Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_27.1031892591244800.0
AAL185W10189589901e-118
YML109W (ZDS2)9426545991e-64
Scas_650.229936785752e-61
YMR273C (ZDS1)9156165158e-54
KLLA0D01683g9441015033e-52
CAGL0F03421g8175684932e-51
CAGL0J06688g8283694331e-43
CAGL0H07425g38043740.94
CAGL0J10010g473151722.0
Scas_588.1183549722.2
Sklu_2365.7380146712.6
KLLA0F16665g82277713.2
YBR155W (CNS1)38530693.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10318
         (912 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10318                                                        1730   0.0  
AAL185W [2] [Homologous to ScYML109W (ZDS2) - SH; ScYMR273C (ZDS...   385   e-118
YML109W (ZDS2) [3862] chr13 (51640..54468) Protein involved in r...   235   1e-64
Scas_650.22                                                           226   2e-61
YMR273C (ZDS1) [4227] chr13 complement(811232..813979) Protein t...   202   8e-54
KLLA0D01683g complement(148855..151689) some similarities with s...   198   3e-52
CAGL0F03421g complement(336157..338610) similar to sp|P50111 Sac...   194   2e-51
CAGL0J06688g complement(637917..640403) similar to sp|P54786 Sac...   171   1e-43
CAGL0H07425g 725307..726449 highly similar to sp|P33313 Saccharo...    33   0.94 
CAGL0J10010g complement(979493..980914) similar to sp|P41814 Sac...    32   2.0  
Scas_588.11                                                            32   2.2  
Sklu_2365.7 YBR155W, Contig c2365 9592-10734                           32   2.6  
KLLA0F16665g complement(1535656..1538124) similar to sp|P36159 S...    32   3.2  
YBR155W (CNS1) [340] chr2 (549727..550884) Component of the Hsp9...    31   3.9  

>Kwal_27.10318
          Length = 925

 Score = 1730 bits (4480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 858/912 (94%), Positives = 858/912 (94%)

Query: 1   MDQERDHRASLNNDMRDQSVSGNTXXXXXXXXXXXXVLIAAQSLDSELQHVKNLKRMSFG 60
           MDQERDHRASLNNDMRDQSVSGNT            VLIAAQSLDSELQHVKNLKRMSFG
Sbjct: 1   MDQERDHRASLNNDMRDQSVSGNTRRSARSEKRKSEVLIAAQSLDSELQHVKNLKRMSFG 60

Query: 61  SMDLPLDPEMEFRMXXXXXXXXXXXXXXXLESQAEEPNQXXXXXXXXXXXXXXIELTAHE 120
           SMDLPLDPEMEFRM               LESQAEEPNQ              IELTAHE
Sbjct: 61  SMDLPLDPEMEFRMSPSHSQRSSSSDAVSLESQAEEPNQDDDSDDNLSYLNDSIELTAHE 120

Query: 121 YLEEPRDFLVERSSVSKSEDSHNGRNLSGVRRGGMSKKPRELSNGGDDNVTQNLFWVPAN 180
           YLEEPRDFLVERSSVSKSEDSHNGRNLSGVRRGGMSKKPRELSNGGDDNVTQNLFWVPAN
Sbjct: 121 YLEEPRDFLVERSSVSKSEDSHNGRNLSGVRRGGMSKKPRELSNGGDDNVTQNLFWVPAN 180

Query: 181 QHPNVKPENYLELVQDTLHTLSIDSEVEPPTDKTVEGNNPYLASANTKASPSSQLRSGQN 240
           QHPNVKPENYLELVQDTLHTLSIDSEVEPPTDKTVEGNNPYLASANTKASPSSQLRSGQN
Sbjct: 181 QHPNVKPENYLELVQDTLHTLSIDSEVEPPTDKTVEGNNPYLASANTKASPSSQLRSGQN 240

Query: 241 SLVRRPSGLRKSYTELEDLLQHEIQDSDENNENAQSELNNIIKNRPRATSSGSSLKDITE 300
           SLVRRPSGLRKSYTELEDLLQHEIQDSDENNENAQSELNNIIKNRPRATSSGSSLKDITE
Sbjct: 241 SLVRRPSGLRKSYTELEDLLQHEIQDSDENNENAQSELNNIIKNRPRATSSGSSLKDITE 300

Query: 301 ELTRISNKAGFTDGDAVCLARTLSMASSYDGEQSQANQSANTDHTPDSEYASTILTKNGL 360
           ELTRISNKAGFTDGDAVCLARTLSMASSYDGEQSQANQSANTDHTPDSEYASTILTKNGL
Sbjct: 301 ELTRISNKAGFTDGDAVCLARTLSMASSYDGEQSQANQSANTDHTPDSEYASTILTKNGL 360

Query: 361 AIPARSSLRRSKFNTYRIRTPNGXXXXXXXXXXXXXPNEERKDPEGYIEKSDRLRSPTSV 420
           AIPARSSLRRSKFNTYRIRTPNG             PNEERKDPEGYIEKSDRLRSPTSV
Sbjct: 361 AIPARSSLRRSKFNTYRIRTPNGSSVTSSSLRSTSLPNEERKDPEGYIEKSDRLRSPTSV 420

Query: 421 NDFNEIYDHYRQGSVGSTSEPHAVDNDASSASPFNKSLVHPSHHETHLNEESESSSKHST 480
           NDFNEIYDHYRQGSVGSTSEPHAVDNDASSASPFNKSLVHPSHHETHLNEESESSSKHST
Sbjct: 421 NDFNEIYDHYRQGSVGSTSEPHAVDNDASSASPFNKSLVHPSHHETHLNEESESSSKHST 480

Query: 481 DKTLNYPLEKDGKGNNSKAKNKENKPSGTQILRKKSSWNWFGKKTSKDQDIANDDEQNTF 540
           DKTLNYPLEKDGKGNNSKAKNKENKPSGTQILRKKSSWNWFGKKTSKDQDIANDDEQNTF
Sbjct: 481 DKTLNYPLEKDGKGNNSKAKNKENKPSGTQILRKKSSWNWFGKKTSKDQDIANDDEQNTF 540

