Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_27.103281271266512e-89
KLLA0D01661g1121023256e-40
YML108W1051063221e-39
AAL184W1121083178e-39
Sklu_767.199923169e-39
CAGL0J06666g1121083047e-37
Scas_650.23*1151052943e-35
ADR015W43670710.11
Kwal_55.2096542171631.00
Sklu_2257.642970631.0
YCR045C49144631.2
KLLA0D13464g43370602.6
KLLA0E03124g77063603.4
Scas_709.341471593.5
YNL262W (POL2)222239594.6
CAGL0J01936g42570584.9
Scas_540.460450585.1
Scas_711.361219125578.1
Scas_712.2756342568.4
Scas_712.54108029578.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10328
         (126 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10328                                                         255   2e-89
KLLA0D01661g complement(148193..148531) similar to sp|Q03759 Sac...   129   6e-40
YML108W (YML108W) [3863] chr13 (54793..55110) Protein of unknown...   128   1e-39
AAL184W [3] [Homologous to ScYML108W - SH] complement(12906..132...   126   8e-39
Sklu_767.1 YML108W, Contig c767 652-951 reverse complement            126   9e-39
CAGL0J06666g complement(636953..637291) similar to sp|Q03759 Sac...   121   7e-37
Scas_650.23*                                                          117   3e-35
ADR015W [1756] [Homologous to ScYIR004W (DJP1) - SH] complement(...    32   0.11 
Kwal_55.20965                                                          29   1.00 
Sklu_2257.6 YIR004W, Contig c2257 8880-10169 reverse complement        29   1.0  
YCR045C (YCR045C) [578] chr3 complement(208130..209605) Member o...    29   1.2  
KLLA0D13464g complement(1159251..1160552) similar to sp|P40564 S...    28   2.6  
KLLA0E03124g 296592..298904 some similarities with sp|P20134 Sac...    28   3.4  
Scas_709.3                                                             27   3.5  
YNL262W (POL2) [4345] chr14 (148211..154879) DNA polymerase epsi...    27   4.6  
CAGL0J01936g complement(190181..191458) highly similar to sp|P40...    27   4.9  
Scas_540.4                                                             27   5.1  
Scas_711.36                                                            27   8.1  
Scas_712.27                                                            26   8.4  
Scas_712.54                                                            27   8.5  

>Kwal_27.10328
          Length = 127

 Score =  255 bits (651), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 126/126 (100%), Positives = 126/126 (100%)

Query: 1   MSKLHTRKRETKSKMSDERAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELIL 60
           MSKLHTRKRETKSKMSDERAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELIL
Sbjct: 1   MSKLHTRKRETKSKMSDERAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELIL 60

Query: 61  PFEIDDMDTLNEWFDKFDAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQS 120
           PFEIDDMDTLNEWFDKFDAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQS
Sbjct: 61  PFEIDDMDTLNEWFDKFDAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQS 120

Query: 121 ERASDV 126
           ERASDV
Sbjct: 121 ERASDV 126

>KLLA0D01661g complement(148193..148531) similar to sp|Q03759
           Saccharomyces cerevisiae YML108w hypothetical protein
           singleton, start by similarity
          Length = 112

 Score =  129 bits (325), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 63/102 (61%), Positives = 79/102 (77%), Gaps = 6/102 (5%)

Query: 18  ERAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWFDKF 77
           E  YRML+L+E+P+ SE   D +K++N     ATHEFVDEL LP ++D+MD LN WFDKF
Sbjct: 5   ENVYRMLILLEEPI-SESAGDTKKKQN-----ATHEFVDELPLPIQVDEMDLLNSWFDKF 58

Query: 78  DAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQ 119
           D +ICIPNEG IKYEISSDGL+VL+LD+S E +V EV  FV+
Sbjct: 59  DEKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVE 100

>YML108W (YML108W) [3863] chr13 (54793..55110) Protein of unknown
           function [318 bp, 105 aa]
          Length = 105

 Score =  128 bits (322), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 79/106 (74%), Gaps = 5/106 (4%)

