Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.921831030616410.0
KLLA0B08195g3302898291e-110
YOR292C3093228051e-107
Scas_665.293223187212e-94
CAGL0M11330g2962767036e-92
AFR568C3152586256e-80
Kwal_14.26321991531493e-11
YLR251W1971361432e-10
KLLA0F22924g1951341432e-10
Sklu_1738.32001531389e-10
AFR120C182941351e-09
Scas_639.202081541362e-09
CAGL0B03465g2101821292e-08
YBL005W (PDR3)97675681.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.9218
         (306 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.9218                                                          636   0.0  
KLLA0B08195g 723299..724291 similar to sgd|S0005818 Saccharomyce...   323   e-110
YOR292C (YOR292C) [5076] chr15 complement(865650..866579) Member...   314   e-107
Scas_665.29                                                           282   2e-94
CAGL0M11330g complement(1114703..1115593) similar to sp|Q08743 S...   275   6e-92
AFR568C [3760] [Homologous to ScYOR292C - SH] (1459711..1460658)...   245   6e-80
Kwal_14.2632                                                           62   3e-11
YLR251W (YLR251W) [3647] chr12 (641466..642059) Member of the Mp...    60   2e-10
KLLA0F22924g 2129434..2130021 similar to sgd|S0004241 Saccharomy...    60   2e-10
Sklu_1738.3 YLR251W, Contig c1738 3838-4440 reverse complement         58   9e-10
AFR120C [3312] [Homologous to ScYLR251W - SH] (655883..656431) [...    57   1e-09
Scas_639.20                                                            57   2e-09
CAGL0B03465g complement(343994..344626) highly similar to tr|Q06...    54   2e-08
YBL005W (PDR3) [189] chr2 (217435..220365) Zinc-finger transcrip...    31   1.7  

>Kwal_26.9218
          Length = 310

 Score =  636 bits (1641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/306 (100%), Positives = 306/306 (100%)

Query: 1   MPIQLFDRDQIAVSYGDDDMERGWTRRASRNVREKLLEWARRVDDKIQGYTLLHVGIVHW 60
           MPIQLFDRDQIAVSYGDDDMERGWTRRASRNVREKLLEWARRVDDKIQGYTLLHVGIVHW
Sbjct: 1   MPIQLFDRDQIAVSYGDDDMERGWTRRASRNVREKLLEWARRVDDKIQGYTLLHVGIVHW 60

Query: 61  TLLTIWVMLLVKVASVYGRMYKRSALFTTLCTNAVLFGTSDILAQCILQYTWDPVDPTPA 120
           TLLTIWVMLLVKVASVYGRMYKRSALFTTLCTNAVLFGTSDILAQCILQYTWDPVDPTPA
Sbjct: 61  TLLTIWVMLLVKVASVYGRMYKRSALFTTLCTNAVLFGTSDILAQCILQYTWDPVDPTPA 120

Query: 121 ALDATAHNLVSRYALFGDQDSDAENDSISLYNEYGPGATAQSPVPYHQSAQHPPRFDFFR 180
           ALDATAHNLVSRYALFGDQDSDAENDSISLYNEYGPGATAQSPVPYHQSAQHPPRFDFFR
Sbjct: 121 ALDATAHNLVSRYALFGDQDSDAENDSISLYNEYGPGATAQSPVPYHQSAQHPPRFDFFR 180

Query: 181 WLCFMAWGSFLSFFQVPWYKVLNFFYTEDPTVVQVLERVLSDQLVYSPISLYCFFMYSNY 240
           WLCFMAWGSFLSFFQVPWYKVLNFFYTEDPTVVQVLERVLSDQLVYSPISLYCFFMYSNY
Sbjct: 181 WLCFMAWGSFLSFFQVPWYKVLNFFYTEDPTVVQVLERVLSDQLVYSPISLYCFFMYSNY 240

