Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_27.1033237837319130.0
KLLA0D01639g38137414450.0
YMR272C (SCS7)38437414230.0
AAL183W37737313060.0
Scas_696.3642637413051e-180
CAGL0F03399g38037812331e-170
Scas_666.12121561603e-13
AFL223W165621511e-11
CAGL0L03828g121511462e-11
YML054C (CYB2)591631521e-10
KLLA0F27577g172701422e-10
KLLA0B14795g5561031493e-10
Kwal_47.18167227561443e-10
Scas_571.1d6091041475e-10
Kwal_26.8461123761348e-10
KLLA0A12111g236501401e-09
CAGL0K10736g593801431e-09
YNL111C (CYB5)120561312e-09
Scas_571.2602731403e-09
KLLA0F23672g123761304e-09
ADL085C2731571365e-09
Sklu_2444.3564501352e-08
KLLA0D02640g589681323e-08
Kwal_23.2823560481305e-08
Sklu_2258.5580591271e-07
Kwal_26.8046198741169e-07
Kwal_14.807578481137e-06
Scas_717.14189761081e-05
CAGL0K03069g194491052e-05
KLLA0E18535g148731032e-05
AAL078W592461003e-04
Scas_563.649774976e-04
Kwal_23.569351346950.001
Sklu_2032.352246930.002
KLLA0C10692g52098930.002
CAGL0I00418g49072920.003
Sklu_2299.348046900.005
KLLA0C05566g47772880.008
YMR073C20176850.009
AAR153C47872860.011
Kwal_14.184528872840.015
YGL055W (OLE1)51048820.035
CAGL0M13101g34151710.68
ACL114W31957672.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10332
         (373 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10332                                                         741   0.0  
KLLA0D01639g complement(146344..147489) similar to sp|Q03529 Sac...   561   0.0  
YMR272C (SCS7) [4226] chr13 complement(809622..810776) Ceramide ...   552   0.0  
AAL183W [4] [Homologous to ScYMR272C (SCS7) - SH] complement(137...   507   0.0  
Scas_696.36                                                           507   e-180
CAGL0F03399g complement(333955..335097) highly similar to sp|Q03...   479   e-170
Scas_666.12                                                            66   3e-13
AFL223W [2972] [Homologous to ScYNL111C (CYB5) - SH] complement(...    63   1e-11
CAGL0L03828g 440663..441028 similar to sp|P40312 Saccharomyces c...    61   2e-11
YML054C (CYB2) [3916] chr13 complement(165533..167308) Cytochrom...    63   1e-10
KLLA0F27577g 2556662..2557180 some similarities with sp|Q9M5B0 P...    59   2e-10
KLLA0B14795g 1299429..1301099 similar to sp|P00175 Saccharomyces...    62   3e-10
Kwal_47.18167                                                          60   3e-10
Scas_571.1d                                                            61   5e-10
Kwal_26.8461                                                           56   8e-10
KLLA0A12111g 1053506..1054216 some similarities with sp|P09437 H...    59   1e-09
CAGL0K10736g 1045298..1047079 highly similar to sp|P00175 Saccha...    60   1e-09
YNL111C (CYB5) [4482] chr14 complement(416940..417302) Cytochrom...    55   2e-09
Scas_571.2                                                             59   3e-09
KLLA0F23672g 2212223..2212594 some similarities with sp|P40312 S...    55   4e-09
ADL085C [1656] [Homologous to NOHBY] (535296..536117) [822 bp, 2...    57   5e-09
Sklu_2444.3 , Contig c2444 10960-12654                                 57   2e-08
KLLA0D02640g complement(225482..227251) gi|5262950|emb|CAB45871....    55   3e-08
Kwal_23.2823                                                           55   5e-08
Sklu_2258.5 YML054C, Contig c2258 8274-10016 reverse complement        54   1e-07
Kwal_26.8046                                                           49   9e-07
Kwal_14.807                                                            48   7e-06
Scas_717.14                                                            46   1e-05
CAGL0K03069g complement(284361..284945) weakly similar to sp|Q04...    45   2e-05
KLLA0E18535g 1641507..1641953 some similarities with ca|CA1511|I...    44   2e-05
AAL078W [109] [Homologous to ScYGL055W - NSH] complement(209600....    43   3e-04
Scas_563.6                                                             42   6e-04
Kwal_23.5693                                                           41   0.001
Sklu_2032.3 , Contig c2032 4286-5854                                   40   0.002
KLLA0C10692g complement(916718..918280) weakly similar to sp|P21...    40   0.002
CAGL0I00418g 30058..31530 highly similar to sp|P21147 Saccharomy...    40   0.003
Sklu_2299.3 YGL055W, Contig c2299 5338-6780 reverse complement         39   0.005
KLLA0C05566g complement(497877..499310) similar to sp|P21147 Sac...    39   0.008
YMR073C (YMR073C) [4032] chr13 complement(412267..412872) Protei...    37   0.009
AAR153C [341] [Homologous to ScYGL055W (OLE1) - SH] (619953..621...    38   0.011
Kwal_14.1845                                                           37   0.015
YGL055W (OLE1) [1924] chr7 (398629..400161) Stearoyl-CoA desatur...    36   0.035
CAGL0M13101g 1286561..1287586 similar to sp|P35735 Saccharomyces...    32   0.68 
ACL114W [935] [Homologous to ScYJR107W - NSH] complement(144800....    30   2.0  