Query: 541 SDFLSVSGNAKTSYIPTEKVNHSRHRHYSIDSGSRGSIAADPSKLAVSSSPKKQKREKKF 600
           SDFLSVSGNAKTSYIPTEKVNHSRHRHYSIDSGSRGSIAADPSKLAVSSSPKKQKREKKF
Sbjct: 541 SDFLSVSGNAKTSYIPTEKVNHSRHRHYSIDSGSRGSIAADPSKLAVSSSPKKQKREKKF 600

Query: 601 IQLFKRSRTASTGSRDKEDKVNYLGGTSGNPTDMLKTKASSRNVSKPTLDVQPAKIPTIG 660
           IQLFKRSRTASTGSRDKEDKVNYLGGTSGNPTDMLKTKASSRNVSKPTLDVQPAKIPTIG
Sbjct: 601 IQLFKRSRTASTGSRDKEDKVNYLGGTSGNPTDMLKTKASSRNVSKPTLDVQPAKIPTIG 660

Query: 661 GERRSASLDESSLDKGSDLDQGMEKSVAKLQPSVCLTSKAKNEVSTPVHVVENPQVQGAN 720
           GERRSASLDESSLDKGSDLDQGMEKSVAKLQPSVCLTSKAKNEVSTPVHVVENPQVQGAN
Sbjct: 661 GERRSASLDESSLDKGSDLDQGMEKSVAKLQPSVCLTSKAKNEVSTPVHVVENPQVQGAN 720

Query: 721 KLDGEHQVEPVFESDTDTESETDLQGSLKQGFEVKQSASVEKADTQPVIQLEEPFQQKQA 780
           KLDGEHQVEPVFESDTDTESETDLQGSLKQGFEVKQSASVEKADTQPVIQLEEPFQQKQA
Sbjct: 721 KLDGEHQVEPVFESDTDTESETDLQGSLKQGFEVKQSASVEKADTQPVIQLEEPFQQKQA 780

Query: 781 SRKDVQDSSPVDIEDNAGIDPMAPAAGGYTLPPRKLTFSDVVKPERPNSPMKFSDSSFGF 840
           SRKDVQDSSPVDIEDNAGIDPMAPAAGGYTLPPRKLTFSDVVKPERPNSPMKFSDSSFGF
Sbjct: 781 SRKDVQDSSPVDIEDNAGIDPMAPAAGGYTLPPRKLTFSDVVKPERPNSPMKFSDSSFGF 840

Query: 841 PLPPLTISTVVMIDHRLTINVERAIYRLSHLKLGDPKRELRQQVVLSNFMYAYLNLVNHS 900
           PLPPLTISTVVMIDHRLTINVERAIYRLSHLKLGDPKRELRQQVVLSNFMYAYLNLVNHS
Sbjct: 841 PLPPLTISTVVMIDHRLTINVERAIYRLSHLKLGDPKRELRQQVVLSNFMYAYLNLVNHS 900

Query: 901 LYLQQLEEDNPA 912
           LYLQQLEEDNPA
Sbjct: 901 LYLQQLEEDNPA 912

>AAL185W [2] [Homologous to ScYML109W (ZDS2) - SH; ScYMR273C (ZDS1)
           - SH] complement(9537..12593) [3057 bp, 1018 aa]
          Length = 1018

 Score =  385 bits (990), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 337/958 (35%), Positives = 462/958 (48%), Gaps = 125/958 (13%)

Query: 37  VLIAAQSLDSELQHVKNLKRMSFGSMDLPLDPEMEFRMXXXXXXXXXXXXXXXLESQAEE 96
           VLIAAQSLD ELQ+VKNLKR+S GSMDL +DPEMEFRM                E   E 
Sbjct: 77  VLIAAQSLDYELQNVKNLKRISIGSMDLLMDPEMEFRMNGAAVSPSASPRNSLTEESLEW 136

Query: 97  PNQXXXXXXXXXXXXXXIELTAHEYL----EEPRD-FLVERSSVSKSEDSHNGRNLS--- 148
                              + AH       +  RD  L   SSV  SE+      LS   
Sbjct: 137 FQLSAEQEQGGELPLHAESIDAHSSAGGSSDTARDELLTSASSVVPSEELSCSHPLSPPA 196

Query: 149 GVRRGGMSKKPRELSNGGDDNV----------TQNLFWVPANQHPNVKPENYLELVQDTL 198
             ++  +     +L     D            + NL WV A+QHPNVKPENYLELV DTL
Sbjct: 197 AAKKSTLMSSRSKLGRQHTDTTHTKQATGEPFSSNLLWVRADQHPNVKPENYLELVHDTL 256

Query: 199 HTLSIDSEVEPPTDKTVEGNNPYLASANTKASPSSQLRSGQNSLVRRPSGLRKSYTELED 258
           + L I +       +   G++P +  +NT  +      +   SLVR+ S LRKS+TE+E 
Sbjct: 257 NNLRIGA-------RHGRGDSP-VQQSNTPVANGESSTASARSLVRKQSRLRKSFTEVEA 308

Query: 259 LLQHEIQDSDENNENAQSELNNIIKNRPRATSSGSSLKDITEELTRISNKAGFTDGDAVC 318
           + + +  DS        SE+   +  R R     SSLK+ITEELTRISN AG TD DA+ 
Sbjct: 309 IEESQFTDS------IGSEIP--VGKRMRV----SSLKEITEELTRISNNAGLTDSDAIT 356

Query: 319 LARTLSMASSYDGEQSQANQSANTDHTPDSEYASTILTKNGLAIPARSSLRRSKFNTYRI 378
           LARTL + S    E +  ++   +    ++EYAS+IL KNGLAIPARSSLRRSKF TYRI
Sbjct: 357 LARTLGIGSQSADEHATFSECVPSAEAEENEYASSILAKNGLAIPARSSLRRSKFTTYRI 416

Query: 379 RTPNGXXX---XXXXXXXXXXPNEERKDPEGYIEKSD------RLR------SPTSVNDF 423
           R+                      ER      ++K+       RL       +P S N  
Sbjct: 417 RSAGSDSSPPENKSTSSSSLAAAYERNSRSPKMQKAAFKGSHPRLSGENTSLAPQSPNSI 476

