Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.92071469144773080.0
KLLA0B08217g1439145646430.0
YOR291W1472147145710.0
AFR567W1449145645080.0
CAGL0M11308g1452144444930.0
Scas_665.301439118643160.0
KLLA0E22352g12067598113e-89
CAGL0L01419g12147408114e-89
AFR354C12107617813e-85
YEL031W (SPF1)12157477707e-84
Scas_583.14*8755455492e-57
Kwal_14.14989399343141e-28
CAGL0A00517g11228552925e-26
YGL006W (PMC1)11738862882e-25
Kwal_47.1754712408542764e-24
YGL167C (PMR1)9509212754e-24
AEL301W9578572702e-23
CAGL0I04312g9519412657e-23
KLLA0A08910g12808562641e-22
Kwal_23.316011008572603e-22
AGL097C10968422504e-21
KLLA0E14630g10828452471e-20
Scas_707.48*7417762451e-20
Kwal_23.578911338082461e-20
YIL048W (NEO1)11516352433e-20
CAGL0K12034g10878522407e-20
YDR039C (ENA2)10918582407e-20
YDR038C (ENA5)10918582399e-20
KLLA0A03157g9388582389e-20
YDR040C (ENA1)10918562362e-19
ADL079C11665782352e-19
AFL011W12428482335e-19
KLLA0F20658g10828442301e-18
KLLA0C08393g11486672075e-16
Kwal_26.707013154782067e-16
Scas_499.33461481943e-15
KLLA0C17644g15764142004e-15
KLLA0A04015g13434661978e-15
Sklu_2193.111436411942e-14
CAGL0L00715g11446171852e-13
ADR350W13114571824e-13
AGR120C15473971772e-12
Scas_704.3811615061744e-12
CAGL0L11814g15763121726e-12
CAGL0J01870g9464191718e-12
KLLA0E01650g15501871711e-11
Scas_576.815913121682e-11
CAGL0G06270g13283251637e-11
CAGL0G08085g15783101611e-10
Scas_297.18002461592e-10
YER166W (DNF1)15713141583e-10
YGL008C (PMA1)9182461574e-10
AFL191W15752601565e-10
YMR162C (DNF3)16561871557e-10
YDR093W (DNF2)16123151549e-10
Kwal_23.355615972401531e-09
Scas_669.316381871512e-09
CAGL0H04477g16261881512e-09
Scas_636.1615543341441e-08
YAL026C (DRS2)13554821422e-08
YPL036W (PMA2)9472471386e-08
KLLA0A09031g8992441386e-08
Scas_710.419042671387e-08
AGL085C9092511361e-07
Scas_688.19133511243e-06
Scas_89.12712781186e-06
CAGL0A00495g902961153e-05
KLLA0D04092g11523031082e-04
Kwal_47.175228993841039e-04
Scas_569.0d4681191000.001
KLLA0F07447g97582940.010
ACR086C810128880.044
CAGL0M08602g101272850.12
Kwal_55.2157598973850.12
YBR295W (PCA1)1216251840.15
AGL041C1233210810.34
Scas_615.9942137780.69
Sklu_2442.10163184742.0
CAGL0K07964g36340722.8
YDR270W (CCC2)1004110723.3
Scas_516.237040713.4
Kwal_0.237154784715.5
Kwal_26.7720538103696.8
YPR086W (SUA7)34540688.6
Scas_227.0d30745679.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.9207
         (1447 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.9207                                                         2819   0.0  
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...  1793   0.0  
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...  1765   0.0  
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...  1741   0.0  
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...  1735   0.0  
Scas_665.30                                                          1667   0.0  
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...   317   3e-89
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...   317   4e-89
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...   305   3e-85
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...   301   7e-84
Scas_583.14*                                                          216   2e-57
Kwal_14.1498                                                          125   1e-28
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...   117   5e-26
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...   115   2e-25
Kwal_47.17547                                                         110   4e-24
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...   110   4e-24
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...   108   2e-23
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...   106   7e-23
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...   106   1e-22
Kwal_23.3160                                                          104   3e-22
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....   100   4e-21
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...   100   1e-20
Scas_707.48*                                                           99   1e-20
Kwal_23.5789                                                           99   1e-20
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...    98   3e-20
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    97   7e-20
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...    97   7e-20
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...    97   9e-20
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....    96   9e-20
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...    96   2e-19
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...    95   2e-19
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    94   5e-19
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    93   1e-18
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...    84   5e-16
Kwal_26.7070                                                           84   7e-16
Scas_499.3                                                             79   3e-15
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...    82   4e-15
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...    80   8e-15
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement          79   2e-14
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...    76   2e-13
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...    75   4e-13
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...    73   2e-12
Scas_704.38                                                            72   4e-12
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...    71   6e-12
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    70   8e-12
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...    70   1e-11
Scas_576.8                                                             69   2e-11
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...    67   7e-11
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...    67   1e-10
Scas_297.1                                                             66   2e-10
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...    65   3e-10
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...    65   4e-10
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...    65   5e-10
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...    64   7e-10
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...    64   9e-10
Kwal_23.3556                                                           64   1e-09
Scas_669.3                                                             63   2e-09
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...    63   2e-09
Scas_636.16                                                            60   1e-08
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...    59   2e-08
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    58   6e-08
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    58   6e-08
Scas_710.41                                                            58   7e-08
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...    57   1e-07
Scas_688.1                                                             52   3e-06
Scas_89.1                                                              50   6e-06
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    49   3e-05
KLLA0D04092g complement(344666..348124) some similarities with s...    46   2e-04
Kwal_47.17522                                                          44   9e-04
Scas_569.0d                                                            43   0.001
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...    41   0.010
ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH] (511968..51...    39   0.044
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...    37   0.12 
Kwal_55.21575                                                          37   0.12 
YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transpo...    37   0.15 
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...    36   0.34 
Scas_615.9                                                             35   0.69 
Sklu_2442.10 YCL014W, Contig c2442 14442-19337                         33   2.0  
CAGL0K07964g 790076..791167 highly similar to sp|P29055 Saccharo...    32   2.8  
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...    32   3.3  
Scas_516.2                                                             32   3.4  
Kwal_0.237                                                             32   5.5  
Kwal_26.7720                                                           31   6.8  
YPR086W (SUA7) [5512] chr16 (710097..711134) RNA polymerase II t...    31   8.6  
Scas_227.0d                                                            30   9.8  