Query: 15  MSDERAYRMLVLVEDPVKSEGTVDGEKEENTDA-PKATHEFVDELILPFEIDDMDTLNEW 73
           MS    YRMLVL+ED  K    ++ E E+     P   HEFVDELILPF +D++D LN W
Sbjct: 1   MSKSNTYRMLVLLEDDTK----INKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTW 56

Query: 74  FDKFDAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQ 119
           FDKFDAEICIPNEG IKYEISSDGL+VL+LD+  EEVV +V+KFV+
Sbjct: 57  FDKFDAEICIPNEGHIKYEISSDGLIVLMLDKEIEEVVEKVKKFVE 102

>AAL184W [3] [Homologous to ScYML108W - SH] complement(12906..13244)
           [339 bp, 112 aa]
          Length = 112

 Score =  126 bits (317), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 80/108 (74%), Gaps = 6/108 (5%)

Query: 15  MSDERAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWF 74
           M+ +  YRM++L+E+P K   T DG K EN     A+H+FVDEL+LP ++DD++ LN WF
Sbjct: 1   MATDNFYRMMILLEEPHKQHST-DGRKIEN-----ASHDFVDELLLPIQVDDLEVLNTWF 54

Query: 75  DKFDAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQSER 122
           DKFD EICIPNEG IKYEISSDGL+VL+LD+   EV+  VR FV + +
Sbjct: 55  DKFDEEICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQ 102

>Sklu_767.1 YML108W, Contig c767 652-951 reverse complement
          Length = 99

 Score =  126 bits (316), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 55/92 (59%), Positives = 73/92 (79%)

Query: 34  EGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWFDKFDAEICIPNEGFIKYEI 93
           E   D  +E N +  K +HEFVDEL+LP ++D+MD LN+WFDKFD +ICIPNEG+IKYEI
Sbjct: 5   EAIPDSSQENNENTTKTSHEFVDELVLPIQVDEMDLLNDWFDKFDEQICIPNEGYIKYEI 64

Query: 94  SSDGLVVLLLDRSREEVVAEVRKFVQSERASD 125
           SSDGL+VL+L++ REEVV +VR+FV+  +  D
Sbjct: 65  SSDGLIVLILNKEREEVVDKVRRFVEEHQVQD 96

>CAGL0J06666g complement(636953..637291) similar to sp|Q03759
           Saccharomyces cerevisiae YML108w, start by similarity
          Length = 112

 Score =  121 bits (304), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 60/108 (55%), Positives = 79/108 (73%), Gaps = 5/108 (4%)

Query: 19  RAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWFDKFD 78
             YRM+VL+E+P++ + T+   KEE     K  HEF+DEL LPF+ID++D LN+WFDKFD
Sbjct: 3   NLYRMMVLLEEPMEEDITISDSKEEK----KVMHEFMDELTLPFQIDEIDLLNKWFDKFD 58

Query: 79  AEICIPNEGFIKYEISSDGLVVLLLDRS-REEVVAEVRKFVQSERASD 125
            EICIPNEG IKYEI+SDGL+VL+LD+   EE V +V+ FV+     D
Sbjct: 59  DEICIPNEGHIKYEITSDGLIVLILDKELGEEFVGKVKTFVEQNNVED 106

>Scas_650.23*
          Length = 115

 Score =  117 bits (294), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 81/105 (77%), Gaps = 1/105 (0%)

Query: 15  MSDERAYRMLVLVEDPVKSEGTVDGEKEEN-TDAPKATHEFVDELILPFEIDDMDTLNEW 73
           MS +  YRMLVL+E+ ++     D +  ++    PK THEF++EL+LPFE+ ++D LN+W
Sbjct: 1   MSKDNMYRMLVLLEEEMEEPELFDNDTTDSKATEPKKTHEFIEELLLPFEVSELDALNKW 60

Query: 74  FDKFDAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFV 118
           FDKFD EICIPNEG IKYEISSDGL+VLLLD+  E V++EV+KF+
Sbjct: 61  FDKFDEEICIPNEGHIKYEISSDGLIVLLLDKEIENVISEVKKFI 105

>ADR015W [1756] [Homologous to ScYIR004W (DJP1) - SH]
          complement(732201..733511) [1311 bp, 436 aa]
          Length = 436

 Score = 32.0 bits (71), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 12/70 (17%)

