Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_27.105341741739091e-127
KLLA0F18370g1791755311e-69
AGR041C1811474121e-51
Scas_594.1067759670.80
YOL078W (AVO1)117672641.8
ADL353C86598632.7
KLLA0B13816g41390605.7
Kwal_26.7869144928598.2
KLLA0D02860g194066598.7
Kwal_14.172477061589.8
YEL025C118858589.9
Sklu_2430.996667589.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10534
         (173 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10534                                                         354   e-127
KLLA0F18370g 1692172..1692711 no similarity, hypothetical start       209   1e-69
AGR041C [4351] [Homologous to NOHBY] (784425..784970) [546 bp, 1...   163   1e-51
Scas_594.10                                                            30   0.80 
YOL078W (AVO1) [4741] chr15 (181681..185211) Component of the TO...    29   1.8  
ADL353C [1387] [Homologous to ScYML093W - SH] (86120..88717) [25...    29   2.7  
KLLA0B13816g complement(1209339..1210580) similar to sp|P40354 S...    28   5.7  
Kwal_26.7869                                                           27   8.2  
KLLA0D02860g complement(240197..246019) similar to sgd|S0004414 ...    27   8.7  
Kwal_14.1724                                                           27   9.8  
YEL025C (YEL025C) [1399] chr5 complement(102581..106147) Protein...    27   9.9  
Sklu_2430.9 YMR102C, Contig c2430 15497-18397                          27   9.9  

>Kwal_27.10534
          Length = 174

 Score =  354 bits (909), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 173/173 (100%), Positives = 173/173 (100%)

Query: 1   MLTNNVFRTLTAGTLTKAPVCSFVRSSSWFSKILYPFSSSNQSITDSYKPSSQNGNQCFL 60
           MLTNNVFRTLTAGTLTKAPVCSFVRSSSWFSKILYPFSSSNQSITDSYKPSSQNGNQCFL
Sbjct: 1   MLTNNVFRTLTAGTLTKAPVCSFVRSSSWFSKILYPFSSSNQSITDSYKPSSQNGNQCFL 60

Query: 61  PVRSDDELDDTLRANNRTPLILNFTVRGDETCNKLTGALNRIVLLETDKRVNIADVETDF 120
           PVRSDDELDDTLRANNRTPLILNFTVRGDETCNKLTGALNRIVLLETDKRVNIADVETDF
Sbjct: 61  PVRSDDELDDTLRANNRTPLILNFTVRGDETCNKLTGALNRIVLLETDKRVNIADVETDF 120

Query: 121 MQTRNSMMRFGVKQIPTLVAVRKTFPTDLYTVPNLATSPVNWGELKRWIEKNS 173
           MQTRNSMMRFGVKQIPTLVAVRKTFPTDLYTVPNLATSPVNWGELKRWIEKNS
Sbjct: 121 MQTRNSMMRFGVKQIPTLVAVRKTFPTDLYTVPNLATSPVNWGELKRWIEKNS 173

>KLLA0F18370g 1692172..1692711 no similarity, hypothetical start
          Length = 179

 Score =  209 bits (531), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 108/175 (61%), Positives = 133/175 (76%), Gaps = 5/175 (2%)

Query: 2   LTNNVFRTLTAGTLTKAPVC--SFVRSSSWFSKILYPFS-SSNQSITDSYKPSSQNGNQC 58
           +T N    L  G  +  PV   S VR++SW+SKI+YPF+   N S + SY  + +N  QC
Sbjct: 5   ITQNHKLLLRIGADSVKPVLYRSTVRNNSWWSKIIYPFTQEENISPSQSYVKTGKN--QC 62

Query: 59  FLPVRSDDELDDTLRANNRTPLILNFTVRGDETCNKLTGALNRIVLLETDKRVNIADVET 118
           FLP+R+D+EL+D L  NNR PLILNFT RG+ETCNKLTGALNRIVLLETDKR+NI DVET
Sbjct: 63  FLPIRNDNELNDVLLFNNRLPLILNFTFRGNETCNKLTGALNRIVLLETDKRINICDVET 122

Query: 119 DFMQTRNSMMRFGVKQIPTLVAVRKTFPTDLYTVPNLATSPVNWGELKRWIEKNS 173
           DF++TR +M+RFGV QIPTLVAVRKTFP D +T P+L +  VNW +LK WIEKN+
Sbjct: 123 DFLETREAMLRFGVTQIPTLVAVRKTFPVDTFTQPDLTSQDVNWLQLKTWIEKNA 177