Query: 241 IMQKGDSASFKVKIQKVYLGTLGCNYLVWPPVQFINFLVVPKHLQVPFSSSVGVVWNCFL 300
           IMQKGDSASFKVKIQKVYLGTLGCNYLVWPPVQFINFLVVPKHLQVPFSSSVGVVWNCFL
Sbjct: 241 IMQKGDSASFKVKIQKVYLGTLGCNYLVWPPVQFINFLVVPKHLQVPFSSSVGVVWNCFL 300

Query: 301 SMRNAS 306
           SMRNAS
Sbjct: 301 SMRNAS 306

>KLLA0B08195g 723299..724291 similar to sgd|S0005818 Saccharomyces
           cerevisiae YOR292c, start by similarity
          Length = 330

 Score =  323 bits (829), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 159/289 (55%), Positives = 205/289 (70%), Gaps = 28/289 (9%)

Query: 46  KIQGYTLLHVGIVHWTLLTIWVMLLVKVASVYGRMYKRSALFTTLCTNAVLFGTSDILAQ 105
            ++ + +L + I+HW++L+ W++LL+   SVYG +Y+ SAL  T+CTN +LFGTSD LAQ
Sbjct: 39  SLRRFKILKITIIHWSILSTWIVLLLHFTSVYGSLYQSSALLATMCTNVLLFGTSDCLAQ 98

Query: 106 CILQYTWDPVDPTPAALDATAHNLVSRYALFGDQD-SDAENDSISLYNEYG--------- 155
           CI  +    VDP P  +D    NLV+  +    +   D  +D++S++N+YG         
Sbjct: 99  CISCFLSYKVDPVPEVVDKVTRNLVAGLSFRRTESFDDNYSDNVSIFNDYGVERPSFEGQ 158

Query: 156 -------PGATAQ--------SPVPYH---QSAQHPPRFDFFRWLCFMAWGSFLSFFQVP 197
                  PG  ++        S + Y     S+ +   F F+RW+CFM+WG FLSFFQVP
Sbjct: 159 TDTRNASPGIDSELRHDWDLDSNLDYDADGTSSSNNELFSFYRWICFMSWGWFLSFFQVP 218

Query: 198 WYKVLNFFYTEDPTVVQVLERVLSDQLVYSPISLYCFFMYSNYIMQKGDSASFKVKIQKV 257
           WYK LN+FYTEDPTVVQVLERVLSDQLVYSPISLYCFFMYSNYIM+ GD+ SF++KI+ +
Sbjct: 219 WYKFLNYFYTEDPTVVQVLERVLSDQLVYSPISLYCFFMYSNYIMEHGDAESFQIKIRNI 278

Query: 258 YLGTLGCNYLVWPPVQFINFLVVPKHLQVPFSSSVGVVWNCFLSMRNAS 306
           Y+ TLGCNYLVWP VQFINFL+VPKHLQVPFSSSVGV+WNCFLSMRN+S
Sbjct: 279 YITTLGCNYLVWPLVQFINFLMVPKHLQVPFSSSVGVLWNCFLSMRNSS 327

>YOR292C (YOR292C) [5076] chr15 complement(865650..866579) Member of
           the Mpv17 and PMP22 family, which are peroxisomal
           proteins, has moderate similarity to uncharacterized C.
           albicans Orf6.6217p [930 bp, 309 aa]
          Length = 309

 Score =  314 bits (805), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 166/322 (51%), Positives = 207/322 (64%), Gaps = 30/322 (9%)

Query: 1   MPIQLFDRDQIAVSYGDDDMER----------GWTRRASRNVREKLLEWARRVDDKIQGY 50
           MP+QLF RDQI V Y + +M             WTRRA+  +R  +       + +IQ  
Sbjct: 1   MPLQLFGRDQIVVHYDNGNMSNDDQNHQSVLGSWTRRAAAALRTLM-------NKRIQRI 53