Query: 19 RAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWFDKFD 78
          +AYR   + E P K           N + PKAT  F   +   +++   D L   +DKF 
Sbjct: 24 KAYRKKSVQEHPDK-----------NPNDPKATERF-QAISEAYQVLSSDELRAKYDKFG 71

Query: 79 AEICIPNEGF 88
           E  +P  GF
Sbjct: 72 KEEAVPQNGF 81

>Kwal_55.20965
          Length = 421

 Score = 28.9 bits (63), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 32/71 (45%), Gaps = 12/71 (16%)

Query: 18 ERAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWFDKF 77
          ++AYR   + E P           ++N + P AT  F   +   +++   + L   +DK+
Sbjct: 24 KKAYRKKSVQEHP-----------DKNPNDPTATERF-QAISQAYQVLSKEDLRAKYDKY 71

Query: 78 DAEICIPNEGF 88
            E  IP EGF
Sbjct: 72 GKEEAIPKEGF 82

>Sklu_2257.6 YIR004W, Contig c2257 8880-10169 reverse complement
          Length = 429

 Score = 28.9 bits (63), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 29/70 (41%), Gaps = 12/70 (17%)

Query: 19 RAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWFDKFD 78
          +AYR   + E P K           N + P AT  F   +   +++   + L   +DKF 
Sbjct: 24 KAYRKKSVQEHPDK-----------NPNDPSATERF-QSISQAYQVLSNEELRTKYDKFG 71

Query: 79 AEICIPNEGF 88
           E  +P  GF
Sbjct: 72 KEEAVPQNGF 81

>YCR045C (YCR045C) [578] chr3 complement(208130..209605) Member of
           the subtilase family of serine proteases, has moderate
           similarity to S. pombe Isp6p, which is a putative
           subtilase-type proteinase involved in sexual
           differentiation [1476 bp, 491 aa]
          Length = 491

 Score = 28.9 bits (63), Expect = 1.2,   Method: Composition-based stats.
 Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 4/44 (9%)

Query: 38  DGEKEENT----DAPKATHEFVDELILPFEIDDMDTLNEWFDKF 77
           D E+E+N     DAP+          LPF++ D D    WF+ +
Sbjct: 115 DVEEEQNITYQPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYY 158

>KLLA0D13464g complement(1159251..1160552) similar to sp|P40564
          Saccharomyces cerevisiae YIR004w DJP1 DnaJ-like protein
          involved specifically in peroxisomal protein import,
          start by similarity
          Length = 433

 Score = 27.7 bits (60), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 29/70 (41%), Gaps = 12/70 (17%)

Query: 19 RAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWFDKFD 78
          +AYR   + E P K           N D P AT  F   +   +++   + L   +DKF 
Sbjct: 24 KAYRKKSVKEHPDK-----------NPDDPTATERF-QAISEAYQVLSSEELRMKYDKFG 71

Query: 79 AEICIPNEGF 88
           E  +P  GF
Sbjct: 72 KEEAMPKNGF 81

>KLLA0E03124g 296592..298904 some similarities with sp|P20134
           Saccharomyces cerevisiae YOR140w SFL1 transcription
           factor singleton, hypothetical start
          Length = 770

 Score = 27.7 bits (60), Expect = 3.4,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 6/63 (9%)

Query: 33  SEGTVDGEKE-----ENTDAPKATHEFVDELILPFEIDDMDTLNEWFDKFDAEICIPNEG 87
           +EGT + + E     +N+  P+  H F+ +L    E DD+  L  W    D+ +  P E 
Sbjct: 63  TEGTSNVKSEVQPTVQNSSTPQNPH-FIHKLYSMLEDDDLKNLIWWSPSCDSFLIRPTER 121

Query: 88  FIK 90
           F K
Sbjct: 122 FSK 124

>Scas_709.3
          Length = 414

 Score = 27.3 bits (59), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 31/71 (43%), Gaps = 12/71 (16%)

Query: 18 ERAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWFDKF 77
          ++AYR   + E P K           N + P AT  F   +   +++   DTL   +DK+
Sbjct: 23 KKAYRKKSIQEHPDK-----------NPNDPTATERF-QAISEAYQVLSDDTLRLKYDKY 70