>AGR041C [4351] [Homologous to NOHBY] (784425..784970) [546 bp, 181
           aa]
          Length = 181

 Score =  163 bits (412), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 82/147 (55%), Positives = 100/147 (68%), Gaps = 4/147 (2%)

Query: 28  SWFSKILYPFSSSNQSITDSYKPS-SQNGNQCFLPVRSDDELDDTLRANNRTPLILNFTV 86
           SW S++LYP      S   SY+ + S  GNQC LP+RS+ EL+D L  ++  PL+LNFT 
Sbjct: 35  SWLSRLLYPPGRPGAS---SYRDNNSSGGNQCLLPIRSNAELNDALLISHSAPLLLNFTF 91

Query: 87  RGDETCNKLTGALNRIVLLETDKRVNIADVETDFMQTRNSMMRFGVKQIPTLVAVRKTFP 146
           RG    + LTGA NRIVLLETDKR+NIADVE DF  TR  M+RFGV  +PTLVAVRKT P
Sbjct: 92  RGVPQADALTGAANRIVLLETDKRINIADVEADFADTREGMLRFGVNSLPTLVAVRKTLP 151

Query: 147 TDLYTVPNLATSPVNWGELKRWIEKNS 173
            D YT+     + VNW  LK WIE+N+
Sbjct: 152 VDYYTLSEDELAEVNWLRLKAWIERNA 178

>Scas_594.10
          Length = 677

 Score = 30.4 bits (67), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 98  ALNRIVLLETDKRVNIADVETDFMQTRN-SMMRFGVKQIPTLVAVRKTFPTDLYTVPNL 155
           AL   +  E D  VNI     DF+++ N   M+  +KQ+    +VR + P DL  V ++
Sbjct: 489 ALKEFIDHEIDNEVNILVSNKDFLRSENPEEMKGLIKQVKRANSVRASSPHDLPEVSDV 547

>YOL078W (AVO1) [4741] chr15 (181681..185211) Component of the TOR
           complex 2 (Tor2p-Lst8p-Kog1p-Avo1p-Avo2p-Tsc11p), which
           is involved in signaling to the actin cytoskeleton [3531
           bp, 1176 aa]
          Length = 1176

 Score = 29.3 bits (64), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 9/72 (12%)

Query: 47  SYKPSSQNGNQCFLPVRSDDELDDTLRANNRTPLILNFTVRGDETCNKLTGALNRIVLLE 106
           S+ P+SQ G       ++D +  D+L AN          + GD +     G+++R  L E
Sbjct: 321 SHFPTSQKGKIFLTDNKNDGQKSDSLNANK--------GIHGDGSSASGNGSVSRDGLTE 372

Query: 107 TDKRVNIADVET 118
           T+   NI+D+E+
Sbjct: 373 TESN-NISDMES 383

>ADL353C [1387] [Homologous to ScYML093W - SH] (86120..88717) [2598
           bp, 865 aa]
          Length = 865

 Score = 28.9 bits (63), Expect = 2.7,   Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 40/98 (40%), Gaps = 10/98 (10%)

Query: 26  SSSWFSKILYPFSSSNQSITDSYKPSSQNGNQCFLPVRSDDELD---------DTLRANN 76
           +SS F+K  +      Q ++ S K    NG+   L + S ++LD         D    N+
Sbjct: 656 NSSQFTKSAHKIDKEKQKLSRSKKDEKDNGDDLLLDIESSNKLDIIDPYDESGDEADGNS 715

Query: 77  -RTPLILNFTVRGDETCNKLTGALNRIVLLETDKRVNI 113
            +    +N    GD+   K      R+ + E DK  ++
Sbjct: 716 FKQQDAINEAFAGDDVVAKFQEEKKRVAIDEDDKEEDV 753

>KLLA0B13816g complement(1209339..1210580) similar to sp|P40354
           Saccharomyces cerevisiae YJR062c NTA1 amino-terminal
           amidase singleton, start by similarity
          Length = 413

 Score = 27.7 bits (60), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 36/90 (40%), Gaps = 9/90 (10%)