Query: 424 NEIYDHYRQ-----GSVGSTSEPHAVDNDAS-SASPFNKSLVHPSHHETHLNEESESSSK 477
           N+IYDHY       GS      P    +DAS ++SP   S  H + +   ++  S S   
Sbjct: 477 NDIYDHYNTSDTDDGSPELQGSPVTHTSDASFTSSPNIASGEHCARNAHKISPISVSQLS 536

Query: 478 HSTDKTLNYPLEKDGKGNNSKAKNKEN---------KPSGTQI-LRKKSSWNWFG--KKT 525
            ++  + +    K  +   S   ++++            G +I   KK  W+WFG  ++ 
Sbjct: 537 ATSSSSTSPGSSKSAESTKSWTFDQKSPLRSITLNSSTKGHKISAEKKKGWSWFGNSRRP 596

Query: 526 SKDQDI--ANDDEQNTFSDFLSVSGNAKTSYIPTEKV--------NHSRHRHYS-----I 570
           S +  +    D E     +   +         P   V        NHSR+RH +     +
Sbjct: 597 SSESVLLPGTDSEGCPMDESQPIQSEEYPLKHPISPVSDETPRRGNHSRNRHQTSSPEEL 656

Query: 571 DSG----SRGSIAADPSKLAVSSSPK-KQKREKKFIQLFK-RSRTASTGSRDKEDKVNYL 624
           + G    S  ++  D  +      PK K+K EKKF+++FK RS T  +     + + + L
Sbjct: 657 EIGWTETSLTTLDGDTEQDGKPQHPKTKEKLEKKFMKIFKKRSGTGLSQDTPNQGEESSL 716

Query: 625 GGTSGNPTDMLKTKASSRNVSKPTLDVQPA-KIPTIGGERRSASLDESSLDK---GSDLD 680
             TS     + +++ S R   +P+  +  +  +      R+S S+   +  +     + D
Sbjct: 717 KATS----RIRRSRESKRQTDEPSASLTTSVSLNNHNNGRKSVSISRPTWQRTESSYNGD 772

Query: 681 QGMEKSVAKLQPSVCLTSKAKNEVSTPVHVVENPQVQG-ANKLDGEHQVEPVFESDTDTE 739
           +G + S+  LQP+V +TS   +   T     ++PQ Q    K+DG         S     
Sbjct: 773 KG-KGSITSLQPAVSVTSSRDSHEQT----RQDPQPQSLVTKMDGS--------SSNGVT 819

Query: 740 SETDLQGSLKQGFEVKQSASVEKA----DTQPVIQLEEPFQQKQASRKDVQDSSPVDIED 795
             +   G  K+G   K S S  K     D  PV        QK     +   S   D   
Sbjct: 820 VSSQRAGFSKKG-RSKTSHSRSKLSTSHDIAPVDNRPSDVDQKSTEANNTLSSRAED--S 876

Query: 796 NAGIDP----MAPAAGGYTLPPRKLTFSDVVKPERPNSPMKFSDSSFGFPLPPLTISTVV 851
           +  +DP    + P    ++LPPRKL F DV++PE+PNSPMKF+ S+FGFPLPPLT+STV+
Sbjct: 877 HPSLDPGKSALGPGEIAHSLPPRKLRFDDVLRPEKPNSPMKFTPSAFGFPLPPLTVSTVI 936

Query: 852 MIDHRLTINVERAIYRLSHLKLGDPKRELRQQVVLSNFMYAYLNLVNHSLYLQQLEED 909
           M DHRL I VERAIYRLSHLKL DPKRELRQQV+LSNFMY+YLNLVNHSLYLQQ+EED
Sbjct: 937 MFDHRLPIYVERAIYRLSHLKLSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQQIEED 994

>YML109W (ZDS2) [3862] chr13 (51640..54468) Protein involved in
           regulation of transcriptional silencing and life span,
           multicopy suppressor of sin4 [2829 bp, 942 aa]
          Length = 942

 Score =  235 bits (599), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 212/654 (32%), Positives = 310/654 (47%), Gaps = 105/654 (16%)

Query: 37  VLIAAQSLDSELQHVKNLKRMSFGSMDLPLDPEMEFRMXXXXXXXXXXXXXXXLESQAEE 96
           VLIAA+SLD+E+Q+VKNLKR+S GSMDL +DPE+EF++                ES  EE
Sbjct: 52  VLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVNSRNSYSSDSSKESLQESLHEE 111

Query: 97  -------------PNQXXXXXXXXXXXXXXIELTAHEYLEEPRDFLVER-------SSVS 136
                         +               I++T  EYL +      E+       S+ S
Sbjct: 112 NIIRSEQKEEQGSEDNDAYEEGDATNVDDSIDITQTEYLHDEETLEKEKIIRNASSSTSS 171

Query: 137 KSEDSHNGRNLSGVRRGGMSKKPRELSNGGDD---NVTQNLFWVPANQHPNVKPENYLEL 193
            +  +   R LSGV+         ++ N  D    ++TQNL WVPA+QHPNVKPENYLEL
Sbjct: 172 SARVTSRNRRLSGVKTLA-HDVVLDVENDHDSKMVDLTQNLLWVPADQHPNVKPENYLEL 230

Query: 194 VQDTLHTLSIDSEVEPPTDKTVEGNNPYLASANTKASPSSQLRSGQNSLVRRPSGLRKSY 253
           +QDTL  + I +  +   +K   GNN  +         S++ R+G  S+VRRPS L+ SY
Sbjct: 231 IQDTLQNIQISTNQDIDENKLELGNNHVI---------SNRKRTG--SVVRRPSRLKTSY 279

Query: 254 TELEDLLQHEIQDSDENNENAQSELNNIIKNRPRATSSGSSLKDITEELTRISNKAGFTD 313
           T+ +D    E   +D+  E  + +++  I +    T    SLK+ITEELT+ISN AG TD
Sbjct: 280 TKFDD----EPPLADKPQE-GEIQVDKRISSSDIKTIRSVSLKEITEELTKISNNAGLTD 334

Query: 314 GDAVCLARTLSMASSYDGEQSQANQSANTDHTP-DSEYASTILTKNGLAIPARSSLRRSK 372
            DAV LAR+LSM+ S+  E        N +HT  D+E+AS +  + GL IP RSSLRRSK
Sbjct: 335 SDAVTLARSLSMSGSFTNESLH----LNGNHTENDNEFASNMFNETGLTIPERSSLRRSK 390