Query: 51  TLLHVGIVHWTLLTIWVMLLVKVASVYGRMYKRSALFTTLCTNAVLFGTSDILAQCILQY 110
           TL      HW LL IWV  L K  S Y ++Y  SA+F TLCTN +LFG SDILAQ I  +
Sbjct: 54  TL-----THWLLLVIWVTSLWKFTSHYRQLYANSAVFATLCTNILLFGISDILAQSIACF 108

Query: 111 TWDPVDPTPAALDATAHNLVSRYALFGDQDSDAENDSISLYNEYGPGATAQSPVPYHQSA 170
               VDP P  L+ T H++ +   +  +     E+D +S++N++    ++ +    +   
Sbjct: 109 YSYHVDPIPQILNDTFHHVQNNRDV--ENGGGYESDELSIFNDFTSEHSSYTDNDDYPEL 166

Query: 171 QHP------PRFDFFRWLCFMAWGSFLSFFQVPWYKVLNFFYTEDPTVVQVLERVLSDQL 224
             P        FDFFRW CFM WG F+SFFQ PWYK LNFFYTEDPTVVQV ERVLSDQL
Sbjct: 167 DRPLATFKTDTFDFFRWGCFMFWGFFISFFQAPWYKFLNFFYTEDPTVVQVFERVLSDQL 226

Query: 225 VYSPISLYCFFMYSNYIMQKGDSASFKVKIQKVYLGTLGCNYLVWPPVQFINFLVVPKHL 284
           +YSPISLYCFFM+SNY+M+ GD  +   KIQ++Y+ TLGCNYLVWP VQFINFL++P+  
Sbjct: 227 LYSPISLYCFFMFSNYVMEGGDKDTLGKKIQRLYISTLGCNYLVWPMVQFINFLIMPRDF 286

Query: 285 QVPFSSSVGVVWNCFLSMRNAS 306
           Q PFSSSVGVVWNCFLSMRNAS
Sbjct: 287 QAPFSSSVGVVWNCFLSMRNAS 308

>Scas_665.29
          Length = 322

 Score =  282 bits (721), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 151/318 (47%), Positives = 202/318 (63%), Gaps = 14/318 (4%)

Query: 1   MPIQLFDRDQIAVSYGDDDMERGWTRRASRNVREKLLEWARRVDDKIQGYTLLHVGIVHW 60
           M ++L   D I  ++ DD   RG  + + +N+R    E A     +     +  + + H 
Sbjct: 1   MALELAGEDSIT-AFNDDSETRGVIKSSFKNIR-TFEENAVGKVKRFFTIRIYRITLTHL 58

Query: 61  TLLTIWVMLLVKVASVYGRMYKRSALFTTLCTNAVLFGTSDILAQCILQYTWDPVDPTPA 120
            +L IWV  L+K  S Y  MY ++AL  TL  N++LFG SD LAQ I  +   P+DP P 
Sbjct: 59  IILIIWVSFLLKYTSYYNEMYAKNALVATLFMNSILFGISDCLAQSITCFFSGPLDPVPK 118

Query: 121 ALDATAHNLVSRYALFGDQDSDAEN----DSISLYNEYGPGATAQS--------PVPYHQ 168
            +D TA ++++++     +  D EN    D++S++N+YG    + S        P     
Sbjct: 119 IVDDTARHIMNQFRSPAHESLDLENGYESDTLSVFNDYGLSPASSSIGNEEGFLPSEEEV 178

Query: 169 SAQHPPRFDFFRWLCFMAWGSFLSFFQVPWYKVLNFFYTEDPTVVQVLERVLSDQLVYSP 228
                  F+F R+  FM WG F+SFFQVPWYK+LNFFYTEDPTV+QVLERVLSDQL YSP
Sbjct: 179 GTTRTYLFNFRRFFSFMFWGFFISFFQVPWYKILNFFYTEDPTVIQVLERVLSDQLTYSP 238

