Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_27.1031431531116600.0
YMR274C (RCE1)3153106162e-78
CAGL0F03443g3123066041e-76
KLLA0D01705g3213175753e-72
Scas_696.373223165623e-70
AAL186W3193145259e-65
Sklu_2367.2551101681.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10314
         (311 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10314                                                         644   0.0  
YMR274C (RCE1) [4228] chr13 complement(814363..815310) Protease ...   241   2e-78
CAGL0F03443g complement(339175..340113) similar to sp|Q03530 Sac...   237   1e-76
KLLA0D01705g complement(152307..153272) similar to sp|Q03530 Sac...   226   3e-72
Scas_696.37                                                           221   3e-70
AAL186W [1] [Homologous to ScYMR274C (RCE1) - SH] complement(810...   206   9e-65
Sklu_2367.2 YML023C, Contig c2367 4427-6082 reverse complement         31   1.5  

>Kwal_27.10314
          Length = 315

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/311 (100%), Positives = 311/311 (100%)

Query: 1   MFSAPFLISLYVSISYVAAIHMWSQPIGQFQARRDDPRVIKSRMRRVGLITSINLLLVPW 60
           MFSAPFLISLYVSISYVAAIHMWSQPIGQFQARRDDPRVIKSRMRRVGLITSINLLLVPW
Sbjct: 1   MFSAPFLISLYVSISYVAAIHMWSQPIGQFQARRDDPRVIKSRMRRVGLITSINLLLVPW 60

Query: 61  LQSTFSAREITFMDAFLALGIIPAGYKSDTFYFDVSNFVYDIVRALKLVCILYSGPLLDN 120
           LQSTFSAREITFMDAFLALGIIPAGYKSDTFYFDVSNFVYDIVRALKLVCILYSGPLLDN
Sbjct: 61  LQSTFSAREITFMDAFLALGIIPAGYKSDTFYFDVSNFVYDIVRALKLVCILYSGPLLDN 120

Query: 121 VLYYLLVPDVAVTEAFQDLKAELCSIWGLRNYVFGPATEELFYTCMLVNNFLLTSTDPVT 180
           VLYYLLVPDVAVTEAFQDLKAELCSIWGLRNYVFGPATEELFYTCMLVNNFLLTSTDPVT
Sbjct: 121 VLYYLLVPDVAVTEAFQDLKAELCSIWGLRNYVFGPATEELFYTCMLVNNFLLTSTDPVT 180

Query: 181 YKAILLLPPLFFGLAHLHHAWEMSTVGIYSNVQIAITTLIQMTYTTLFGVFTNFVYLRTG 240
           YKAILLLPPLFFGLAHLHHAWEMSTVGIYSNVQIAITTLIQMTYTTLFGVFTNFVYLRTG
Sbjct: 181 YKAILLLPPLFFGLAHLHHAWEMSTVGIYSNVQIAITTLIQMTYTTLFGVFTNFVYLRTG 240

Query: 241 QNFWCCFAIHAFANYMGLPKMSALCEQFDLNRSTGFRSLVSKFWKWGYVAMLLIGLVKFK 300
           QNFWCCFAIHAFANYMGLPKMSALCEQFDLNRSTGFRSLVSKFWKWGYVAMLLIGLVKFK
Sbjct: 241 QNFWCCFAIHAFANYMGLPKMSALCEQFDLNRSTGFRSLVSKFWKWGYVAMLLIGLVKFK 300

Query: 301 GNMWELTDSRH 311
           GNMWELTDSRH
Sbjct: 301 GNMWELTDSRH 311

>YMR274C (RCE1) [4228] chr13 complement(814363..815310) Protease
           involved in ras and a-factor C-terminal proteolysis [948
           bp, 315 aa]
          Length = 315

 Score =  241 bits (616), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 132/310 (42%), Positives = 186/310 (60%), Gaps = 10/310 (3%)

Query: 4   APFLISLYVSISYVAAIHMWSQPIGQFQARRDDPRVIKSRMRRVGLITSINLLLVPWLQS 63
           + FL+ LY+SISYV  ++  SQP G   ++RD+PR IKSRM+++ ++   NL LVP+LQS
Sbjct: 5   STFLVLLYISISYVLPLYATSQPEG---SKRDNPRTIKSRMQKLTIMLISNLFLVPFLQS 61

Query: 64  TFSA--REITFMDAFLALGIIPAGYKSDTFYFDVSNFVYDIVRALKLVCILYSGPLLDNV 121
             S+    I+F DAFL LGIIP  Y +    +  S FV D+ + + ++  LY GP+LD V
Sbjct: 62  QLSSTTSHISFKDAFLGLGIIPGYYAALPNPWQFSQFVKDLTKCVAMLLTLYCGPVLDFV 121