Query: 373 FNTYRIRTPNGX--XXXXXXXXXXXXPNEERKDPEGYIEKSDRLRSPTSVNDFNEIYDHY 430
           FNTY+IR                    N+ R+        +   +   S+NDF+EI+DHY
Sbjct: 391 FNTYKIRLEGSSLPQAVKLNSLMNIQTNDNRRSASSPASYTQVPQEQASLNDFHEIFDHY 450

Query: 431 RQGSVGSTSEPHAVDNDASSASPFNKSLVHPSHHETHLNEESESSSKHSTDKTLNYPLEK 490
           R+ S   ++E      D+++     + L H S         S+ SS  STD + N  L K
Sbjct: 451 RRTSTDWSTENEKY-VDSTNYYSDEEDLTHASI--------SQESSLLSTDSSNNSVLIK 501

Query: 491 DGKGNNSKAKNKENKPSGTQILRKKSS-----WNWF----GKKTSKDQDI---------- 531
                +  ++  +   S ++     +S     W+W     G   + +Q            
Sbjct: 502 PHNTGSMISEKLDQHVSSSEKSNTNNSEANHGWSWLNSSNGSLNANEQTYQQLTDDEDDE 561

Query: 532 -ANDDEQNTFSDFLSVSGNAKTSYIPTEKVNHSRHRH---YSIDSGSRGSIAADPSKLAV 587
              D+E+  F + LSVS  AK++   +E++NHS++RH   + I S    S+   PS ++ 
Sbjct: 562 ECVDNEKADFVN-LSVSRRAKSTKRASERINHSKNRHSPIFQIHSEEAKSVVITPSVVSS 620

Query: 588 S-------------------------SSPKKQKREKKFIQLFKRSRTASTGSRD 616
           S                         S+ KK   EK+  +LFKR +   T   D
Sbjct: 621 SESQPSKPTAPAVVEKKVELPTDTQASTHKKNSLEKRLAKLFKRKQHNGTCKSD 674

 Score =  177 bits (448), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 81/113 (71%), Positives = 94/113 (83%), Gaps = 4/113 (3%)

Query: 794 EDNAGIDPMAPAAGGYTLPPRKLTFSDVVKPERPNSPMKFSDSSFGFPLPPLTISTVVMI 853
           EDN    P AP     TLPPRKLTF DVVKP+  N+P+KF+DS+FGFPLP +T STV+M 
Sbjct: 804 EDNTS--PTAPQIS--TLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMF 859

Query: 854 DHRLTINVERAIYRLSHLKLGDPKRELRQQVVLSNFMYAYLNLVNHSLYLQQL 906
           DHRL INVERAIYRLSHLKL DP RELRQQV+LSNFMY+YLNLVNH+LY++Q+
Sbjct: 860 DHRLGINVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQV 912

>Scas_650.22
          Length = 993

 Score =  226 bits (575), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 212/678 (31%), Positives = 304/678 (44%), Gaps = 151/678 (22%)

Query: 37  VLIAAQSLDSELQHVKNLKRMSFGSMDLPLDPEMEFRMXXXXXXXXX-----XXXXXXLE 91
           VLIAAQSLD+E+Q VKNLKR+S GSMDL +DPE+EFR+                    LE
Sbjct: 28  VLIAAQSLDNEVQSVKNLKRLSIGSMDLLIDPELEFRVNNDKSNQSTPIGSYERSNENLE 87

Query: 92  SQAEEPNQXXXXXXXXXXXXXXIELTAHEYLEEPRDFLVERSSVSKSEDSHNGRNLSG-- 149
            Q  EP +              IELT  EYL +       R +V+  E SH  R++SG  
Sbjct: 88  -QINEP-EDNENDESSVSIDDSIELTQTEYLHDASVPQTNR-TVTPEEPSH--RSMSGAG 142

Query: 150 -VRRGGMSKKPREL---SNGGD-----------------------------DNVTQNLFW 176
            ++R G S   R+L   S G                               D++T+NL W
Sbjct: 143 SLKRNGSSISKRKLPFISTGMSAAPTSHLSPSSTSTSSSSSSSSNSASSSPDDLTKNLLW 202

Query: 177 VPANQHPNVKPENYLELVQDTLHTLSIDSEVEPPTDKTVEGNNPYLASANTKASPSS--- 233
           VPANQHPNVKPENYLELVQDTL  + ++   EP +    E         N   S S+   
Sbjct: 203 VPANQHPNVKPENYLELVQDTLQNIHLE---EPASSLQHENEKSNNNKENIDISKSNMSE 259

Query: 234 ----------------QLRSGQNSLVRRPSGLRKSYTELEDLLQHEIQDSDENNENAQSE 277
                           ++ +   SLVRRPS LR SYTE E       +D   N+E ++++
Sbjct: 260 EEPIDRHPQSLDKTFLEITNRNRSLVRRPSRLRTSYTEFE-------EDDYSNSEESEAK 312

Query: 278 LN-----------------NIIKNRPRATSSGSSLKDITEELTRISNKAGFTDGDAVCLA 320
            N                 N +      +    SLKDITEELT ISNKAG TD DA+ LA
Sbjct: 313 TNESQLSSREEKPFLFNDRNGLNQLRNFSQRSVSLKDITEELTNISNKAGLTDSDAITLA 372

Query: 321 RTLSMASSY-DGEQSQANQSANTDHTPDSEYASTILTKNGLAIPARSSLRRSKFNTYRIR 379
           RTLSMASS+ DG  +        +   +SE+AS +  KNGL IP RSSLRRSKFNTYRIR
Sbjct: 373 RTLSMASSFSDGNVNLGKSKLQNESNEESEFASNMFMKNGLTIPERSSLRRSKFNTYRIR 432

Query: 380 TPNGXX----------XXXXXXXXXXXPNEERKDPEGYIEKSDRLRSPTSV-NDFNEIYD 428
           + +                         ++ ++ P  +  +   L + TS     +++YD
Sbjct: 433 STSSSTSTREKTSPLLQSSSFARQEADTDDLQRSPVSFTNRDSYLATTTSSPGSISDLYD 492