>Kwal_27.10332
          Length = 378

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/373 (96%), Positives = 361/373 (96%)

Query: 1   METKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEV 60
           METKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEV
Sbjct: 1   METKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEV 60

Query: 61  MKDGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLEDEYDSTVFVPEV 120
           MKDGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLEDEYDSTVFVPEV
Sbjct: 61  MKDGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLEDEYDSTVFVPEV 120

Query: 121 PAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPLF 180
           PAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPLF
Sbjct: 121 PAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPLF 180

Query: 181 GNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHRF 240
           GNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHRF
Sbjct: 181 GNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHRF 240

Query: 241 LFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMXXXXXXXXXXXXYKLVFALLPYY 300
           LFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVM            YKLVFALLPYY
Sbjct: 241 LFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFLLLCTPFYKLVFALLPYY 300

Query: 301 WACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWDK 360
           WACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWDK
Sbjct: 301 WACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWDK 360

Query: 361 VFGTYLAENAPLS 373
           VFGTYLAENAPLS
Sbjct: 361 VFGTYLAENAPLS 373

>KLLA0D01639g complement(146344..147489) similar to sp|Q03529
           Saccharomyces cerevisiae YMR272c SCS7 required for
           hydroxylation of ceramide singleton, start by similarity
          Length = 381

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/374 (70%), Positives = 311/374 (83%), Gaps = 2/374 (0%)

Query: 2   ETKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVM 61
            ++ LPLYS + +++HN  +DCWV+L  RKIY+VT+FL++HPGG + I++YAG DIT+VM
Sbjct: 3   SSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVM 62

Query: 62  KDGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLE--DEYDSTVFVPE 119
           KD   H HS  AYE++DE Y VGYLAT EEE+KLL N  H VEV L+  +E+DSTVFV E
Sbjct: 63  KDVLTHEHSESAYEIMDESYLVGYLATEEEEKKLLTNKDHVVEVNLKGNNEFDSTVFVKE 122

Query: 120 VPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPL 179
           +P E+KLSI TDY  DY +HKFLDLN+PLL Q+L   FTK+FYLDQVHRPRHYG+GSAPL
Sbjct: 123 LPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSAPL 182

Query: 180 FGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHR 239
           FGNFLEPLSKT W+++P+VWLPVV YHI+TA+ NMN+ FA+FLF VG+FVWTLIEYG+HR
Sbjct: 183 FGNFLEPLSKTPWWMVPVVWLPVVTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGLHR 242

Query: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMXXXXXXXXXXXXYKLVFALLPY 299
           FLFHLD  LP  Q A+T+HFLLHGVHHYLPMDR+RLVM            YKLVFALLPY
Sbjct: 243 FLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALLPY 302

Query: 300 YWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWD 359
           YWACAGFAGGMLGYVCYDLTHYFLHH++LP  ++KLKKYH+EHHYKNYELGFGVTSW WD
Sbjct: 303 YWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRKLKKYHLEHHYKNYELGFGVTSWFWD 362

Query: 360 KVFGTYLAENAPLS 373
           KVFGTYL ENAPLS
Sbjct: 363 KVFGTYLGENAPLS 376

>YMR272C (SCS7) [4226] chr13 complement(809622..810776) Ceramide
           hydroxylase that hydroxylates the C-26 fatty-acyl moiety
           of inositol-phosphorylceramide [1155 bp, 384 aa]
          Length = 384

 Score =  552 bits (1423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/374 (68%), Positives = 307/374 (82%), Gaps = 3/374 (0%)

Query: 3   TKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMK 62
           +KTL L+S   VQEHN+A+DCWVT QNRKIYDVT+FL +HPGG + I++YAGKDITE+MK
Sbjct: 6   SKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEIMK 65

Query: 63  DGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLE---DEYDSTVFVPE 119
           D  +H HS  AYE+L++EY +GYLAT EE  +LL N  HKVEV+L     E+DST FV E
Sbjct: 66  DSDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSADGTEFDSTTFVKE 125

Query: 120 VPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPL 179
           +PAEEKLSI TDY+ DY +HKFLDLNRPLLMQ+L +DF K+FY+DQ+HRPRHYG+GSAPL
Sbjct: 126 LPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGSAPL 185

Query: 180 FGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHR 239
           FGNFLEPL+KT+W+V+P+ WLPVV YH+  A++NMN+LFA FLF VG+FVWTLIEYG+HR
Sbjct: 186 FGNFLEPLTKTAWWVVPVAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGLHR 245

Query: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMXXXXXXXXXXXXYKLVFALLPY 299
           FLFH D +LP + +A+  HFLLHG HHYLPMD+YRLVM            YKLVFALLP 
Sbjct: 246 FLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALLPL 305