>Kwal_26.9207
          Length = 1469

 Score = 2819 bits (7308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1370/1447 (94%), Positives = 1370/1447 (94%)

Query: 1    MSNSDLSHRGSTNGRNSRMRPSFSSARTGSSSNTLTSATVVDNNSTEAYAGATFETVPSS 60
            MSNSDLSHRGSTNGRNSRMRPSFSSARTGSSSNTLTSATVVDNNSTEAYAGATFETVPSS
Sbjct: 1    MSNSDLSHRGSTNGRNSRMRPSFSSARTGSSSNTLTSATVVDNNSTEAYAGATFETVPSS 60

Query: 61   IVSFHHPHSFHTNGNSMLESASNSNELHSRSHEAEXXXXXXXXXXXXQGPSRTPNFRYFS 120
            IVSFHHPHSFHTNGNSMLESASNSNELHSRSHEAE            QGPSRTPNFRYFS
Sbjct: 61   IVSFHHPHSFHTNGNSMLESASNSNELHSRSHEAESLLSSRHSYSRSQGPSRTPNFRYFS 120

Query: 121  EEEIELAEGVSSTLESADYDINWDGTPTYEQERLHYHNPSGRSSIRSGTGHXXXXXXXXX 180
            EEEIELAEGVSSTLESADYDINWDGTPTYEQERLHYHNPSGRSSIRSGTGH         
Sbjct: 121  EEEIELAEGVSSTLESADYDINWDGTPTYEQERLHYHNPSGRSSIRSGTGHSLSSYQSRS 180

Query: 181  XXXXXXXXXXXXXXXXPTRQSQNRRENANQVFGTSPHXXXXXXXXXXXDRVPAGIDDXXX 240
                            PTRQSQNRRENANQVFGTSPH           DRVPAGIDD   
Sbjct: 181  SSRSGRSARGYGTSRSPTRQSQNRRENANQVFGTSPHSSSSSSRYSYRDRVPAGIDDDSG 240