Query: 429 HYR---QGSVGSTSEPHAVDNDASSASPFNKS------------LVHPSHHETHLNEESE 473
           HY+   +   G+ ++  A   D S AS   +S            LV P   ++ ++E  +
Sbjct: 493 HYQDNAESKQGNDNDNEARQGDLSHASISQESSFLSNESSNDSILVKPLGSKSMIHENLD 552

Query: 474 SSSKHSTDKTLNYPLEKDGKGNNSKAKNKENKPSGTQILRKKSSWNWFGKKTSKDQDI-- 531
           +   H  D+      +K  K N +        P  ++   K++ W+W G + + ++D   
Sbjct: 553 NGQDHDDDQP---AYQKVSKLNPT-------IPDTSRSKHKRNGWSWSGNRANSEEDATV 602

Query: 532 ---ANDDEQNTFSDFLSVSGNAKTSYIPTEKVNHSRHRHYSIDSGSRGSIAADPSKLAVS 588
              + D++Q  ++D                    S+ RH  I + SR  +  +       
Sbjct: 603 LVNSQDEDQTGYTD------------------QKSKSRHRPILARSRDHLKINKEAELPK 644

Query: 589 SSPKKQKREKKFIQLFKR 606
            S K++  EK+F++LF+R
Sbjct: 645 ESHKRETIEKRFVKLFRR 662

 Score =  176 bits (446), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 79/126 (62%), Positives = 102/126 (80%)

Query: 781 SRKDVQDSSPVDIEDNAGIDPMAPAAGGYTLPPRKLTFSDVVKPERPNSPMKFSDSSFGF 840
           + ++V +SS +   +N+  D        + LP RKLTF+DV +P+RPN+P++F+DS+FGF
Sbjct: 820 AERNVMNSSDLQSIENSSDDINTGNTIEHVLPARKLTFADVKRPDRPNAPIQFTDSAFGF 879

Query: 841 PLPPLTISTVVMIDHRLTINVERAIYRLSHLKLGDPKRELRQQVVLSNFMYAYLNLVNHS 900
           PLP LT+STV+M DHRL INVERAIYRLSHLKL D KRELRQQV+LSNFMYAYLNLVNH+
Sbjct: 880 PLPMLTVSTVIMFDHRLGINVERAIYRLSHLKLSDSKRELRQQVLLSNFMYAYLNLVNHT 939

Query: 901 LYLQQL 906
           LY++Q+
Sbjct: 940 LYMEQV 945

>YMR273C (ZDS1) [4227] chr13 complement(811232..813979) Protein that
           regulates SWE1 and CLN2 transcription, Sir3p
           phosphorylation, rDNA recombination and silencing, and
           life span, involved in high calcium tolerance and
           regulation of beta-1,3 glucan biosynthesis [2748 bp, 915
           aa]
          Length = 915

 Score =  202 bits (515), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 193/616 (31%), Positives = 280/616 (45%), Gaps = 103/616 (16%)

Query: 37  VLIAAQSLDSELQHVKNLKRMSFGSMDLPLDPEMEFRMXXXXXXXXXXXXXXXLESQAEE 96
           VLIAAQSLD+E++ VKNLKR+S GSMDL +DPE++ +                  S A  
Sbjct: 30  VLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFGGESSGRRSWSGTTS--SSASM 87

Query: 97  PNQXXXXXXXXXXXXXXIELTAHEYLEEPRDFLVERSSVSKSEDSHNGRNLSGVRRGGMS 156
           P+                + T  E L    +  +E S+ +K        N  G+++G  S
Sbjct: 88  PSDTTTVNNTRYS-----DPTPLENLHGRGNSGIESSNKTKQ------GNYLGIKKGVHS 136

Query: 157 KKPRELSNGGDDNVTQNLFWVPANQHPNVKPENYLELVQDTLHTLSIDSEVEPPTDKTVE 216
              +  +N     + +NL WVPANQHPNVKP+N+LELVQDTL  + +    E     + E
Sbjct: 137 PSRKLNANV----LKKNLLWVPANQHPNVKPDNFLELVQDTLQNIQLSDNGEDNDGNSNE 192

Query: 217 GNN-----------PYLASANTKASPSSQL-RSGQNSLVRRPSGLRKSYTEL-EDLLQHE 263
            N+            Y    N   + +  L R G  SL+RRPS LR+SYTE  ++     
Sbjct: 193 NNDIEDNGEDKESQSYENKENNTINLNRGLSRHGNASLIRRPSTLRRSYTEFDDNEDDDN 252

Query: 264 IQDSDENNENAQSELNNIIKNRPRATSSGSSLKDITEELTRISNKAGFTDGDAVCLARTL 323
             DS     N   E  + IK RP       SL+DITEELT+ISN AG TD DA+ LARTL
Sbjct: 253 KGDSASETVNKVEERISKIKERP------VSLRDITEELTKISNSAGLTDNDAITLARTL 306

Query: 324 SMASSYDGEQSQANQSANTDH------------TPDSEYASTILTKNGLAIPARSSLRRS 371
           SMA SY  ++ Q     + D               D E+AS +   N +  P RSSLRRS
Sbjct: 307 SMAGSYSDKKDQPQPEGHYDEGDIGFSTSQANTLDDGEFASNMPINNTMTWPERSSLRRS 366

Query: 372 KFNTYRIRTPNGXXXXXXXXXXXXXPNEER---------------KDP-EGYIEKSDRLR 415
           +FNTYRIR+                 +EER               K P     E S+ + 
Sbjct: 367 RFNTYRIRSQEQEKEVEQSVDEMKNDDEERLKLTKNTIKVEIDPHKSPFRQQDEDSENMS 426

Query: 416 SPTSVNDFNEIYDHYRQGSVGSTSEPHAVDNDASSASPFNKSLVHPSHHETHLNEESESS 475
           SP S+ DF +IY+HYRQ S G   +   ++ +A            P        E+    
Sbjct: 427 SPGSIGDFQDIYNHYRQSS-GEWEQEMGIEKEAEEV---------PVKVRNDTVEQDLEL 476

Query: 476 SKHSTDKTLNYPLEKDGKGNNSKAKNKENKPSGTQILRKKSSWNWFGKKTSKDQDIANDD 535
            + +TD  +  P   D         NKE     T+  R+++ W W   K S++    +D+
Sbjct: 477 REGTTD--MVKPSATDD--------NKE-----TKRHRRRNGWTWLNNKMSRE----DDN 517