Query: 300 YWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWD 359
           YWA AGFAGG+ GYVCYD  H+FLHH+KLP  ++KLKKYH+EHHYKNY+LGFGVTSW WD
Sbjct: 306 YWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWFWD 365

Query: 360 KVFGTYLAENAPLS 373
           +VFGTYL  +APLS
Sbjct: 366 EVFGTYLGPDAPLS 379

>AAL183W [4] [Homologous to ScYMR272C (SCS7) - SH]
           complement(13713..14846) [1134 bp, 377 aa]
          Length = 377

 Score =  507 bits (1306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 237/373 (63%), Positives = 292/373 (78%), Gaps = 1/373 (0%)

Query: 1   METKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEV 60
           M +KTLPLYS + +Q+H     CWV++ NRKIYDV++FL++HPGG   I++YAGKDIT V
Sbjct: 1   MVSKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAV 60

Query: 61  MKDGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLEDEYDSTVFVPEV 120
           +KD  +H H+  AYE+LDE Y VGYLAT EEE KLL N KH +EV  E+  D+T FV E+
Sbjct: 61  LKDKLIHEHTEAAYEILDESYLVGYLATEEEEIKLLTNEKHVMEVTPEN-LDTTTFVKEL 119

Query: 121 PAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPLF 180
           PAEE LS+ TD+  DY +H FLDLN+PLLMQ+L  +FT++FY+DQ+HRPRHYG+GSAPLF
Sbjct: 120 PAEEVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYIDQIHRPRHYGKGSAPLF 179

Query: 181 GNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHRF 240
           GNFLEPLSKT W+V+P+VW PVV Y++  A+QNM    A+  F  G+FVWTLIEY +HRF
Sbjct: 180 GNFLEPLSKTVWWVVPMVWYPVVLYYLTRALQNMPAHLALTCFAAGVFVWTLIEYSLHRF 239

Query: 241 LFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMXXXXXXXXXXXXYKLVFALLPYY 300
           LFH D  +P + +A+TVHFLLHGVHHYLPMD+YRLVM            Y+LVF++ P Y
Sbjct: 240 LFHFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVMPPALFVVLCAPFYRLVFSIFPEY 299

Query: 301 WACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWDK 360
            AC  FAGG+ GYVCYD+THYFLHH KLP  ++KLKKYH+EHHYKNYELGFGVTSW WDK
Sbjct: 300 CACGCFAGGLFGYVCYDVTHYFLHHHKLPPFMRKLKKYHLEHHYKNYELGFGVTSWYWDK 359

Query: 361 VFGTYLAENAPLS 373
           VFGTYLA N+P+S
Sbjct: 360 VFGTYLASNSPVS 372

>Scas_696.36
          Length = 426

 Score =  507 bits (1305), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 234/374 (62%), Positives = 293/374 (78%), Gaps = 7/374 (1%)

Query: 3   TKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMK 62
           +KTL L+S  QV +HN+ +DCWVT+ +RKIYDV+KFL DHP G   I+++AGKDITE++K
Sbjct: 52  SKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLK 111

Query: 63  DGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLEDE---YDSTVFVPE 119
           D  +   +    ++LD++Y +GY+AT  EE+KLL N  HKVEVKL +    +DST FV +
Sbjct: 112 DEKIDQQT----DLLDDQYLIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDSTTFVKD 167

Query: 120 VPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPL 179
           +P E+KLSI TDY +D  +H FLDLN+PLL Q+L  +FTK+FYLDQ+HRPRHYG+ SAPL
Sbjct: 168 LPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQESAPL 227

Query: 180 FGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHR 239
           FGNFLEP +KT+WY++PI WLPVV YHI  A +N+N LFA+ LF +G++VWT IEY MHR
Sbjct: 228 FGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYCMHR 287

Query: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMXXXXXXXXXXXXYKLVFALLPY 299
           FLFH D  LP +  AY +HFLLHG HHYLPMD+YRLV+            YKLVFALLPY
Sbjct: 288 FLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFALLPY 347

Query: 300 YWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWD 359
           YWACAGFAGGM GY+CYDL HYFLHH+KLP  ++KLKKYH+EHHYKNY+LG+GVTSW WD
Sbjct: 348 YWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRKLKKYHLEHHYKNYQLGYGVTSWYWD 407

Query: 360 KVFGTYLAENAPLS 373
           K FGTYL+ ++PLS
Sbjct: 408 KKFGTYLSPDSPLS 421

>CAGL0F03399g complement(333955..335097) highly similar to sp|Q03529
           Saccharomyces cerevisiae YMR272c SCS7 required for
           hydroxylation of ceramide, hypothetical start
          Length = 380

 Score =  479 bits (1233), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 229/378 (60%), Positives = 284/378 (75%), Gaps = 15/378 (3%)

Query: 2   ETKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYA----GKDI 57
            +KTL L+  S + +HNS DDCWV+   RKIYDV+K+L+DHP   D + +      G DI
Sbjct: 7   SSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTDI 66