Query: 229 ISLYCFFMYSNYIMQKGDSASFKVKIQKVYLGTLGCNYLVWPPVQFINFLVVPKHLQVPF 288
           + LY FFMY+NYIM+ G++ +F  KI+ +Y+ TLGCNYLVWP VQFINFL++PK  QVPF
Sbjct: 239 VQLYFFFMYANYIMEGGNAETFATKIKSIYISTLGCNYLVWPAVQFINFLLLPKPFQVPF 298

Query: 289 SSSVGVVWNCFLSMRNAS 306
           SSSVGV+WNCFLSMRNAS
Sbjct: 299 SSSVGVLWNCFLSMRNAS 316

>CAGL0M11330g complement(1114703..1115593) similar to sp|Q08743
           Saccharomyces cerevisiae YOR292c, hypothetical start
          Length = 296

 Score =  275 bits (703), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 136/276 (49%), Positives = 188/276 (68%), Gaps = 11/276 (3%)

Query: 41  RRVDDKIQGYTLLHVGIVHWTLLTIWVMLLVKVA-SVYGRMYKRSALFTTLCTNAVLFGT 99
           R V   +    + H+ + HW L+  W+ L+ +   + Y  +YK + L  +  +N +LFG 
Sbjct: 21  RNVFRTVFTANVFHISLTHWFLMFCWLNLMWRYYFNHYKDLYKYNRLIASQLSNCMLFGL 80

Query: 100 SDILAQCILQYTWDPVDPTPAALDATAHNLVSRYAL--------FGDQDSDAEND-SISL 150
           SDILAQCI  Y    +DP P  +D T  NL+    +          ++  D++ND ++S+
Sbjct: 81  SDILAQCITCYFSREMDPVPRIIDETVQNLIPYNVMPLPGGIFEANEELLDSDNDDNLSV 140

Query: 151 YNEYGPGATAQSPVPYHQSAQHPPRFDFFRWLCFMAWGSFLSFFQVPWYKVLNFFYTEDP 210
           +N+YG    +   + Y+ + +    F F RWL FM WG F+SFFQVPWY +LN  YTEDP
Sbjct: 141 FNDYGEYDNSNDEIEYNHT-EKVATFHFRRWLGFMGWGGFISFFQVPWYIILNTIYTEDP 199

Query: 211 TVVQVLERVLSDQLVYSPISLYCFFMYSNYIMQKGDSASFKVKIQKVYLGTLGCNYLVWP 270
           TVVQVLERVL+DQL+YSP+SLY FFMYSNY++++GD  +F +KI+++Y+ TLGCNY++WP
Sbjct: 200 TVVQVLERVLTDQLLYSPVSLYFFFMYSNYVIEQGDRYTFSMKIRRLYVTTLGCNYMIWP 259

Query: 271 PVQFINFLVVPKHLQVPFSSSVGVVWNCFLSMRNAS 306
            +QFINFLV+PKH QVPFSSSVGVVWNCFLSMRNA+
Sbjct: 260 MMQFINFLVIPKHYQVPFSSSVGVVWNCFLSMRNAA 295

>AFR568C [3760] [Homologous to ScYOR292C - SH] (1459711..1460658)
           [948 bp, 315 aa]
          Length = 315

 Score =  245 bits (625), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 130/258 (50%), Positives = 167/258 (64%), Gaps = 8/258 (3%)

Query: 52  LLHVGIVHWTLLTIWVMLLVKVASVYGRMYKRSALFTTLCTNAVLFGTSDILAQCILQYT 111
           LL V   +W +    +ML+  +  VYG +Y+RS L  T C+N +LFG SD  AQ  L   
Sbjct: 56  LLGVPPTYWAVGGATLMLVALLTRVYGWLYERSVLVATYCSNVLLFGLSDCAAQG-LACA 114

Query: 112 WDPVDPTPAALDATAHNLVSRYALFGDQDSDAENDSISLYNEYGPGATAQSPVPYHQSA- 170
                     L AT   LV             E D +  +++YGP    +S +   +   
Sbjct: 115 ATEASRAGGPLAATRELLVQLRP--QPPVRLDEEDELRAFSDYGP--RPESHMTESEGVW 170