Query: 241  XXXXXXXXXXXXXXDRRFLDDEDRNSSQDQASETKKKTSSYHAEYLKPQYHDRFFPQNIP 300
                          DRRFLDDEDRNSSQDQASETKKKTSSYHAEYLKPQYHDRFFPQNIP
Sbjct: 241  QSMHSEHSSESGDSDRRFLDDEDRNSSQDQASETKKKTSSYHAEYLKPQYHDRFFPQNIP 300

Query: 301  HLQFQRFYIAEEDLVVGIAGFRTSKFGKICYYLMSVITLGLFYLLLRWVPRYKVRLCGKK 360
            HLQFQRFYIAEEDLVVGIAGFRTSKFGKICYYLMSVITLGLFYLLLRWVPRYKVRLCGKK
Sbjct: 301  HLQFQRFYIAEEDLVVGIAGFRTSKFGKICYYLMSVITLGLFYLLLRWVPRYKVRLCGKK 360

Query: 361  THLAKAEWVVVENEFGELSIIEVSRRWYNRPLSTLLSMDKIADITEDIPNHHQRHHHESK 420
            THLAKAEWVVVENEFGELSIIEVSRRWYNRPLSTLLSMDKIADITEDIPNHHQRHHHESK
Sbjct: 361  THLAKAEWVVVENEFGELSIIEVSRRWYNRPLSTLLSMDKIADITEDIPNHHQRHHHESK 420

Query: 421  ENPNIPIMISFSYRYFNLIYSPIEDLFKINSNWTDADWLSLSSIQKGLPTSVVEDRMLAF 480
            ENPNIPIMISFSYRYFNLIYSPIEDLFKINSNWTDADWLSLSSIQKGLPTSVVEDRMLAF
Sbjct: 421  ENPNIPIMISFSYRYFNLIYSPIEDLFKINSNWTDADWLSLSSIQKGLPTSVVEDRMLAF 480

Query: 481  GRNNINLKQKTSLEILFDEVLHPFYVFQIFSILLWLADNYYYYAACIFIISMLSIIDTLV 540
            GRNNINLKQKTSLEILFDEVLHPFYVFQIFSILLWLADNYYYYAACIFIISMLSIIDTLV
Sbjct: 481  GRNNINLKQKTSLEILFDEVLHPFYVFQIFSILLWLADNYYYYAACIFIISMLSIIDTLV 540

Query: 541  ETKKTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVPGDVYEISDPSLSTFPCDSLLLSG 600
            ETKKTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVPGDVYEISDPSLSTFPCDSLLLSG
Sbjct: 541  ETKKTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVPGDVYEISDPSLSTFPCDSLLLSG 600

Query: 601  DCIVNESMLTGESVPVSKIPASDETIYQLLEDFQKTQISNFLAKSFLFNGTKIIRVRIGG 660
            DCIVNESMLTGESVPVSKIPASDETIYQLLEDFQKTQISNFLAKSFLFNGTKIIRVRIGG
Sbjct: 601  DCIVNESMLTGESVPVSKIPASDETIYQLLEDFQKTQISNFLAKSFLFNGTKIIRVRIGG 660

Query: 661  EQSTALAMVVRTGFSTTKGSLLRSMIFPKPSGFKFYEDSFKYIGFMTLIALAGFSISCIN 720
            EQSTALAMVVRTGFSTTKGSLLRSMIFPKPSGFKFYEDSFKYIGFMTLIALAGFSISCIN
Sbjct: 661  EQSTALAMVVRTGFSTTKGSLLRSMIFPKPSGFKFYEDSFKYIGFMTLIALAGFSISCIN 720

Query: 721  FIRLGLAYKVMILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGK 780
            FIRLGLAYKVMILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGK
Sbjct: 721  FIRLGLAYKVMILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGK 780