Query: 78 DAEICIPNEGF 88
            +  +P  GF
Sbjct: 71 GKKEAVPTGGF 81

>YNL262W (POL2) [4345] chr14 (148211..154879) DNA polymerase epsilon
            large subunit, catalytic subunit essential for DNA
            replication and involved in DNA repair [6669 bp, 2222 aa]
          Length = 2222

 Score = 27.3 bits (59), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 24/39 (61%), Gaps = 2/39 (5%)

Query: 1    MSKLHTRKRETKSKMSDERAYRMLVLVEDP--VKSEGTV 37
            +SKL+ R  +  +K+ +ER  + L+L++ P   K  GT+
Sbjct: 1566 ISKLYRRLSQETTKLKEERGLQFLLLLQSPFITKLLGTI 1604

>CAGL0J01936g complement(190181..191458) highly similar to
          sp|P40564 Saccharomyces cerevisiae YIR004w DJP1, start
          by similarity
          Length = 425

 Score = 26.9 bits (58), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 29/70 (41%), Gaps = 12/70 (17%)

Query: 19 RAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWFDKFD 78
          +AYR   + E P K           N + P AT  F   +   +++   + L   +DKF 
Sbjct: 24 KAYRKKSIQEHPDK-----------NPNDPTATERF-QAISEAYQVLSSEELRAKYDKFG 71

Query: 79 AEICIPNEGF 88
           +  IP  GF
Sbjct: 72 KQEAIPKGGF 81

>Scas_540.4
          Length = 604

 Score = 26.9 bits (58), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 8/50 (16%)

Query: 1   MSKLHTRKRETKSKMSDE-----RAYRMLVLVEDPVKSEGTVDGEKEENT 45
           ++KL  + +ET+SK+ ++     R Y   +L+    K +   DGE+EENT
Sbjct: 270 IAKLQKQHQETQSKLKEQALMELREYLKSILLN---KKKNNSDGEQEENT 316

>Scas_711.36
          Length = 1219

 Score = 26.6 bits (57), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 53/125 (42%), Gaps = 27/125 (21%)

Query: 3   KLHTRKRETKSKMSDERAYR-----MLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDE 57
           KLHT +    +   D++A +     +  +VE+P K                K T E    
Sbjct: 597 KLHTPEANKVTIRGDDKAVKTANKALTSIVENPTKKS--------------KITVEVASN 642

Query: 58  LILPFEIDDMDTLNEWFDKFDAEICIPNEGFIKYEISSDGLVVLL-----LDRSREEVVA 112
            I          LNE  +KFD +I +PN   IK + +    +VL      L+++++ + A
Sbjct: 643 SIARLVGTKGSNLNEIREKFDCQIDVPNHDEIKDKTAE---IVLTGQEYNLEQAKKFIAA 699

Query: 113 EVRKF 117
           E +K+
Sbjct: 700 EAKKW 704

>Scas_712.27
          Length = 563

 Score = 26.2 bits (56), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 12/42 (28%)

Query: 30  PVKSEGTVDGE------------KEENTDAPKATHEFVDELI 59
           PVK+E  V  E            KE N ++ K+T  F+D+L+
Sbjct: 500 PVKTEANVGSESANSNTEQKAIIKESNVESVKSTSTFIDQLV 541

>Scas_712.54
          Length = 1080

 Score = 26.6 bits (57), Expect = 8.5,   Method: Composition-based stats.
 Identities = 13/29 (44%), Positives = 16/29 (55%)

Query: 30  PVKSEGTVDGEKEENTDAPKATHEFVDEL 58
           PVKSEG  D E E+ +D   A     +EL
Sbjct: 779 PVKSEGEFDDESEKESDDDDADENMQEEL 807

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.133    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,150,617
Number of extensions: 183617
Number of successful extensions: 544
Number of sequences better than 10.0: 33
Number of HSP's gapped: 539
Number of HSP's successfully gapped: 33
Length of query: 126
Length of database: 16,596,109
Length adjustment: 89
Effective length of query: 37
Effective length of database: 13,515,107
Effective search space: 500058959
Effective search space used: 500058959
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 55 (25.8 bits)