Query: 536 EQNTFSDFLSVSGNAKTSYIPTEKVNHSRHRHYSIDSGSRGSIAADPSKL-----AVSSS 590
           E+N   D      N +       ++++S+  + S+ +G   +  ++  ++     + ++S
Sbjct: 518 EENQGDD-----ENEENVDSQRMELDNSKKHYISLFNGGEKTEVSNKEEMNNSSTSTATS 572

Query: 591 PKKQKREKKFIQLFKR 606
             +QK EK F  LF+R
Sbjct: 573 QTRQKIEKTFANLFRR 588

 Score =  179 bits (455), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 92/168 (54%), Positives = 122/168 (72%), Gaps = 13/168 (7%)

Query: 755 KQSASVEKADT-QPVIQLEEPFQQKQASRKDVQDSSPVD----IEDNAGIDP----MAPA 805
           + S  V+K +T +   QL+ P Q++  +   VQ S+PV     ++ +A ++      APA
Sbjct: 737 QHSKHVQKENTDEQKAQLQAPAQEQVQTSVPVQASAPVQNSAPVQTSAPVEASAQTQAPA 796

Query: 806 A----GGYTLPPRKLTFSDVVKPERPNSPMKFSDSSFGFPLPPLTISTVVMIDHRLTINV 861
           A        LPPRKLTF+DV KP++PNSP++F+DS+FGFPLP LT+STV+M DHRL INV
Sbjct: 797 APPLKHTSILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINV 856

Query: 862 ERAIYRLSHLKLGDPKRELRQQVVLSNFMYAYLNLVNHSLYLQQLEED 909
           ERAIYRLSHLKL + KR LR+QV+LSNFMYAYLNLVNH+LY++Q+  D
Sbjct: 857 ERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVAHD 904

>KLLA0D01683g complement(148855..151689) some similarities with
           sp|P54786 Saccharomyces cerevisiae YML109w ZDS2
           multicopy suppressor of SIN4, hypothetical start
          Length = 944

 Score =  198 bits (503), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 96/101 (95%)

Query: 809 YTLPPRKLTFSDVVKPERPNSPMKFSDSSFGFPLPPLTISTVVMIDHRLTINVERAIYRL 868
           Y LPPRKLTF+DV+KP+RPNSPMKF+DS+FGFPLPPLTISTV+M DHRL I+VERAIYRL
Sbjct: 822 YPLPPRKLTFADVLKPDRPNSPMKFTDSAFGFPLPPLTISTVIMFDHRLPIHVERAIYRL 881

Query: 869 SHLKLGDPKRELRQQVVLSNFMYAYLNLVNHSLYLQQLEED 909
           SHLKL DPKR LRQQV+LSNFMYAYLNLVNHSLYLQQ+EE+
Sbjct: 882 SHLKLSDPKRVLRQQVLLSNFMYAYLNLVNHSLYLQQIEEE 922

 Score =  149 bits (375), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 98/218 (44%), Positives = 135/218 (61%), Gaps = 26/218 (11%)

Query: 167 DDNVTQNLFWVPANQHPNVKPENYLELVQDTLHTLSIDSEVEPPTDKTVEGNNPYLASAN 226
           ++++ QNL WV A+QHPNVKPENYLELVQ+TL  +++     P  ++T   +   L +  
Sbjct: 185 NESLGQNLLWVRADQHPNVKPENYLELVQNTLENMNLGGR-SPTANETQAQSLSGLKTLR 243

Query: 227 TKASPSSQLRSGQNSLVRRPSGLRKSYTELEDLLQHEIQDSDENNENAQSELNNIIKNRP 286
            ++     ++SG NSL RRPS LR SYTEL            E++E+       +    P
Sbjct: 244 KRS-----MQSG-NSLARRPSRLRTSYTELS-----------EDDEDKGMTDQPLAAAAP 286

Query: 287 RATSSGS-SLKDITEELTRISNKAGFTDGDAVCLARTLSMA--SSYDGE-QSQANQSANT 342
             +S  + SLKDITEELT++SN+AG TD DAV LARTL +A  S+ D   Q  +N  A+ 
Sbjct: 287 TMSSRRTVSLKDITEELTKLSNQAGLTDTDAVTLARTLWVADESTTDSTGQGLSNNLADE 346

Query: 343 DHTPDSEYASTILTKNGLAIPARSSLRRSKFNTYRIRT 380
           +     E+AST+ TK+G  +PAR SLRRSKFNTYRI++
Sbjct: 347 EE----EFASTMFTKSGFTVPARHSLRRSKFNTYRIQS 380

 Score = 66.2 bits (160), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 28/38 (73%), Positives = 35/38 (92%)

Query: 37 VLIAAQSLDSELQHVKNLKRMSFGSMDLPLDPEMEFRM 74
          VLIAAQSLD E++HVKNLKR+S GSMDL +DPE+E+R+
Sbjct: 13 VLIAAQSLDQEVKHVKNLKRLSIGSMDLLMDPELEYRV 50

>CAGL0F03421g complement(336157..338610) similar to sp|P50111
           Saccharomyces cerevisiae YMR273c ZDS1, hypothetical
           start
          Length = 817

 Score =  194 bits (493), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 190/568 (33%), Positives = 266/568 (46%), Gaps = 120/568 (21%)

Query: 37  VLIAAQSLDSELQHVKNLKRMSFGSMDLPLDPEMEFRMXXXXXXXXXXXXXXXLESQAEE 96
           V IAAQSLD EL+ VKNLKR+S GSMDL +DPEM+                    +Q E+
Sbjct: 8   VYIAAQSLDKELRSVKNLKRLSIGSMDLLMDPEMDM-------LPYNNGYRNSWSTQLEQ 60

Query: 97  PNQXXXXXXXXXXXXXXIELTAHEYL----EEPRDFLVERSSVSKSEDSHNGRNLSGVRR 152
            ++               ++   E L     +P+    E++ V  ++    G   S  RR
Sbjct: 61  GDKPLKSTRYSDPTHYNSKIVRQERLPFKQNQPQKSDKEQTQVENTK-KQPGSPKSLTRR 119