Query: 171 --QHPPRFDFFRWLCFMAWGSFLSFFQVPWYKVLNFFYTEDPTVVQVLERVLSDQLVYSP 228
             + P RFDF+RW CFM WG  ++ FQVPWY++LN+ YT+DPTVVQVLERVLSDQL+YSP
Sbjct: 171 VEEEPRRFDFYRWGCFMLWGPVMANFQVPWYRLLNYLYTDDPTVVQVLERVLSDQLLYSP 230

Query: 229 ISLYCFFMYSNYIMQKGDSASFKVKIQKVYLGTLGCNYLVWPPVQFINFLVVPKHLQVPF 288
           +SLYCFF YSNY+++ G   +F +KIQ+VY+ TLGCNY VWP VQF+NFLV+PK LQVPF
Sbjct: 231 LSLYCFFWYSNYVIEGGTEETFALKIQRVYVSTLGCNYAVWPLVQFLNFLVIPKSLQVPF 290

Query: 289 SSSVGVVWNCFLSMRNAS 306
           SSSVGV+WN FLS+R AS
Sbjct: 291 SSSVGVLWNIFLSLRAAS 308

>Kwal_14.2632
          Length = 199

 Score = 62.0 bits (149), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/153 (30%), Positives = 76/153 (49%), Gaps = 7/153 (4%)

Query: 158 ATAQSPVPYHQSAQHPPRFDFFRWLCFMAWGSFL-SFFQVPWYKVLNFFYTEDPTV---V 213
           A AQ   P  +SA    ++D  R +  + +GS + SF    W+K LN             
Sbjct: 33  AIAQLCFPGDKSATR--QYDIARTVRAVTYGSLIFSFIGDKWFKTLNKIKLASFPANHWS 90

Query: 214 QVLERVLSDQLVYSPISLYCFFMYSNYIMQKGDSASFKVKIQKVYLGTLGCNYLVWPPVQ 273
            +  RV +DQL+++P+ +  +F     +M+       + KI+ V+   L  N++VWP VQ
Sbjct: 91  NLALRVGTDQLLFAPLCVPFYFGILT-LMEGKSPKHAENKIRNVWWDILKTNWMVWPAVQ 149

Query: 274 FINFLVVPKHLQVPFSSSVGVVWNCFLSMRNAS 306
            INF +VP   ++   + V + WN FLS RN+ 
Sbjct: 150 IINFSLVPVQHRLLAVNLVAIFWNTFLSFRNSE 182

>YLR251W (YLR251W) [3647] chr12 (641466..642059) Member of the Mpv17
           and PMP22 family, which are peroxisomal proteins, has
           low similarity to mouse Mpv17, which functions in
           peroxisomal reactive oxygen metabolism and is associated
           with glomerulosclerosis and inner ear defects [594 bp,
           197 aa]
          Length = 197

 Score = 59.7 bits (143), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 70/136 (51%), Gaps = 6/136 (4%)

Query: 176 FDFFRWLCFMAWGSFL-SFFQVPWYKVLN--FFYTEDPTV--VQVLERVLSDQLVYSPIS 230
           +D+ R    + +GS + SF    WYK+LN   +    P      ++ RV  DQL ++P+ 
Sbjct: 47  YDYKRTARAVIYGSLIFSFIGDKWYKILNNKIYMRNRPQYHWSNMVLRVAVDQLAFAPLG 106

Query: 231 LYCFFMYSNYIMQKGDSASFKVKIQKVYLGTLGCNYLVWPPVQFINFLVVPKHLQVPFSS 290
           L  F+     IM+       K+KI++ +  TL  N+ VWP  Q INF VVP   ++   +
Sbjct: 107 L-PFYFTCMSIMEGRSFDVAKLKIKEQWWPTLLTNWAVWPLFQAINFSVVPLQHRLLAVN 165