Query: 58  TEVMKDGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKL--EDEYDSTV 115
           +++              + + ++Y VGYLAT++EE+KLL N  HKVEVKL  ++ +DST 
Sbjct: 67  SQM---------ELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTT 117

Query: 116 FVPEVPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRG 175
           FV ++P E+KLSI TDY RDY +HKFLDLN+PLL Q+L  +FTK+FYLDQ+HRPRHYG+G
Sbjct: 118 FVKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKG 177

Query: 176 SAPLFGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEY 235
           SAPLFGNFLE  +KT+W+V+P VW PVV Y I TA+ NMN   A+FLF +GIFVWTLIEY
Sbjct: 178 SAPLFGNFLEAFTKTAWWVVPTVWGPVVLYFITTALMNMNNPLALFLFGLGIFVWTLIEY 237

Query: 236 GMHRFLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMXXXXXXXXXXXXYKLVFA 295
            +HRFLFH D +LP + + + +HFLLHG HHYLPMD YRLV+            YKLVFA
Sbjct: 238 CLHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFA 297

Query: 296 LLPYYWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTS 355
            LPYYWACAGFAGGMLGY+CYDL HYFLHH+K+P  ++KLKKYH+EHHYKNY+LGFGVTS
Sbjct: 298 ALPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRKLKKYHLEHHYKNYQLGFGVTS 357

Query: 356 WVWDKVFGTYLAENAPLS 373
           W WDKVFGTYL  +APLS
Sbjct: 358 WFWDKVFGTYLGPDAPLS 375

>Scas_666.12
          Length = 121

 Score = 66.2 bits (160), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 1/56 (1%)

Query: 8  LYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKD 63
          +YS  Q+ EHN  DD W+ ++  K+YDV+KFL++HPGG ++I E AG+D TE   D
Sbjct: 4  VYSYQQIAEHNKPDDAWIIIEG-KVYDVSKFLDEHPGGDEIIFELAGQDATEHFLD 58

>AFL223W [2972] [Homologous to ScYNL111C (CYB5) - SH]
          complement(19601..20098) [498 bp, 165 aa]
          Length = 165

 Score = 62.8 bits (151), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 42/62 (67%), Gaps = 1/62 (1%)

Query: 2  ETKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVM 61
          ET    LY+  ++ EHNS +D W+ + N K+YD TKF E+HPGG +++++ AG+D TE  
Sbjct: 37 ETTMPKLYTYQEIAEHNSENDLWLII-NGKVYDCTKFAEEHPGGDEVLIDLAGQDATEPF 95

Query: 62 KD 63
           D
Sbjct: 96 AD 97

>CAGL0L03828g 440663..441028 similar to sp|P40312 Saccharomyces
          cerevisiae YNL111c CYB5, start by similarity
          Length = 121

 Score = 60.8 bits (146), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 35/51 (68%), Gaps = 1/51 (1%)

Query: 8  LYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDIT 58
          +Y+  QV EHN   DCW+ +    +YDV+KFL++HPGG ++I E+ G D T
Sbjct: 4  VYTYKQVSEHNKEGDCWIIIDG-SVYDVSKFLDEHPGGDEIIFEHRGTDAT 53

>YML054C (CYB2) [3916] chr13 complement(165533..167308) Cytochrome
           b2 [L-(+)-lactate cytochrome c oxidoreductase],
           catalyzes the conversion of L-lactate to pyruvate [1776
           bp, 591 aa]
          Length = 591

 Score = 63.2 bits (152), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 44/63 (69%), Gaps = 3/63 (4%)

Query: 10  SASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSH 69
           S ++V +HN  DDCWV + N  +YD+T+FL +HPGG D+I   AGKD+T + +  PLH+ 
Sbjct: 92  SPAEVAKHNKPDDCWVVI-NGYVYDLTRFLPNHPGGQDVIKFNAGKDVTAIFE--PLHAP 148

Query: 70  SFV 72
           + +
Sbjct: 149 NVI 151

>KLLA0F27577g 2556662..2557180 some similarities with sp|Q9M5B0
          Petunia hybrida Cytochrome b5 DIF-F, hypothetical start
          Length = 172

 Score = 59.3 bits (142), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 2/70 (2%)

Query: 7  PLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPL 66
          PL +  +V  H+S  DCW  +   K+YD+T FL  HPGG  ++++YAGKD T +  D   
Sbjct: 4  PLITMDEVARHSSRSDCWTVIHG-KVYDITSFLHKHPGGAQVLLKYAGKDST-LQFDDIG 61

Query: 67 HSHSFVAYEV 76
          HS   +AY++
Sbjct: 62 HSMESLAYDL 71

>KLLA0B14795g 1299429..1301099 similar to sp|P00175 Saccharomyces
           cerevisiae YML054c CYB2 lactate dehydrogenase cytochrome
           b2 singleton, start by similarity
          Length = 556

 Score = 62.0 bits (149), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 57/103 (55%), Gaps = 15/103 (14%)

Query: 10  SASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSH 69
           S  +V+ HN  DDCW+ + N ++YD+TKFL  HPGG   ++E+AG+D TE         H
Sbjct: 82  SVKEVKMHNRIDDCWIVIDN-EVYDITKFLSQHPGGVARLMEFAGRDATERF----YQMH 136