Query: 122 LYYLLVPDVAVTEAFQDLKAELCSIWGLRNYVFGPATEELFYTCMLVNNFL-LTSTDPVT 180
           LY+LL P  ++ E   D   E  +IW  RN++F P TEE+FYT ML+  +L L     ++
Sbjct: 122 LYHLLNPKSSILE---DFYHEFLNIWSFRNFIFAPITEEIFYTSMLLTTYLNLIPHSQLS 178

Query: 181 YKAILLLPPLFFGLAHLHHAWEMSTVGIYSNVQIAITTLIQMTYTTLFGVFTNFVYLRTG 240
           Y+ +   P LFFGLAH HHA+E    G  + V I +TT  Q+ YTTLFG  T FV++RTG
Sbjct: 179 YQQLFWQPSLFFGLAHAHHAYEQLQEGSMTTVSILLTTCFQILYTTLFGGLTKFVFVRTG 238

Query: 241 QNFWCCFAIHAFANYMGLPKMSALCEQFD-LNRSTGFRSLVSKFWKWGYVAMLLIGLVKF 299
            N WCC  +HA  N MG P  S L   F  +++  G  S +   W   Y A+L++GL+  
Sbjct: 239 GNLWCCIILHALCNIMGFPGPSRLNLHFTVVDKKAGRISKLVSIWNKCYFALLVLGLISL 298

Query: 300 KGNMWELTDS 309
           K  +  L  +
Sbjct: 299 KDTLQTLVGT 308

>CAGL0F03443g complement(339175..340113) similar to sp|Q03530
           Saccharomyces cerevisiae YMR274c RCE1 modulator of
           RAS2P, hypothetical start
          Length = 312

 Score =  237 bits (604), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 127/306 (41%), Positives = 188/306 (61%), Gaps = 10/306 (3%)

Query: 6   FLISLYVSISYVAAIHMWSQPIGQFQARRDDPRVIKSRMRRVGLITSINLLLVPWLQSTF 65
           F I++ +S+SYVA +++ S+ I  + ARRDDPRVIK R++ V +++ +N  +VP L S  
Sbjct: 6   FCINIGISLSYVAVLYITSKGIENYPARRDDPRVIKRRLKNVLMVSILNTAIVPLLHSII 65

Query: 66  SAREITFMDAFLALGIIPAGYKSDTFYFDVSNFVYDIVRALKLVCILYSGPLLDNVLYYL 125
              ++++ +AFL +GIIP  ++  +    +  ++  I++ L LV +LY GPL D VLYY+
Sbjct: 66  -VPQLSYKEAFLNIGIIPGYHQHGSS--QIKLYIGTILKNLCLVMLLYIGPLTDMVLYYI 122

Query: 126 LVPDVAVTEAFQDLKAELCSIWGLRNYVFGPATEELFYTCMLVNNFLLTSTDPVTYKAIL 185
              + ++  AF++   E  +IWGLRNY+F P TEELFYT +L+N +L           +L
Sbjct: 123 SNKESSILSAFRE---EFMNIWGLRNYIFAPITEELFYTSLLLNTYLTLEPRKPKLTTLL 179

Query: 186 LLPPLFFGLAHLHHAWEMSTVGIYSNVQIAITTLIQMTYTTLFGVFTNFVYLRTGQNFWC 245
             P LFF +AH+HHA+E + VG +S   I I TL QM YT +FG FTNFV+LRTG N W 
Sbjct: 180 WQPSLFFSIAHIHHAYEATLVGNFSTTSIIINTLFQMAYTGIFGAFTNFVFLRTGGNLWS 239

Query: 246 CFAIHAFANYMGLPKMSALCEQFDL---NRSTGFRSLVSKFWKWGYVAMLLIGLVKFKGN 302
           C  +H+F N MG P  S L E F +    +S   + L+S  W   Y  +L +G++ FK  
Sbjct: 240 CILLHSFCNVMGFPSGSELYEYFTVIKTPKSLKLQHLLS-IWNKVYYILLFMGILFFKDG 298

Query: 303 MWELTD 308
           +W LT 
Sbjct: 299 LWRLTS 304

>KLLA0D01705g complement(152307..153272) similar to sp|Q03530
           Saccharomyces cerevisiae YMR274c RCE1 modulator of RAS2P
           singleton, start by similarity
          Length = 321

