Length = 499

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 318 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAFADVY--DLMDMTEVLFSEM 365
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F++M
Sbjct: 347 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIKFMEEFFAKM 396

>KLLA0F25234g complement(2349192..2350691) highly similar to
           sp|P15625 Saccharomyces cerevisiae YFL022c FRS2
           phenylalanine--tRNA ligase beta chain, cytosolic
           singleton, start by similarity
          Length = 499

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 318 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAFADVY--DLMDMTEVLFSEM 365
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F++M
Sbjct: 347 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIQFMEDFFAKM 396

>Kwal_47.17998
          Length = 499

 Score = 33.9 bits (76), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 318 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAFADVY--DLMDMTEVLFSEM 365
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F +M
Sbjct: 347 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIQFMEGFFEKM 396

>YFL022C (FRS2) [1661] chr6 complement(93497..95008)
           Phenylalanyl-tRNA synthetase, beta subunit, cytoplasmic
           [1512 bp, 503 aa]
          Length = 503

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 318 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAFADVY--DLMDMTEVLFSEM 365
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F  M
Sbjct: 351 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIKFMEEFFERM 400

>Scas_717.11
          Length = 1280

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 38/81 (46%), Gaps = 8/81 (9%)

Query: 381 PRDPAKELELNFARPWKRINMIEELEKRLNVKFPAGDELHTAETGEFLKRVLKENNLECP 440
           PRD AKE+++   R    I  +  +   LN+  P+GD      T   LKR L +N  +  
Sbjct: 635 PRDLAKEVKILLLRSSPIIYNVSNISSLLNISHPSGD------TEVELKRKLLDNISKVN 688

Query: 441 PPL--TNARMLDKLVGELEDT 459
           P +     RML   + E E++
Sbjct: 689 PTIFKDQVRMLKDSINEYEES 709

>KLLA0C18612g 1646511..1652933 similar to sp|P25655 Saccharomyces
            cerevisiae YCR093w CDC39 nuclear protein singleton, start
            by similarity
          Length = 2140

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/113 (21%), Positives = 50/113 (44%), Gaps = 15/113 (13%)

Query: 155  LMSQLQDYGSESAYEADHDLIKRGDIIGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCL 214
            L+SQ++DY  +  +   +D   +  I+ +  ++ R+  K     ++S+ VS  Q +   L
Sbjct: 1430 LVSQIKDYSEDVEFNLQNDSTIKNTIVEILSFISRSNQK----DQLSLKVS--QAVVNSL 1483

Query: 215  HILPADHFGFKDQETRYRKRYLDLIMNKDARPRFITRSKIISYIRKFLDERNF 267
                     F   E++  +  L L++ K      + R  ++ ++   LD R F
Sbjct: 1484 ---------FGSNESKLCRDVLSLLLEKLCSLSIVARKDVVWWLVYALDPRKF 1527

>KLLA0C15851g complement(1378324..1380579) some similarities with
           sgd|S0006294 Saccharomyces cerevisiae YPR089w/YPR090w,
           hypothetical start
          Length = 751

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 66  FADLDPSQYFEARSRQIQELKK--TQSPNPYPHKFHVSIGLSEFLQKYAHLQR 116
           +  L+P QY    S  I+ L     + PN YPHK +++  ++    +YAH +R
Sbjct: 251 YKHLEPRQYISFTSLDIESLSSLVAKLPNKYPHKPNIAAAVTFQCIRYAHHKR 303

>KLLA0F08371g 779264..781009 no similarity, hypothetical start
          Length = 581

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 79/176 (44%), Gaps = 18/176 (10%)

Query: 216 ILPADHFGFKDQETRYRKRYLDLIMNKDA--RPR---FITRSKIISYIRKFLDERNFIEV 270
           I+    FG  +   RYR + ++ + + D+  +PR   FIT +++   +    D  ++I  
Sbjct: 410 IVRPKSFGPIESGARYRAKMVNDMKSDDSTGKPRWCHFITSAEMKGILDFIFDGLDYIAN 469

Query: 271 ETPMMNVIAGGATAKPFVTHHNDLNMDMFMRIAPELFLKEL--VVGGMERVY--EIGRQF 326
           +  + + ++ G    PF  H + +   M   ++ +  +K+   V+ G  +V+  E+ +Q 
Sbjct: 470 DDTLPDKLSKGIKPNPFKQHESRIRSHMVGYVSGKKCMKDAKNVLTGERKVFAEEMYKQV 529

Query: 327 RNEGIDMTHNPEFTTCEFYQAFADVYDLMDMTEVLFSEMV-----KEITGSYVIKY 377
              G D    P  T  EF  A  +V  +MD  E LF +          TG Y +++
Sbjct: 530 I--GYDDKRRPYNTLKEF--AVMEVKYMMDNIEDLFGKFYWVDPGTVPTGGYKVRF 581