Query: 70  SFVAYEVLDEE-YHVGYLATA------EEEQKLLGNSKHKVEV 105
           S    E + E   ++G L  A      EEE +++   +HK ++
Sbjct: 137 SSATLEKMKEHLVYIGKLKGAFDKELSEEEIRII---EHKAKI 176

>Kwal_47.18167
          Length = 227

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 37/56 (66%), Gaps = 1/56 (1%)

Query: 3  TKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDIT 58
          +  LP  S+ +V  H  ADDCW+++   K+YDV+ +L  HPGG  ++++ AGKD T
Sbjct: 28 SSQLPFISSDEVATHTDADDCWISIHG-KVYDVSSYLPQHPGGAQVMLKLAGKDAT 82

>Scas_571.1d
          Length = 609

 Score = 61.2 bits (147), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 58/104 (55%), Gaps = 9/104 (8%)

Query: 10  SASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSH 69
           S  +V +HNS +DCW+ + N ++YD+T F+  HPGG D+I   AGKD++ +    PLH+ 
Sbjct: 96  STDEVTKHNSENDCWIVI-NGQVYDLTSFMSIHPGGSDIIKLNAGKDVSAIF--NPLHAP 152

Query: 70  SFVAYEVLDEEYHVGYLATAEEEQKLL-----GNSKHKVEVKLE 108
           + +    L  E ++G L     ++ +      G SK  +  KL+
Sbjct: 153 NAIE-RFLPPECYLGPLQGTMPKELICDPYTPGESKEDIARKLK 195

>Kwal_26.8461
          Length = 123

 Score = 56.2 bits (134), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 46/76 (60%), Gaps = 8/76 (10%)

Query: 8  LYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLH 67
          LYS  ++ EHN+  D W+ +   K+YD TKF+++HPGG +++V+  G+D T     GP  
Sbjct: 4  LYSYKEIAEHNTEKDLWMIIDG-KVYDCTKFMDEHPGGEEVLVDLGGQDAT-----GPFA 57

Query: 68 S--HSFVAYEVLDEEY 81
             HS  A ++L + Y
Sbjct: 58 DIGHSDDAVKMLADLY 73

>KLLA0A12111g 1053506..1054216 some similarities with sp|P09437
           Hansenula anomala Cytochrome B2, mitochondrial precursor
           (EC 1.1.2.3) (L-lactate dehydrogenase [Cytochrome])
           (L-lactate ferricytochrome C oxidoreductase) (L-LCR),
           hypothetical start
          Length = 236

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 10  SASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITE 59
           S  +V+ HN  DDCW+ +    +YD+T FL  HPGG   ++E+AG+D TE
Sbjct: 82  SVKEVKSHNRIDDCWIVIDG-DVYDITGFLSKHPGGVTRLMEFAGRDATE 130

>CAGL0K10736g 1045298..1047079 highly similar to sp|P00175
           Saccharomyces cerevisiae YML054c CYB2 lactate
           dehydrogenase cytochrome b2, hypothetical start
          Length = 593

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 47/80 (58%), Gaps = 4/80 (5%)

Query: 7   PLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPL 66
           P  S S+V +HN+ +DCWV +    +YD+T F+  HPGG D+I   AGKD+T +    P+
Sbjct: 88  PKISPSEVIKHNTPEDCWVVIDGY-VYDLTNFIALHPGGPDIIKTNAGKDVTAIFD--PI 144

Query: 67  HSHSFVAYEVLDEEYHVGYL 86
           H    +  + +  E H+G L
Sbjct: 145 HPPDAIE-KYIKPEQHIGPL 163

>YNL111C (CYB5) [4482] chr14 complement(416940..417302) Cytochrome
          b5 [363 bp, 120 aa]
          Length = 120

 Score = 55.1 bits (131), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 39/56 (69%), Gaps = 1/56 (1%)

Query: 8  LYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKD 63
          +YS  +V EHN  ++ W+ + + K+YDV++F ++HPGG ++I++  G+D TE   D
Sbjct: 4  VYSYQEVAEHNGPENFWIIIDD-KVYDVSQFKDEHPGGDEIIMDLGGQDATESFVD 58

>Scas_571.2
          Length = 602

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 5/73 (6%)

Query: 2   ETKTLP--LYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITE 59
           E+K  P  +   S+V  HN+  DCW+ + N  +YD+T F+  HPGG D+I   AGKD+T 
Sbjct: 80  ESKLAPKRVIDPSEVARHNTPADCWIVI-NGVVYDLTSFIPVHPGGADIIKSNAGKDVTA 138

Query: 60  VMKDGPLHSHSFV 72
           + +  P+H+   +
Sbjct: 139 IFE--PIHAPGVI 149

>KLLA0F23672g 2212223..2212594 some similarities with sp|P40312
          Saccharomyces cerevisiae YNL111c CYB5 cytochrome b5
          singleton, hypothetical start
          Length = 123