Query: 153 GGM---SKKPRELSNGGD----------DNVTQNLFWVPANQHPNVKPENYLELVQDTLH 199
           G +   S++P + SN             D V QNL WV A+QHPNVKPENY+ELVQD LH
Sbjct: 120 GAVNFSSRRPVDRSNHSKNSSKINDTLPDEVAQNLLWVRADQHPNVKPENYIELVQDALH 179

Query: 200 TLSIDS--EVEPPTDKTVEGNNPYLASANTKASPSSQLRSGQNSLVRRPSGLRKSYTELE 257
            + ID   E +     T++  + Y  S N K SP++        LVRRPS LRKSYTE +
Sbjct: 180 NIQIDKTEEHDKENSDTLDKVSRYYNS-NNKRSPNN------TGLVRRPSLLRKSYTEFD 232

Query: 258 DLLQHEIQDSDENNENAQSELNNIIKNRPRATSSGSSLKDITEELTRISNKAGFTDGDAV 317
                E++DSD      QS  NN + + P   +   +LKDITEELTRISNKAG T+ DAV
Sbjct: 233 -----EVKDSD---IKEQSSTNNNVDSTPH--NKKFTLKDITEELTRISNKAGLTNNDAV 282

Query: 318 CLARTLSMASSY------------DGEQSQANQSANTDHTPDSEYASTILT-KNGLAIPA 364
            LARTLSMAS              + E   A QS N     D  YAST+L   + L    
Sbjct: 283 TLARTLSMASVAEEDETDDLQERPEAEDDYARQSRNN----DDNYASTMLLPTDSLIKSE 338

Query: 365 RSSLRRSKFNTYRIRTPNGXXXXXXXXXXXXXPNEERKDPEGYIEKSDRLR-----SPTS 419
            S+L+RSK+ TY IRT                  +E KDP   +    + +     SP S
Sbjct: 339 HSTLKRSKY-TYHIRT------------------QEDKDPTIPVSTESQHQDVIEASPGS 379

Query: 420 VNDFNEIYDHYRQGSVGSTSEPHAVDNDASSASPFNKSLVHPSHHETHLNEESESSSKHS 479
           +ND   IYDHYR        EP    +     +P N++       +   + + +S++K  
Sbjct: 380 IND---IYDHYR--------EPSGDWSSLIQVAPENEN-------KKRTDTDIDSNTKIV 421

Query: 480 TDKTLNYPLEKDGKGNNSKAKNKENKPSGTQILRKKSSWNWFGKKTSKDQDIANDDEQNT 539
              T +  L   G   + K+   + +P+     +K++ W W   KTS+  ++ +D  +N 
Sbjct: 422 QHSTEHVDLGSTGHSTSDKSDINKKEPAHR---KKRNGWLW-SSKTSEKVNVTSDKHEN- 476

Query: 540 FSDFLSVSGNAKTSYIPTEKVNHSRHRH 567
                          +P  + NHS++RH
Sbjct: 477 ------------EDIVPESRFNHSKNRH 492

 Score =  157 bits (398), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 84/94 (89%)

Query: 812 PPRKLTFSDVVKPERPNSPMKFSDSSFGFPLPPLTISTVVMIDHRLTINVERAIYRLSHL 871
           PPRKLTF+DV K ++ N+P++F+DS+FGFPLP LT STV+M DHRL I+VERAIYRLSHL
Sbjct: 722 PPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYRLSHL 781

Query: 872 KLGDPKRELRQQVVLSNFMYAYLNLVNHSLYLQQ 905
           KL + KR LR+QV+LSNFMY+YLNLVNH+LY++Q
Sbjct: 782 KLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815

>CAGL0J06688g complement(637917..640403) similar to sp|P54786
           Saccharomyces cerevisiae YML109w ZDS2 or sp|P50111
           Saccharomyces cerevisiae YMR273c ZDS1, hypothetical
           start
          Length = 828

 Score =  171 bits (433), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 140/369 (37%), Positives = 183/369 (49%), Gaps = 47/369 (12%)

Query: 38  LIAAQSLDSELQHVKNLKRMSFGSMDLPLDPEMEFRMXXXXXXXXXXXXXXXLESQAEEP 97
           L AAQSLD E+Q+VKNLKR+S GS+DL  DPE+   +                 S  EE 
Sbjct: 24  LRAAQSLDQEVQNVKNLKRLSIGSIDLITDPELNVTVTGTEREDTSYDADLSNGSFTEED 83

Query: 98  NQXXXXX-XXXXXXXXXIELTAHEYL-----------EEPRDFLVERS------SVSKSE 139
           +                I+ T  EYL           E P+     RS      + S S+
Sbjct: 84  DTTTEIDGSDADETSASIDRTRVEYLTSYDNTQESSNESPKGVARTRSLNLNYHANSNSD 143

Query: 140 DSHNGRNLSGVRRGGMSKKPRELSNGGDDNVTQNLFWVPANQHPNVKPENYLELVQDTLH 199
            S   R L G R     KKP+      + +V+  LFWVPANQHPNVKPENYLELV++TL+
Sbjct: 144 ISIKERTLRGSRSLSNLKKPK----NEEQSVSDKLFWVPANQHPNVKPENYLELVKETLN 199

Query: 200 TLSIDSEVEPPTDKTVEGNNPYLASANTKASPSSQLRSGQNSLVRRPSGLRKSYTEL--E 257
            +    ++     +  E N+    S     + + +LR    S+VRRPS LRKSYTE   E
Sbjct: 200 KI---RDINTDGKEKSENNSEEEVSNKENINENGRLRG---SIVRRPSKLRKSYTEFSSE 253

Query: 258 DLLQHEIQDSDENNENAQSELNNIIKNRPRATSSGSSLKDITEELTRISNKAGFTDGDAV 317
           DL   E+ D   +N       N II  R    S   SLK+IT EL + SNKAG TD +AV
Sbjct: 254 DL---ELLDKALSN-------NRIISTRNTTNSKRLSLKEITNELVKHSNKAGLTDDNAV 303

Query: 318 CLARTLSMASSYDGE-------QSQANQSANTDHTPDSEYASTILTKNGLAIPARSSLRR 370
            LARTLS+ASS   +       QS   Q   ++   D  +A+ ++  +       SSLRR
Sbjct: 304 TLARTLSIASSVTNQNETGRNDQSNTEQQKQSEDADDDTFATAVVGNSHSLASNTSSLRR 363