>KLLA0F24200g 2257007..2258965 similar to sp|P53918 Saccharomyces
           cerevisiae YNL125c ESBP6, hypothetical start
          Length = 652

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 30/63 (47%), Gaps = 9/63 (14%)

Query: 510 FDQRARFEEQARQKD----QGDDEAQLVDETFCN--ALEYGLPPTGGWG---CGIDRLAM 560
           FDQ +  E + R +      GDDE Q +++ F N       LPP GG+G   C    L M
Sbjct: 148 FDQTSDSEGEYRSEVPVELAGDDEGQTLNKVFTNKETNTLDLPPEGGYGWVCCLCVTLVM 207

Query: 561 FLT 563
           F T
Sbjct: 208 FST 210

>Kwal_34.15989
          Length = 506

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 19/29 (65%)

Query: 391 NFARPWKRINMIEELEKRLNVKFPAGDEL 419
           N A+PW  +N   +L+++++  FP  D+L
Sbjct: 95  NLAQPWVYLNATNDLQRKISSLFPFSDQL 123

>YCR024C (YCR024C) [558] chr3 complement(160739..162217)
           Asparaginyl-tRNA synthetase, mitochondrial [1479 bp, 492
           aa]
          Length = 492

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 84/425 (19%), Positives = 161/425 (37%), Gaps = 46/425 (10%)

Query: 174 LIKRGDIIGVEGYVGRTQP--KKGGEGEISVFVSRIQLLTPCLHILPADHFGFKDQETRY 231
           ++K G  + +     ++ P  K+  E +I   V  I+L+ P     P      K Q  RY
Sbjct: 80  ILKTGQTLSISNATWQSTPNRKQPFELQIKNPVKSIKLVGPVSENYPLQK---KYQTLRY 136

Query: 232 RK-----RYLDLIMNKDARPRFITRSKIISYIRKFLDERNFIEVETPMMNVIAGGATAKP 286
            +     +Y    ++   R R     + + Y +K     +F +V  P++         + 
Sbjct: 137 LRSLPTLKYRTAYLSAILRLRSFVEFQFMLYFQK----NHFTKVSPPILTSNDCEGAGEL 192

Query: 287 FVTHHND-------LNMDMFMRIAPELFLKELVVGGMERVYEIGRQFRNEGIDM-THNPE 338
           F    N             ++ ++ +L L E++   + R + +   FR E  D   H  E
Sbjct: 193 FQVSTNTSPTASSYFGKPTYLTVSTQLHL-EILALSLSRCWTLSPCFRAEKSDTPRHLSE 251

Query: 339 FTTCEFYQAFAD-VYDLMDMTEVLFSEMVKEITGS---YVIKYHPDPRDPAKELELNFAR 394
           F   E    F + V +L    E     ++K    +    + K     ++     EL+  +
Sbjct: 252 FWMLEVEMCFVNSVNELTSFVETTIKHIIKACIDNQQELLPKQFISSQENNASSELSINQ 311

Query: 395 PWKRINM-IEEL--EKRLNVKFPAGDELHTAETGEFLKRVLKENNLECPPPLTNARMLDK 451
             ++I    E+L  EK  N+ +    E+      E +     E     P    + + L  
Sbjct: 312 ETQQIKTRWEDLINEKWHNITYTNAIEILKKRHNE-VSHFKYEPKWGQPLQTEHEKFL-- 368

Query: 452 LVGELEDTCINPTFIFGHPQMMSPLAKKSRDIPG-LCERFEVFV-ATKEICNAYTELNDP 509
             GE   +   P F+  +P++  P   K    P      F++ V    EI       +D 
Sbjct: 369 -AGEYFKS---PVFVTDYPRLCKPFYMKQNSTPDDTVGCFDLLVPGMGEIIGGSLREDD- 423

Query: 510 FDQRARFEEQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIR 569
           +D+  R E +AR  ++  +      + + +  + G  P GG+G G +R   +L  ++ I+
Sbjct: 424 YDKLCR-EMKARGMNRSGEL-----DWYVSLRKEGSAPHGGFGLGFERFISYLYGNHNIK 477

Query: 570 EVLLF 574
           + + F
Sbjct: 478 DAIPF 482

>Scas_628.24
          Length = 487

 Score = 30.4 bits (67), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 21/32 (65%)

Query: 544 GLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 575
           G  P GG+G G++RL  +L  ++ I++ + FP
Sbjct: 447 GSVPHGGFGLGLERLISYLFGNHNIKDAIPFP 478

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.137    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,610,779
Number of extensions: 817816
Number of successful extensions: 2234
Number of sequences better than 10.0: 55
Number of HSP's gapped: 2223
Number of HSP's successfully gapped: 69
Length of query: 583
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 476
Effective length of database: 12,891,983
Effective search space: 6136583908
Effective search space used: 6136583908
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)