 Score = 54.7 bits (130), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 28/76 (36%), Positives = 45/76 (59%), Gaps = 8/76 (10%)

Query: 8  LYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLH 67
          L +  +V EH + DD W+ +   K+YD TKF+++HPGG +++V+  G+D T     GP  
Sbjct: 4  LLTYKEVSEHKTVDDLWMIIDG-KVYDCTKFVDEHPGGDEILVDLGGQDAT-----GPFE 57

Query: 68 S--HSFVAYEVLDEEY 81
             HS  A ++L+  Y
Sbjct: 58 DIGHSDDAIKLLEPMY 73

>ADL085C [1656] [Homologous to NOHBY] (535296..536117) [822 bp, 273
           aa]
          Length = 273

 Score = 57.0 bits (136), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 70/157 (44%), Gaps = 29/157 (18%)

Query: 10  SASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDIT----------- 58
           S  +V +H S DDCW  +  R +YD+T  LE+HPGG  ++++YAG+D T           
Sbjct: 94  SIEEVSQHTSRDDCWFIIHGR-VYDITGLLENHPGGTKILLKYAGRDATLPFDDVGHSME 152

Query: 59  -------------EVMKDGPLHS-HSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVE 104
                        EV     ++S  S V++  L      G  A+ +   + LG+   K+E
Sbjct: 153 SLIYDMAPGSYLGEVDGGENVNSCSSVVSWRSLRWLRSWGKGASDDATVRSLGSQSEKLE 212

Query: 105 VKLEDEYDSTVFVPEVPAEEKLSIVTDY---TRDYGR 138
             L++    T+ +  +     L +V  Y   TR  GR
Sbjct: 213 SDLQNWLQKTLLLLVICVCCVLLLVIRYHNRTRRAGR 249

>Sklu_2444.3 , Contig c2444 10960-12654
          Length = 564

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 36/50 (72%), Gaps = 1/50 (2%)

Query: 10  SASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITE 59
           +  +V+ HN+ DDCW+ L N  +YD+T+F++ HPGG   ++E AG+D TE
Sbjct: 89  TVDEVKLHNNIDDCWIVL-NGDVYDITEFIKIHPGGAARLMEVAGRDATE 137

>KLLA0D02640g complement(225482..227251) gi|5262950|emb|CAB45871.1
           Kluyveromyces lactis cytochrome b2, start by similarity
          Length = 589

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 42/68 (61%), Gaps = 3/68 (4%)

Query: 5   TLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDG 64
           T P  S ++V +H+S  DCWV ++   +Y++T F+  HPGG  +I   AGKD+T++    
Sbjct: 86  TKPKVSPTEVAKHSSPKDCWVVIEGY-VYNLTDFISAHPGGPAIIENNAGKDVTKIF--A 142

Query: 65  PLHSHSFV 72
           P+H+   +
Sbjct: 143 PIHAPDVI 150

>Kwal_23.2823
          Length = 560

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 32/48 (66%), Gaps = 1/48 (2%)

Query: 12  SQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITE 59
           S+V  HN  +DCW+ L N ++YDVT F+  HPGG   I+E AG D TE
Sbjct: 84  SEVMLHNKLNDCWIVL-NDEVYDVTSFIAAHPGGVQRILEVAGSDATE 130

>Sklu_2258.5 YML054C, Contig c2258 8274-10016 reverse complement
          Length = 580

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 36/59 (61%), Gaps = 3/59 (5%)

Query: 14  VQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSHSFV 72
           V +HN   DCWV +    +YD+T+F+  HPGG  +I   AGKD+T +   GP+H+   +
Sbjct: 86  VAKHNDPKDCWVVIDGY-VYDLTEFIHSHPGGPTIIENNAGKDVTAIF--GPIHAPDVI 141

>Kwal_26.8046
          Length = 198

 Score = 49.3 bits (116), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 45/74 (60%), Gaps = 6/74 (8%)

Query: 12  SQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVE-YAGKDITEVMKDGPLHSHS 70
           +Q+ +H + +DCW  + N+K+Y ++ +L+ HPGG D++++  AGKD T +        H 
Sbjct: 126 AQLAQHKAPEDCWCVI-NQKVYCISSYLDFHPGGVDILMKGAAGKDCTSMFN----KYHR 180

Query: 71  FVAYEVLDEEYHVG 84
           +V YE + E   VG
Sbjct: 181 WVNYEKVLETSLVG 194

>Kwal_14.807
          Length = 578

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 32/48 (66%), Gaps = 1/48 (2%)

Query: 13  QVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEV 60
           +V +H+  DDCWV + N  +YD++ F+  HPGG  +I   AGKD++ +
Sbjct: 83  EVAKHSKPDDCWVVI-NGYVYDLSDFIAVHPGGPAIIKANAGKDVSAI 129

>Scas_717.14
          Length = 189

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 42/76 (55%), Gaps = 6/76 (7%)

Query: 10  SASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVE-YAGKDITEVMKDGPLHS 68
           + S +Q H S  DCW T+   K+Y V+ +LE HPGG D+I +  AGKD T +        
Sbjct: 114 NNSILQRHTSRTDCW-TIYKGKVYCVSDYLEYHPGGPDIIFQNCAGKDSTVLFN----QY 168