Query: 781  IDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITNVRGLFNKYSLNDCGSPIDF 840
            IDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITNVRGLFNKYSLNDCGSPIDF
Sbjct: 781  IDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITNVRGLFNKYSLNDCGSPIDF 840

Query: 841  KSRNFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNWSYAEDFQDFKFHSLNEERNNKST 900
            KSRNFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNWSYAEDFQDFKFHSLNEERNNKST
Sbjct: 841  KSRNFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNWSYAEDFQDFKFHSLNEERNNKST 900

Query: 901  LPENAGIAPAVVHPNAESTENKFTENDPHNLLGVIRSFEFVSELRRMSVIVKPYGENVFW 960
            LPENAGIAPAVVHPNAESTENKFTENDPHNLLGVIRSFEFVSELRRMSVIVKPYGENVFW
Sbjct: 901  LPENAGIAPAVVHPNAESTENKFTENDPHNLLGVIRSFEFVSELRRMSVIVKPYGENVFW 960

Query: 961  GFTKGAPEVISEICNKSTLPANYEQILQQYTHNGYRVIACAGKTLPKRTWRFAQKVSREE 1020
            GFTKGAPEVISEICNKSTLPANYEQILQQYTHNGYRVIACAGKTLPKRTWRFAQKVSREE
Sbjct: 961  GFTKGAPEVISEICNKSTLPANYEQILQQYTHNGYRVIACAGKTLPKRTWRFAQKVSREE 1020

Query: 1021 VESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESH 1080
            VESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESH
Sbjct: 1021 VESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESH 1080

Query: 1081 VFVPQINDNMDPNEDLIIWRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNE 1140
            VFVPQINDNMDPNEDLIIWRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNE
Sbjct: 1081 VFVPQINDNMDPNEDLIIWRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNE 1140

Query: 1141 VLPESYINMVLLKSSIYARMSPDEKHELVGQLQGLDYVVGFCGDGANDCGALKAADVGXX 1200
            VLPESYINMVLLKSSIYARMSPDEKHELVGQLQGLDYVVGFCGDGANDCGALKAADVG  
Sbjct: 1141 VLPESYINMVLLKSSIYARMSPDEKHELVGQLQGLDYVVGFCGDGANDCGALKAADVGVS 1200

Query: 1201 XXXXXXXXXXPFTSSVFEISCILDVIKEGRASLTTSFSCFQYMSLYSAIQFVTVTMLYSR 1260
                      PFTSSVFEISCILDVIKEGRASLTTSFSCFQYMSLYSAIQFVTVTMLYSR
Sbjct: 1201 LSEAEASVAAPFTSSVFEISCILDVIKEGRASLTTSFSCFQYMSLYSAIQFVTVTMLYSR 1260

Query: 1261 GINLGDFQFLYIDLFLIVPIAIFMSWSKPYHKLVKKRPSANLVSPKILAPLVANIAIILV 1320
            GINLGDFQFLYIDLFLIVPIAIFMSWSKPYHKLVKKRPSANLVSPKILAPLVANIAIILV
Sbjct: 1261 GINLGDFQFLYIDLFLIVPIAIFMSWSKPYHKLVKKRPSANLVSPKILAPLVANIAIILV 1320

Query: 1321 FQATPWLVVQAMRWYQAPVVGGDDAVQSSDNTVLFFFSNFQYVLTAIVLSVGPPYREPMS 1380
            FQATPWLVVQAMRWYQAPVVGGDDAVQSSDNTVLFFFSNFQYVLTAIVLSVGPPYREPMS
Sbjct: 1321 FQATPWLVVQAMRWYQAPVVGGDDAVQSSDNTVLFFFSNFQYVLTAIVLSVGPPYREPMS 1380

Query: 1381 KNLGFITDVVISIILNVVLMMVPVDSTLGKVFQLTDISSGFKGYLLIWAVLNYFAQLYIP 1440
            KNLGFITDVVISIILNVVLMMVPVDSTLGKVFQLTDISSGFKGYLLIWAVLNYFAQLYIP
Sbjct: 1381 KNLGFITDVVISIILNVVLMMVPVDSTLGKVFQLTDISSGFKGYLLIWAVLNYFAQLYIP 1440