 Score =  226 bits (575), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 124/317 (39%), Positives = 192/317 (60%), Gaps = 14/317 (4%)

Query: 1   MFSAPF-LISLYVSISYVAAIHMWSQPIGQFQARRDDPRVIKSRMRRVGLITSINLLLVP 59
           MFS P  ++++Y+S+SYV A+H  S+ + +F+ RRDDP+VIK+RM+ V  +++ +L  +P
Sbjct: 1   MFSRPADVVAVYISLSYVVAVHTVSRDVNEFKIRRDDPKVIKARMKAVIALSAFHLTTIP 60

Query: 60  WLQSTFSAREITFMDAFLALGIIPAGYKSDTFYFDVS----NFVYDIVRALKLVCILYSG 115
            L    +   I   +  L  G++P G+ ++T     S    N+  D  R L L  +LYS 
Sbjct: 61  LLLKYMNGDSI--QNTLLRFGLLP-GFLNETETGLPSWVPFNYFKDSSRHLSLAIVLYST 117

Query: 116 PLLDNVLYYLLVPDVAVTEAFQDLKAELCSIWGLRNYVFGPATEELFYTCMLVNNFLLTS 175
           PLLD++L+Y  +PD +  +   D+  E  +IWGLR+Y+FGP TEELFYT M++  +L   
Sbjct: 118 PLLDSLLHYCFLPDKSYKDIISDICCEFSTIWGLRDYIFGPITEELFYTSMMLVAYLRLG 177

Query: 176 TDPVTYKA--ILLLPPLFFGLAHLHHAWEMSTVGIYSNVQIAITTLIQMTYTTLFGVFTN 233
            D   Y A  + L+ P  FG+AH+HHA+E  ++GI +   I   TL+QM+YT LFG FTN
Sbjct: 178 -DSSQYDANYLTLIVPNLFGIAHVHHAFEQYSLGIMNLANIIFITLLQMSYTWLFGSFTN 236

Query: 234 FVYLRTGQNFWCCFAIHAFANYMGLPKMSALCEQFDL---NRSTGFRSLVSKFWKWGYVA 290
           +++L +  N W C  IH F NYMGLP+ +   + + L    + +   +L S  W+  Y+ 
Sbjct: 237 YLFLNSSGNLWSCILIHTFCNYMGLPQGNTFSKAYALVPIEKRSNLGTLFSSVWRLLYLP 296

Query: 291 MLLIGLVKFKGNMWELT 307
           +L+I +V FK N+  LT
Sbjct: 297 LLVISIVLFKNNLTSLT 313

>Scas_696.37
          Length = 322

 Score =  221 bits (562), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 125/316 (39%), Positives = 185/316 (58%), Gaps = 15/316 (4%)

Query: 6   FLISLYVSISYVAAIHMWSQPIGQFQA-RRDDPRVIKSRMRRVGLITSINLLLVPWLQST 64
           F +  Y+SISYVA I+  S+   Q+    RDDP VIK R+R+V ++T+ N++LVP+LQ  
Sbjct: 7   FCVLSYISISYVAVIYASSKDARQYPVLGRDDPAVIKRRIRKVLMLTAFNIVLVPFLQCL 66

Query: 65  F------SAREITFMDAFLALGIIPAGYKSDTFYFDVSNFVYDIVRALKLVCILYSGPLL 118
                  +   I+ + A + LGI+P  Y+    ++D+S++ YDI+  + +V +LY GPL+
Sbjct: 67  IKNLRDSTDSSISVIGAIMNLGIVPGHYRDG--HWDISSYYYDIISGIWVVTLLYVGPLM 124

Query: 119 DNVLYYLLVPDVAVTEAFQDLKAELCSIWGLRNYVFGPATEELFYTCMLVNNFL-LTSTD 177
           D  L+Y+      +   + D K E  +I+ LRNY+F P TEE+FYT ML+N +L L   +
Sbjct: 125 DLFLFYVFTKGKTL---YVDYKDEFSNIYCLRNYIFAPITEEIFYTSMLLNTYLMLCPIE 181

Query: 178 PVTYKAILLLPPLFFGLAHLHHAWEMSTVGIYSNVQIAITTLIQMTYTTLFGVFTNFVYL 237
            ++ K +L  P LFFGLAH+HHA+     G  + + I + T+IQ  YTTLFG FTNF++L
Sbjct: 182 SLSLKTLLWQPSLFFGLAHIHHAYGSFRTGDQNLITILMNTIIQFGYTTLFGAFTNFIFL 241