Query: 69  HSFVAYEVLDEEYHVG 84
           HS+V  E L E   +G
Sbjct: 169 HSWVNAEKLLETCLIG 184

>CAGL0K03069g complement(284361..284945) weakly similar to sp|Q04772
           Saccharomyces cerevisiae YMR073c, hypothetical start
          Length = 194

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 34/49 (69%), Gaps = 2/49 (4%)

Query: 11  ASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVE-YAGKDIT 58
           A ++  HN+A+DCW T+ N K+Y ++ +L  HPGG  ++++  +G+D T
Sbjct: 121 AHELARHNTAEDCW-TVINGKVYSISSYLSFHPGGAKILIDKSSGQDST 168

>KLLA0E18535g 1641507..1641953 some similarities with
           ca|CA1511|IPF9972.3eoc Candida albicans unknown
           function, 3-prime end, hypothetical start
          Length = 148

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 41/73 (56%), Gaps = 6/73 (8%)

Query: 19  SADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSHSFVAYEVLD 78
           + D+ W  + NRK+Y +  +L  HPGG  ++ + AGKD+T +        H +V YE L 
Sbjct: 80  NKDNFWCVI-NRKVYCIKAYLSYHPGGEVILKQCAGKDVTSLFN----KYHRWVNYERLL 134

Query: 79  EEYHVG-YLATAE 90
           E   +G Y+ +AE
Sbjct: 135 ETCFIGMYVGSAE 147

>AAL078W [109] [Homologous to ScYGL055W - NSH]
           complement(209600..211378) [1779 bp, 592 aa]
          Length = 592

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 32  IYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSHSFVAYEVL 77
           I+DVT F+ DHPGG  L+V   GKD T    +G +++HS  A  +L
Sbjct: 496 IHDVTPFMHDHPGGMALVVASVGKDATPAF-NGAVYAHSTAARNLL 540

>Scas_563.6
          Length = 497

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 2/74 (2%)

Query: 6   LPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGP 65
           LP++   +  E    +   V +    I+D++ ++ +HPGG  LI +  GKD T   + G 
Sbjct: 396 LPVWDKKEFVEQAQLNKNLVVISG-IIHDISNYIPEHPGGESLIKQALGKDATRAFQGG- 453

Query: 66  LHSHSFVAYEVLDE 79
           ++ HS  A  VL E
Sbjct: 454 VYRHSTAAQNVLSE 467

>Kwal_23.5693
          Length = 513

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 32  IYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSHSFVAYEVL 77
           ++DVT F+ DHPGG  L+    GKD T+   +G ++SHS  A  +L
Sbjct: 410 VHDVTPFIHDHPGGVALVETSIGKDATQAF-NGAVYSHSQAARNLL 454

>Sklu_2032.3 , Contig c2032 4286-5854
          Length = 522

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 32  IYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSHSFVAYEVL 77
           ++DVT F+ DHPGG  L+    GKD T    +G ++SHS  A  +L
Sbjct: 419 VHDVTPFIYDHPGGVTLVETSIGKDATAAF-NGAVYSHSRAARNLL 463

>KLLA0C10692g complement(916718..918280) weakly similar to sp|P21147
           Saccharomyces cerevisiae YGL055w OLE1 stearoyl-CoA
           desaturase singleton, hypothetical start
          Length = 520

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 44/98 (44%), Gaps = 17/98 (17%)

Query: 27  LQNRKIY--------DVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSHSFVAYEVLD 78
           ++NRK Y        DVT F+ DHPGG  L+    GKD T+   +G ++ HS  A  +L 
Sbjct: 404 IKNRKAYVAIEGIVHDVTPFIYDHPGGVTLVETSIGKDATQAF-NGAVYRHSNAARNLL- 461

Query: 79  EEYHVGYLATAEE-------EQKLLGNSKHKVEVKLED 109
               V  +            E+  + N+ H+  +  +D
Sbjct: 462 ATMRVAVITDQSSNIQRTTWEENSIANATHRNNMDRQD 499

>CAGL0I00418g 30058..31530 highly similar to sp|P21147 Saccharomyces
           cerevisiae YGL055w OLE1 stearoyl-CoA desaturase, start
           by similarity
          Length = 490

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 2/72 (2%)

Query: 6   LPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGP 65
           LP ++  +  E N  +D  V +    ++DV+ ++ +HPGG  L+    GKD T+    G 
Sbjct: 386 LPAWTKEEFLEKNRENDGLVIVGG-IVHDVSGYITEHPGGEKLLKNALGKDATKAFSGG- 443

Query: 66  LHSHSFVAYEVL 77
           ++ HS  A+  L
Sbjct: 444 VYRHSNAAHNTL 455

>Sklu_2299.3 YGL055W, Contig c2299 5338-6780 reverse complement
          Length = 480

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 30/46 (65%), Gaps = 1/46 (2%)