Query: 291 SVGVVWNCFLSMRNAS 306
            V + WN +LS +N+ 
Sbjct: 166 VVAIFWNTYLSYKNSK 181

>KLLA0F22924g 2129434..2130021 similar to sgd|S0004241 Saccharomyces
           cerevisiae YLR251w, hypothetical start
          Length = 195

 Score = 59.7 bits (143), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 67/134 (50%), Gaps = 4/134 (2%)

Query: 175 RFDFFRWLCFMAWGSFL-SFFQVPWYKVLNFFYTEDPTV--VQVLERVLSDQLVYSPISL 231
           ++D  R +  + +GS + S     WYK LN      P         RV  DQL+++P+ +
Sbjct: 46  KYDLARTVRAVVYGSLIFSIIGDSWYKFLNQKVIVKPGKHWTNTAARVGCDQLLFAPVGI 105

Query: 232 YCFFMYSNYIMQKGDSASFKVKIQKVYLGTLGCNYLVWPPVQFINFLVVPKHLQVPFSSS 291
             ++   + I++       K KI+  +  TL  N+ VWP  Q INF +VP H ++   + 
Sbjct: 106 PMYYGVMS-ILEGKSLVDAKKKIEDNWWPTLVTNWYVWPAFQLINFSLVPVHHRLFSVNI 164

Query: 292 VGVVWNCFLSMRNA 305
           + + WN FLS +N+
Sbjct: 165 ISIFWNAFLSFKNS 178

>Sklu_1738.3 YLR251W, Contig c1738 3838-4440 reverse complement
          Length = 200

 Score = 57.8 bits (138), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 71/153 (46%), Gaps = 8/153 (5%)

Query: 158 ATAQSPVPYHQSAQHPPRFDFFRWLCFMAWGS-FLSFFQVPWYKVLN--FFYTEDPTV-- 212
           A AQ   P  Q       +D  R L  +A+GS F SF    WYK LN        P    
Sbjct: 33  AIAQFAFPDQQRKSE--GYDIKRTLRSVAYGSLFFSFVGDKWYKFLNNKIRLPHRPINHW 90

Query: 213 VQVLERVLSDQLVYSPISLYCFFMYSNYIMQKGDSASFKVKIQKVYLGTLGCNYLVWPPV 272
              + RV  DQL +SPI +  +F     I++  +    + +I   +  TL  N+ VWP  
Sbjct: 91  SNTVCRVGVDQLGFSPIGVPLYFGIMT-ILEGRNIDEARTRISDNWWPTLVTNWAVWPAF 149

Query: 273 QFINFLVVPKHLQVPFSSSVGVVWNCFLSMRNA 305
           Q +NF +VP   ++   + V + WN FLS +N+
Sbjct: 150 QLVNFSLVPLSHRLLAVNVVSIFWNTFLSYKNS 182

>AFR120C [3312] [Homologous to ScYLR251W - SH] (655883..656431) [549
           bp, 182 aa]
          Length = 182

 Score = 56.6 bits (135), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 53/94 (56%), Gaps = 1/94 (1%)

Query: 213 VQVLERVLSDQLVYSPISLYCFFMYSNYIMQKGDSASFKVKIQKVYLGTLGCNYLVWPPV 272
             VL RV  DQL+++PI +  ++  +  +M+ G     ++++ + +  TL  N++VWP  
Sbjct: 87  ANVLARVACDQLIFAPIGVPLYYT-AMALMEGGSLEDVRIRLSEKWWSTLLANWIVWPAF 145

Query: 273 QFINFLVVPKHLQVPFSSSVGVVWNCFLSMRNAS 306
           Q  NF +VP   ++   + + + WN +LS  N++
Sbjct: 146 QLCNFSLVPVQHRLLTVNVLSIFWNTYLSYSNST 179

>Scas_639.20
          Length = 208

 Score = 57.0 bits (136), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 71/154 (46%), Gaps = 7/154 (4%)