Query: 371 SKFNTYRIR 379
           SKFNTYR++
Sbjct: 364 SKFNTYRVK 372

 Score =  168 bits (426), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 86/97 (88%)

Query: 813 PRKLTFSDVVKPERPNSPMKFSDSSFGFPLPPLTISTVVMIDHRLTINVERAIYRLSHLK 872
           P+KLTF DV KPER N+PM+F+DS+FGFPLPPLTISTV+M DHRL INVERAIYRLSHLK
Sbjct: 696 PKKLTFDDVKKPERANAPMEFTDSAFGFPLPPLTISTVIMCDHRLGINVERAIYRLSHLK 755

Query: 873 LGDPKRELRQQVVLSNFMYAYLNLVNHSLYLQQLEED 909
           L +  RELRQQV+LSNFMYAYLNLV H+L +++ E+D
Sbjct: 756 LSETNRELRQQVLLSNFMYAYLNLVEHTLSVEEAEQD 792

>CAGL0H07425g 725307..726449 highly similar to sp|P33313
           Saccharomyces cerevisiae YBR155w CNS1, hypothetical
           start
          Length = 380

 Score = 33.1 bits (74), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 2/43 (4%)

Query: 802 MAPAAGGYTLPPRKLTFSDVVKPERPNSPMKFSDSSFGFPLPP 844
           M    GG     +KLTF D+++ E+PN P+   DS+    L P
Sbjct: 320 METEGGGLVKAGKKLTFHDILRKEKPNVPL--FDSALKVFLVP 360

>CAGL0J10010g complement(979493..980914) similar to sp|P41814
           Saccharomyces cerevisiae YNL062c GCD10, start by
           similarity
          Length = 473

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 66/151 (43%), Gaps = 29/151 (19%)

Query: 128 FLVERSSVSK----SEDSHNG-RNLSGVR----------RGGM---SKKPRELSNGGDDN 169
           FLVE+  + +    SE+S     NL+ +R           GG+   +   R      D +
Sbjct: 202 FLVEKGDIQRVLDLSEESLGMILNLTNIRSDGTYLCMDETGGLIVYTMLERMFGGKEDLD 261

Query: 170 VTQNLFWVPANQHPNV---KPENYLE-LVQDTLHTLSIDSEVEPPTDKTVEGNNPYLASA 225
               +  +  N+HPN+   K  NY E  ++  + TLSI     PPT + VEG    L+  
Sbjct: 262 APGKIVVINENEHPNLDLLKFSNYSEKFIEKHVVTLSILDYFRPPTMEEVEGRFTPLSKE 321

Query: 226 NTKASPSSQLRSGQNSLVRRPSGLRKSYTEL 256
                  ++L+SG+ S   R   L+  YT+L
Sbjct: 322 EV-----NKLKSGKRSAYSRK--LKWYYTQL 345

>Scas_588.11
          Length = 835

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 403 DPEGYIEKSDRLRSPTSVNDFNEIYD-HYRQGSVGSTSEPHAVDNDASS 450
           D   Y++  DRL S   V DFNE+Y   Y +    +TS P  +DN  + 
Sbjct: 555 DLVRYLQTKDRLISLQKVVDFNELYKVKYTELQRKATSLPSMIDNTVNC 603

>Sklu_2365.7 YBR155W, Contig c2365 9592-10734
          Length = 380

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 63/146 (43%), Gaps = 20/146 (13%)

Query: 688 AKLQPSVCLTSKAKNEVSTPVHVVENPQVQGANKLDGEHQVEPVFESDT--DTESETDLQ 745
           A LQ +V + + +    S P  +V++ ++   N+ D E Q+  +F S     T  E D  
Sbjct: 221 AILQAAVVVRNISIVNTSQPPELVKDAKISLENEEDIESQL--IFPSMVMYPTTDEFDFV 278

Query: 746 GSLKQGFEVKQSASVEKADTQPVIQLEEPFQQKQASRKDVQDSSPVDIEDNAGIDPMAPA 805
           GS+ +        S  +   + V+Q  E + QK             +      I  M   
Sbjct: 279 GSVGE-------LSTPQDLLELVMQRPEEWFQKPGHE---------NFTTKKLIGYMETE 322

Query: 806 AGGYTLPPRKLTFSDVVKPERPNSPM 831
           AGG     +K++F DV+K E+PN P+
Sbjct: 323 AGGLIKVGKKVSFHDVLKMEKPNVPL 348

>KLLA0F16665g complement(1535656..1538124) similar to sp|P36159
           Saccharomyces cerevisiae YKR079c singleton, start by
           similarity
          Length = 822

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 33/77 (42%), Gaps = 7/77 (9%)

Query: 310 GFTDGDAVCLARTLSMASSYDGEQSQANQSANTDHTPDSEYASTILTKNGLAIPARSSLR 369
           GFT+G    +AR     +  D +   AN + N D  P++  A  + T   L  PA     
Sbjct: 151 GFTNGLKNIIARMFPEVNPTDEQDPSANSTLNVDIPPEAIGAKNLTTSYELTFPA----V 206

Query: 370 RSKFNT---YRIRTPNG 383
           R KFN     R+  P G
Sbjct: 207 RGKFNVEEAKRLGVPKG 223

>YBR155W (CNS1) [340] chr2 (549727..550884) Component of the Hsp90
           chaperone complex, has tetratricopeptide (TPR) repeats
           [1158 bp, 385 aa]
          Length = 385

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 802 MAPAAGGYTLPPRKLTFSDVVKPERPNSPM 831
           M   AGG     +KLTF D++K E P+ P+
Sbjct: 323 METKAGGLIKAGKKLTFHDILKKESPDVPL 352

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.307    0.125    0.343 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 30,279,644
Number of extensions: 1390315
Number of successful extensions: 6266
Number of sequences better than 10.0: 248
Number of HSP's gapped: 6320
Number of HSP's successfully gapped: 307
Length of query: 912
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 801
Effective length of database: 12,753,511
Effective search space: 10215562311
Effective search space used: 10215562311
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 66 (30.0 bits)