Query: 32  IYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSHSFVAYEVL 77
           ++DV+ ++ +HPGG  LI   AGKD T+   +G ++ HS  A+ VL
Sbjct: 404 VHDVSGYITEHPGGETLIQAAAGKDATKAF-NGGVYLHSNAAHNVL 448

>KLLA0C05566g complement(497877..499310) similar to sp|P21147
           Saccharomyces cerevisiae YGL055w OLE1 stearoyl-CoA
           desaturase singleton, start by similarity
          Length = 477

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 40/72 (55%), Gaps = 2/72 (2%)

Query: 6   LPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGP 65
           LP++   +  E   +++  V +    ++DV+ ++ +HPGG  LI    GKD T+   +G 
Sbjct: 379 LPVWDKDEFMEKLKSNNGLVVISG-IVHDVSGYITEHPGGETLIQASLGKDATKAF-NGG 436

Query: 66  LHSHSFVAYEVL 77
           ++ HS  A+ +L
Sbjct: 437 VYLHSNAAHNIL 448

>YMR073C (YMR073C) [4032] chr13 complement(412267..412872) Protein
           containing a heme-binding domain, has a region of
           moderate similarity to a region of flavohemoprotein
           b5+b5R (human b5&b5R), which is an NAD(P)H
           oxidoreductase that may act as an oxygen sensor [606 bp,
           201 aa]
          Length = 201

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 41/76 (53%), Gaps = 7/76 (9%)

Query: 14  VQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKD--ITEVMKDGPLHSHSF 71
           V++H   +D    + N K+YD++ +L+ HPGG D+++++   D  IT   K      H +
Sbjct: 130 VKKHCKGEDELWCVINGKVYDISSYLKFHPGGTDILIKHRNSDDLITYFNK-----YHQW 184

Query: 72  VAYEVLDEEYHVGYLA 87
           V YE L +   +G + 
Sbjct: 185 VNYEKLLQVCFIGVVC 200

>AAR153C [341] [Homologous to ScYGL055W (OLE1) - SH]
           (619953..621389) [1437 bp, 478 aa]
          Length = 478

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 38/72 (52%), Gaps = 2/72 (2%)

Query: 6   LPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGP 65
           LP++  S+    +  +   V +    ++DV+ ++ +HPGG  LI    GKD T    +G 
Sbjct: 378 LPVWDRSEFVRASRENSGLVVISG-IVHDVSGYITEHPGGETLIQAALGKDATRAF-NGG 435

Query: 66  LHSHSFVAYEVL 77
           ++ HS  A+ +L
Sbjct: 436 VYMHSNAAHNIL 447

>Kwal_14.1845
          Length = 288

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 2/72 (2%)

Query: 6   LPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGP 65
           LP++   Q  E+   +   V +    ++DV+ ++ +HPGG  LI     KD T+   +G 
Sbjct: 187 LPVWDKQQFMENIKTNPGLVIISG-IVHDVSNYITEHPGGETLIKAALNKDATKAF-NGG 244

Query: 66  LHSHSFVAYEVL 77
           ++ HS  A+ VL
Sbjct: 245 VYLHSNAAHNVL 256

>YGL055W (OLE1) [1924] chr7 (398629..400161) Stearoyl-CoA desaturase
           (delta-9 fatty acid desaturase), required for synthesis
           of unsaturated fatty acids [1533 bp, 510 aa]
          Length = 510

 Score = 36.2 bits (82), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 32  IYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSHSFVAYEVLDE 79
           ++DV+ ++ +HPGG  LI    GKD T+    G ++ HS  A  VL +
Sbjct: 434 VHDVSGYISEHPGGETLIKTALGKDATKAFSGG-VYRHSNAAQNVLAD 480

>CAGL0M13101g 1286561..1287586 similar to sp|P35735 Saccharomyces
           cerevisiae YKL051w, hypothetical start
          Length = 341

 Score = 32.0 bits (71), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 2/51 (3%)

Query: 296 LLPYYWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKN 346
           L P + ACAG+ G  LGYV      YF    + P  +   K  H+E  Y N
Sbjct: 59  LRPLFIACAGWQG--LGYVITIACEYFQRAGRWPFRMPNSKSPHVEAEYDN 107

>ACL114W [935] [Homologous to ScYJR107W - NSH]
           complement(144800..145759) [960 bp, 319 aa]
          Length = 319

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 31  KIYDVTKFLEDHPGGGDLIVEY----AGKDITEVMKDGPLHSHSFVAYEVLDEEYHV 83
           K++D  K +ED   GG+    Y      +DI  ++  GP+++H+ + + + D +  V
Sbjct: 208 KVFDNVKKVEDLKNGGNPRNAYIRVVQSRDIVPMVPTGPIYTHAGILFTITDVDSEV 264

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.141    0.453 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,859,313
Number of extensions: 581829
Number of successful extensions: 1972
Number of sequences better than 10.0: 50
Number of HSP's gapped: 1991
Number of HSP's successfully gapped: 50
Length of query: 373
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 270
Effective length of database: 13,030,455
Effective search space: 3518222850
Effective search space used: 3518222850
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 62 (28.5 bits)