Query: 1441 CRCKGLF 1447
            CRCKGLF
Sbjct: 1441 CRCKGLF 1447

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 1793 bits (4643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 876/1456 (60%), Positives = 1091/1456 (74%), Gaps = 48/1456 (3%)

Query: 1    MSNSDLSHRGSTNGRNSRMRPSFSSARTGSSSNTLTSATVVDNNSTEAYAGATFETVPSS 60
            MS+ D    G  +  N   RPSFSS RTGSS+NT TS+ +++ N+TE Y+GA  ETVPSS
Sbjct: 1    MSSFDSRFTGIPHSANKSARPSFSSTRTGSSANTTTSSAILEQNNTEPYSGAAVETVPSS 60

Query: 61   IVSFHHPHSFHTNGNSMLESASNSNELHSRSHEAEXXXXXXXXXXXXQGPSRTPNFRYFS 120
            IVSF+HPHSF ++G      +S + E   RS E +               SR   F++F+
Sbjct: 61   IVSFYHPHSFQSSGYGASAGSSTNLERRGRSSEHDPLLLSTTTSRRSSS-SRGRGFQFFT 119

Query: 121  EEEIELAEGVSSTLESADYDINWDGTPTYEQERLHYHNPSGRSSIRSGTGHXXXXXXXXX 180
            EE++E AEG++S++E+ADYD++WD  PTYEQERLH    S ++S+R              
Sbjct: 120  EEQVENAEGITSSVENADYDMDWDAIPTYEQERLHIQPRSSKTSLRQDGNDYAMRTFT-- 177

Query: 181  XXXXXXXXXXXXXXXXPTRQSQNR-RENANQVFGTSPHXXXXXXXXXXXDRVPAGID--- 236
                            P R+   R R++ ++++ TSP            DR+PA ++   
Sbjct: 178  ----------------PNRKYSVRSRKSEDRLYSTSPRSSSSSSRYTLRDRIPAELEIST 221

Query: 237  DXXXXXXXXXXXXXXXXXDRRFLDDEDRNSSQDQASETKKKTSSYHAEYLKPQYHDRFFP 296
                              D     ++D NS  ++  E  KK  SYH+E+LKPQYH RFFP
Sbjct: 222  THDVDDSELRSSASSESEDEEAEANDDYNSRAEEDQEQNKK--SYHSEFLKPQYHSRFFP 279

Query: 297  QNIPHLQFQRFYIAEEDLVVGIAGFRTSKFGKICYYLMSVITLGLFYLLLRWVPRYKVRL 356
             N+P+L +QRFYIAEEDLVV IAG+RTS+F   CYYL+ +ITLGL +L+ RW P  +V++
Sbjct: 280  NNVPYLHYQRFYIAEEDLVVAIAGYRTSRFRLQCYYLLCIITLGLAFLVFRWKPTMRVKM 339

Query: 357  CGKKTHLAKAEWVVVENEFGELSIIEVSRRWYNRPLSTLL---SMDKIADITEDIPNHHQ 413
             G+KT L KAEWVVVENEFGEL++  V RRWYNRPLST+L   + D+I       P    
Sbjct: 340  IGEKTPLGKAEWVVVENEFGELTVESVKRRWYNRPLSTVLMETNEDRIG-----TPESRH 394

Query: 414  RHHHESKENPNIPIMISFSYRYFNLIYSPIEDLFKINSNWTDADWLSLSSIQKGLPTSVV 473
             HHHE++ NPN+PI+ISF YRYF L+YSPI+D+F+ NSNW D DWL L  +Q GL +S+ 
Sbjct: 395  YHHHETEWNPNLPILISFQYRYFTLVYSPIDDIFRSNSNWADPDWLDLEVVQHGLTSSIQ 454

Query: 474  EDRMLAFGRNNINLKQKTSLEILFDEVLHPFYVFQIFSILLWLADNYYYYAACIFIISML 533
            EDR LAFG+N++NLKQKT  EILFDE LHPFYVFQIFSI+LWLAD+YYYYA CIF+IS+L
Sbjct: 455  EDRTLAFGKNSVNLKQKTVTEILFDEALHPFYVFQIFSIILWLADDYYYYAGCIFLISVL 514