Query: 158 ATAQSPVPYHQSAQHPPRFDFFRWLCFMAWGSFL-SFFQVPWYKVLNF-----FYTEDPT 211
           A  + P    +  Q    FD+ R    + +GS + SF    WYK+L          +   
Sbjct: 39  APTEQPKQGDEIEQKKKNFDWHRTSRAVIYGSMIFSFIGDKWYKILQNNVKLPLRFQHNK 98

Query: 212 VVQVLERVLSDQLVYSPISLYCFFMYSNYIMQKGDSASFKVKIQKVYLGTLGCNYLVWPP 271
            + +L +V  DQL ++P+ +  F+     IM+ G     + KI+  +  TL  N+ VWP 
Sbjct: 99  SLSMLYKVSVDQLAFAPLGV-PFYFSCMTIMEGGTMKDVETKIKTQWWRTLVTNWCVWPL 157

Query: 272 VQFINFLVVPKHLQVPFSSSVGVVWNCFLSMRNA 305
            Q +NF  VP   ++   + V + WN +LS  N+
Sbjct: 158 FQMVNFTWVPLQHRLLAVNVVAIFWNTYLSYMNS 191

>CAGL0B03465g complement(343994..344626) highly similar to tr|Q06563
           Saccharomyces cerevisiae YLR251w, hypothetical start
          Length = 210

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 84/182 (46%), Gaps = 13/182 (7%)

Query: 128 NLVSRYALFGDQDSDAENDSISLYNEYGPGATAQSPVPYHQSAQHPPRFDFFRWLCFMAW 187
           N +   ALFG  D  A+     L    GP      P     +     ++D  R +  + +
Sbjct: 20  NSIMTGALFGIGDVSAQ-----LLFPSGPDTL---PPSAQTNDVKRGKYDIPRTVRAVVY 71

Query: 188 GSFL-SFFQVPWYKVL-NFFYTEDPTV--VQVLERVLSDQLVYSPISLYCFFMYSNYIMQ 243
           GS + SF    WY+ L    ++  P      ++ RV  DQL ++P+ L  +F   + +  
Sbjct: 72  GSMIFSFIGDRWYRFLTKVKFSNKPAKHWSNMVLRVCVDQLGFAPLGLPFYFGCMSLLEG 131

Query: 244 KGDSASFKVKIQKVYLGTLGCNYLVWPPVQFINFLVVPKHLQVPFSSSVGVVWNCFLSMR 303
            G  A+ + KI+  +  TL  N+ VWP  Q +NF +VP   ++  ++ V + WN FLS  
Sbjct: 132 HGLGAA-REKIKLQWWDTLKTNWCVWPLFQMVNFSLVPLQHRLLAANVVAIFWNTFLSYT 190

Query: 304 NA 305
           N+
Sbjct: 191 NS 192

>YBL005W (PDR3) [189] chr2 (217435..220365) Zinc-finger
           transcription factor, in conjunction with Pdr1p
           regulates the expression of a network of genes involved
           in multiple drug resistance [2931 bp, 976 aa]
          Length = 976

 Score = 30.8 bits (68), Expect = 1.7,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 9/75 (12%)

Query: 177 DFFRWLCFMAWGSFLSFFQVPWYKVLNFFYTEDPTVVQVLERVLSDQLVYSPISLYCFFM 236
           DF  W C       L F+++ ++ + + FY EDP +   LE V++   V+  I+    F 
Sbjct: 701 DFIVWAC-------LDFYELIFFVMASKFYVEDPHI--TLEDVINTLKVFKRITNIISFF 751

Query: 237 YSNYIMQKGDSASFK 251
            +N   +  D  +F+
Sbjct: 752 NNNLDEKDYDCQTFR 766

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.138    0.451 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,302,397
Number of extensions: 433665
Number of successful extensions: 1319
Number of sequences better than 10.0: 15
Number of HSP's gapped: 1328
Number of HSP's successfully gapped: 15
Length of query: 306
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 205
Effective length of database: 13,099,691
Effective search space: 2685436655
Effective search space used: 2685436655
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 61 (28.1 bits)