Query: 238 RTGQNFWCCFAIHAFANYMGLPKMSALCEQFDLNRST--GFRSLVSKFWKWGYVAMLLIG 295
           RTG N W C   H+F N MG P  S L   F +       +R  +   W   Y+ +L +G
Sbjct: 242 RTGGNLWACMFAHSFCNIMGFPGRSRLSLHFTMIEEVKGDWRRKLIAAWNKSYIFLLFLG 301

Query: 296 LVKFKGNMWELTDSRH 311
           +  FK N+  L  SR 
Sbjct: 302 IYLFKANIDTLIYSRE 317

>AAL186W [1] [Homologous to ScYMR274C (RCE1) - SH]
           complement(8108..9067) [960 bp, 319 aa]
          Length = 319

 Score =  206 bits (525), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 120/314 (38%), Positives = 175/314 (55%), Gaps = 13/314 (4%)

Query: 3   SAPFLISLYVSISYVAAIHMWSQPIGQFQARRDDPRVIKSRMRRVGLITSINLLLVPWLQ 62
           S+  L+S Y + SYVAA++++        A R+DP+ I   M+ VG     NLL++PWLQ
Sbjct: 4   SSATLLSFYAATSYVAALYVFPGRRIYGHASRNDPKAIWYGMKAVGCGVLANLLIIPWLQ 63

Query: 63  STFSAREITFMDAFLALGIIPAGYKS-DTFYFDVSNFVYDIVRALKLVCILYSGPLLDNV 121
           S  ++   +F+D F  LG++P  Y      ++D   +  DI+RAL ++  LY+  LLD+ 
Sbjct: 64  SRLASDGFSFVDCFFRLGLVPGAYAHFRGLHWDTLAYATDILRALSILGSLYAADLLDSA 123

Query: 122 LYYLLVPDVAVTEAFQDLKAELCSIWGLRNYVFGPATEELFYTCMLVNNFLLTSTDPVTY 181
            YYLLVPD   T    DL   L    GLRNYVFGP TEEL YT M++ N+ L    P   
Sbjct: 124 AYYLLVPD---TSPVVDLVDRLSCTTGLRNYVFGPITEELVYTSMVLQNYRLL--QPTIS 178

Query: 182 KAILLLP-PLFFGLAHLHHAWEMSTVGIYSNVQIAITTLIQMTYTTLFGVFTNFVYLRTG 240
           +A+LLL  P+FFG+AH+HHA ++   G +   Q+A+T+  Q+ YTTLFG FTN++Y  T 
Sbjct: 179 RAMLLLATPMFFGVAHVHHARQLLATG-HRPAQVALTSSFQILYTTLFGTFTNYIYYHTA 237

Query: 241 QNFWCCFAIHAFANYMGLPKMSA-----LCEQFDLNRSTGFRSLVSKFWKWGYVAMLLIG 295
            N W C  +HA  NY+  P +S+      C +        ++  +   W + Y   LL G
Sbjct: 238 GNLWACILLHAVCNYLSFPSLSSDVFADYCAKVPPALRALWKMRLLHAWGYTYRLCLLCG 297

Query: 296 LVKFKGNMWELTDS 309
           L+ F   +   + S
Sbjct: 298 LLAFLDGIRTFSSS 311

>Sklu_2367.2 YML023C, Contig c2367 4427-6082 reverse complement
          Length = 551

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 37/101 (36%), Gaps = 7/101 (6%)

Query: 50  ITSINLLLVPWLQSTFSAREITFMDAFLALGIIPAGYKSDTFYFDVSNFVYDIVRALK-- 107
           I+S N   V  L+ +   R       F  L  +P G K  +   +   F+    R LK  
Sbjct: 335 ISSANPTRVYKLKQSMELRRAVLASFFKLLFELPGGQKLHSLKVNEKEFIQHTSRILKSF 394

Query: 108 -----LVCILYSGPLLDNVLYYLLVPDVAVTEAFQDLKAEL 143
                  C  YS     ++ Y  L+ +  + E  QDL   L
Sbjct: 395 ENLDEFKCFFYSSDFSKDIGYLSLLAEECINEIAQDLGHNL 435

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.330    0.141    0.452 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,808,780
Number of extensions: 397332
Number of successful extensions: 1015
Number of sequences better than 10.0: 9
Number of HSP's gapped: 1011
Number of HSP's successfully gapped: 9
Length of query: 311
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 210
Effective length of database: 13,099,691
Effective search space: 2750935110
Effective search space used: 2750935110
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 61 (28.1 bits)