Query: 534  SIIDTLVETKKTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVPGDVYEISDPSLSTFPC 593
            SIIDT++ETKK S++LA++SH +CEVRVY+D FW QV+SS+LVPGD++EISDPSL   PC
Sbjct: 515  SIIDTVIETKKNSEKLADISHFNCEVRVYKDRFWTQVNSSDLVPGDLFEISDPSLVVLPC 574

Query: 594  DSLLLSGDCIVNESMLTGESVPVSKIPASDETIYQLLEDFQKTQISNFLAKSFLFNGTKI 653
            D++L+SGDCIVNESMLTGESVPVSK  A++ T+ QLL+DF+ +Q+S+F++KSFLFNGTKI
Sbjct: 575  DAVLISGDCIVNESMLTGESVPVSKYAATEATMAQLLQDFKSSQVSSFVSKSFLFNGTKI 634

Query: 654  IRVRIGGEQSTALAMVVRTGFSTTKGSLLRSMIFPKPSGFKFYEDSFKYIGFMTLIALAG 713
            IRVR    Q  ALA+V+RTGFSTTKGSL+RSM+FPKP GFKFYEDSFKYIGFMTLIA+ G
Sbjct: 635  IRVRNQPGQGMALALVIRTGFSTTKGSLVRSMVFPKPVGFKFYEDSFKYIGFMTLIAMFG 694

Query: 714  FSISCINFIRLGLAYKVMILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPT 773
            FSISCI FIRLGL YKVMILRALDIITIVVPPALPATL+IG SFA+ RLKKKGIFCI+PT
Sbjct: 695  FSISCIQFIRLGLEYKVMILRALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPT 754

Query: 774  RVNVSGKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQN-FRFGALITNVRGLFNKYSLN 832
            RVNV GK+D+MCFDKTGTLTE+GLDVLG+H A+P+G     +   LIT+   +  K++L+
Sbjct: 755  RVNVGGKVDMMCFDKTGTLTEEGLDVLGIHFAKPEGSSTILQLSDLITDCDEVLQKHTLS 814

Query: 833  DCGSPIDFKSRNFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNWSYAEDFQDFKFHSLN 892
            DC S  +FK++NFLVSLLTCHSL+ +DGELLGDPLD KMF+FT W+Y E ++ +KF +  
Sbjct: 815  DCNSAEEFKAKNFLVSLLTCHSLKHIDGELLGDPLDLKMFEFTKWAYEEGYESWKFKNAE 874

Query: 893  EERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLLGVIRSFEFVSELRRMSVIVK 952
            ++           GI+PAVVHP +      F ENDP NL+GVIRSFEF+SELRRMSVIVK
Sbjct: 875  DK----------TGISPAVVHPTSNC---NFIENDPDNLIGVIRSFEFLSELRRMSVIVK 921

Query: 953  PYGENVFWGFTKGAPEVISEICNKSTLPANYEQILQQYTHNGYRVIACAGKTLPKRTWRF 1012
             + EN +W FTKGAPEVI++ICN +T+P ++ ++L  YTHNG+R+IACAGKTLPK +W +
Sbjct: 922  GFKENTYWSFTKGAPEVIADICNPATIPKDFHELLHHYTHNGFRIIACAGKTLPKSSWLY 981

Query: 1013 AQKVSREEVESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRE 1072
            +QKVSREEVE N+EFLGF+VFENKLK  T   L  LQ+A IR++MCTGDNVLTA+SVGR+
Sbjct: 982  SQKVSREEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRD 1041

Query: 1073 SGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLILDGVTLEPMNG-SSDYTIAVTGDV 1131
            SGLI+   VF+P +NDN++ +  L+ WRDVD+   +LD VTL+P+N     YT+A+TGD+
Sbjct: 1042 SGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDI 1101

Query: 1132 FRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQGLDYVVGFCGDGANDCGA 1191
            FR+LF+N+E+LP+ YI+ VL+K SIYARMSPDEKHELV QLQ LDY VGFCGDGANDCGA
Sbjct: 1102 FRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQKLDYNVGFCGDGANDCGA 1161