Query: 10  LTAGTLTKAPVCSFVRSSSWF-SKILYPFSSSNQSITDSY------KPSSQNGNQCFLPV 62
           +T   L   P  +  +   WF SK+L PF +   + T SY      KP    G +  L +
Sbjct: 287 ITYWLLRLTPFVALKKRYEWFHSKLLVPFLTRTSTKTSSYVGSSLDKPWVHEGKETVLVL 346

Query: 63  --RSDDELDDTLRANNRTPLILNFTVRGDE 90
             R   E   T+ A +      N  + GDE
Sbjct: 347 ANRCGIEDKQTVYAGSSGIYKFNGHIHGDE 376

>Kwal_26.7869
          Length = 1449

 Score = 27.3 bits (59), Expect = 8.2,   Method: Composition-based stats.
 Identities = 12/28 (42%), Positives = 17/28 (60%)

Query: 106 ETDKRVNIADVETDFMQTRNSMMRFGVK 133
           ET +RVNIAD+  +   T N  +R G +
Sbjct: 135 ETSRRVNIADIFPEMFTTLNGSVRTGSR 162

>KLLA0D02860g complement(240197..246019) similar to sgd|S0004414
           Saccharomyces cerevisiae YLR422w, start by similarity
          Length = 1940

 Score = 27.3 bits (59), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 5/66 (7%)

Query: 14  TLTKAPVCSFVRSSSWFSKILYPFSSSNQSITDSYKPSSQNGNQ---CFLPVRSDDELDD 70
           TL K  +C      S  S I    SS+N  IT  ++PSS   +     F+ VR  + +++
Sbjct: 595 TLDKVSICGLENKKSNVSNITIQISSNNDKIT--FRPSSVTHSYKKWAFITVRPGELVNE 652

Query: 71  TLRANN 76
           T+R + 
Sbjct: 653 TIRIDG 658

>Kwal_14.1724
          Length = 770

 Score = 26.9 bits (58), Expect = 9.8,   Method: Composition-based stats.
 Identities = 16/61 (26%), Positives = 26/61 (42%), Gaps = 5/61 (8%)

Query: 95  LTGALNRIVLLETDKRVNIADVETDFMQTRNSMMRFGVKQIPTLVAVRKTFPTDLYTVPN 154
           L G L ++V+   D ++ I     D  + +   M     + P L    +TFP +LY  P 
Sbjct: 229 LMGLLKQVVVRRPDLKIIIMSATLDAEKFQRYFM-----EAPLLAVPGRTFPVELYYTPE 283

Query: 155 L 155
            
Sbjct: 284 F 284

>YEL025C (YEL025C) [1399] chr5 complement(102581..106147) Protein of
           unknown function [3567 bp, 1188 aa]
          Length = 1188

 Score = 26.9 bits (58), Expect = 9.9,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 98  ALNRIVLLETDKRVNIADVETDFMQTRNSMMRFGVK-QIPTLVAVRKTFPTDLYTVPN 154
           AL  + +L+ D R++I +  + F +   +     +K Q+   +    + P +LYTVPN
Sbjct: 719 ALFSLCVLDYDSRISIFEFGSTFYREGFTKQMTSLKPQLENHIFYLPSIPVELYTVPN 776

>Sklu_2430.9 YMR102C, Contig c2430 15497-18397
          Length = 966

 Score = 26.9 bits (58), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 29/67 (43%), Gaps = 2/67 (2%)

Query: 2   LTNNVFRTLTAGTLTKAPVCSFVRSSSWFSKILYPFSSSNQSITDSYKPSSQNGNQCFLP 61
           LT N  +  TAG     P+ ++  S+S  S  L    SS  S   S   S +   +  LP
Sbjct: 863 LTTNTVKAATAGFNKSCPMGNYSHSNSVLS--LSTMRSSKSSTAQSIPSSQETTTEHVLP 920

Query: 62  VRSDDEL 68
             SD ++
Sbjct: 921 AASDSQM 927

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.131    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,789,733
Number of extensions: 241595
Number of successful extensions: 738
Number of sequences better than 10.0: 17
Number of HSP's gapped: 735
Number of HSP's successfully gapped: 17
Length of query: 173
Length of database: 16,596,109
Length adjustment: 95
Effective length of query: 78
Effective length of database: 13,307,399
Effective search space: 1037977122
Effective search space used: 1037977122
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 58 (26.9 bits)