Query: 1192 LKAADVGXXXXXXXXXXXXPFTSSVFEISCILDVIKEGRASLTTSFSCFQYMSLYSAIQF 1251
            LKAA++G            PFTS+VF+ISC+LDVIKEGRASL TSFSCFQYMSLYSAIQF
Sbjct: 1162 LKAANIGISLSEAEASVAAPFTSAVFDISCVLDVIKEGRASLVTSFSCFQYMSLYSAIQF 1221

Query: 1252 VTVTMLYSRGINLGDFQFLYIDLFLIVPIAIFMSWSKPYHKLVKKRPSANLVSPKILAPL 1311
            +T+T+LYSRG NLGDFQFLYIDL LIVPIAI MSWSKP  KLVKKRPSANLVSPKIL PL
Sbjct: 1222 ITITILYSRGSNLGDFQFLYIDLLLIVPIAISMSWSKPNSKLVKKRPSANLVSPKILVPL 1281

Query: 1312 VANIAIILVFQATPWLVVQAMRWYQAPVVGGDDAVQSSDNTVLFFFSNFQYVLTAIVLSV 1371
              NI +IL+FQ  PW+ VQ   WY  PVVGGDDAVQSSDNTVLFF SNFQY+LTA+VLS 
Sbjct: 1282 CLNITLILIFQLLPWIAVQYTSWYMKPVVGGDDAVQSSDNTVLFFVSNFQYILTAVVLSQ 1341

Query: 1372 GPPYREPMSKNLGFITDVVISIILNVVLMMVPVDSTLGKVFQLTDISSGFKGYLLIWAVL 1431
            GPPYREPM KN+GFI D+ +S++++  LM + V + LG++ QLT+IS  FK  +L  A  
Sbjct: 1342 GPPYREPMIKNIGFILDISLSMLVSFGLMYLNVQTWLGELLQLTNISDTFKWLILTTAAA 1401

Query: 1432 NYFAQLYIPCRCKGLF 1447
            NY+A  YIP + K LF
Sbjct: 1402 NYYASKYIPEKFKHLF 1417

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 1765 bits (4571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 884/1471 (60%), Positives = 1091/1471 (74%), Gaps = 54/1471 (3%)

Query: 2    SNSDLSHRGSTNGRNSRM-RPSFSSARTGSSSNTLTSATVVDNNSTEAYAGATFETVPSS 60
            S++ + H G  + RN RM R SFSS  T S++ TLTSA V+D N++E YAGATFE VPSS
Sbjct: 5    SSNQIQH-GQRSERNRRMPRASFSSTATTSTAATLTSAMVLDQNNSEPYAGATFEAVPSS 63

Query: 61   IVSFHHPHSFHTNGNSMLESASNSNELHSRSHE-AEXXXXXXXXXXXXQGPSRTP-NFRY 118
            IVSFHHPHSF +   S L S  +S  L  R     E            +  SR P +FR+
Sbjct: 64   IVSFHHPHSFQS---SNLPSPHSSGNLEQRGRRLTESEPLVLSSAEQSRSSSRNPSHFRF 120

Query: 119  FSEEEIELAEGVSSTLESADYDINWDGTPTYEQERLHYHNPSGRSSIRSGTGHXXXXXXX 178
            F++E+I  AEG +STLE+ DYD+ WD TP YEQ+R++       + + S           
Sbjct: 121  FTQEQISNAEG-ASTLENTDYDMAWDATPAYEQDRIY------GTGLSSRRSSIRSFSRA 173

Query: 179  XXXXXXXXXXXXXXXXXXPTRQSQNRRENANQ--VFGTSPHXXXXXXXXXXXDRVPAGID 236
                               +R  Q   EN++   V+ ++ H           +R+P  ++
Sbjct: 174  SSLSNAKSYGSFSKRGRSGSRAPQRLGENSDTGFVYHSATHSSSSLSRYTTRERIPIELE 233

Query: 237  DXXXXXXXXXXXXXXXXXDRRFLDDE------DRNSSQDQASETKKKTSS-------YHA 283
                                  L+DE      + + S+  ASE  + + S        H+
Sbjct: 234  SQTD----------------EILEDESSTHSLESSDSRRSASENNRGSFSGHDDVHNQHS 277

Query: 284  EYLKPQYHDRFFPQNIPHLQFQRFYIAEEDLVVGIAGFRTSKFGKICYYLMSVITLGLFY 343
            EYLKP YH++F+PQ  P+L +QRFYIAEEDLV+GIA ++TSKF  I Y L   +T GL Y
Sbjct: 278  EYLKPDYHEKFYPQYAPNLHYQRFYIAEEDLVIGIAAYQTSKFWYIIYNLCCFLTFGLVY 337

Query: 344  LLLRWVPRYKVRLCGKKTHLAKAEWVVVENEFGELSIIEVSRRWYNRPLSTLLSMDKIAD 403
            LL RW+P  KV+L G K  LAKAEWVV+ENEFGE  I  + R+WYNRPLST+L  +   +
Sbjct: 338  LLTRWLPHLKVKLYGVKVPLAKAEWVVIENEFGEFVIQPIDRQWYNRPLSTVLPFENYPN 397

Query: 404  ITEDIPNHHQRHHHESKENPNIPIMISFSYRYFNLIYSPIEDLFKINSNWTDADWLSLSS 463
             + +  + +  HHH ++ NPN+PI+I+F YRY   IYSP++DLFK N+NW D DW+ LS+
Sbjct: 398  PSYEPNDINLSHHHANEINPNVPILITFEYRYIKFIYSPLDDLFKTNNNWIDPDWVDLST 457

Query: 464  IQKGLPTSVVEDRMLAFGRNNINLKQKTSLEILFDEVLHPFYVFQIFSILLWLADNYYYY 523
            +  GL   V EDR LAFG+N INL+ KT+ EILF+EVLHPFYVFQ+FSI+LW  D YYYY
Sbjct: 458  VSNGLTKGVQEDRELAFGKNQINLRMKTTSEILFNEVLHPFYVFQVFSIILWGIDEYYYY 517

Query: 524  AACIFIISMLSIIDTLVETKKTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVPGDVYEI 583
            AACIF+IS+LSI D+L E KK S+ LAE+SH HC+VRV RD FW  +SSSELVPGD+YE+
Sbjct: 518  AACIFLISVLSIFDSLNEQKKVSRNLAEMSHFHCDVRVLRDKFWTTISSSELVPGDIYEV 577

Query: 584  SDPSLSTFPCDSLLLSGDCIVNESMLTGESVPVSKIPASDETIYQLLEDFQKTQISNFLA 643
            SDP+++  PCDS+LLS DCIVNESMLTGESVPVSK PA++ET+YQL +DFQ TQIS+F++
Sbjct: 578  SDPNITILPCDSILLSSDCIVNESMLTGESVPVSKFPATEETMYQLCDDFQSTQISSFVS 637

Query: 644  KSFLFNGTKIIRVRIGGEQSTALAMVVRTGFSTTKGSLLRSMIFPKPSGFKFYEDSFKYI 703
            KSFL+NGT IIR RI   Q+ ALAMVVRTGFSTTKGSL+RSM+FPKP+GFKFY DSFKYI
Sbjct: 638  KSFLYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYRDSFKYI 697

Query: 704  GFMTLIALAGFSISCINFIRLGLAYKVMILRALDIITIVVPPALPATLSIGASFAIARLK 763
            GFM+LIA+ GF +SC+ FI+LGL  K MILRALDIITIVVPPALPATL+IG +FA++RLK
Sbjct: 698  GFMSLIAIFGFCVSCVQFIKLGLDKKTMILRALDIITIVVPPALPATLTIGTNFALSRLK 757

Query: 764  KKGIFCIAPTRVNVSGKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITNVR 823
            +KGIFCI+PTR+N+SGKIDVMCFDKTGTLTEDGLDVLGV ++EP G +  +FG L++++R
Sbjct: 758  EKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDVLGVQISEPNGVRGQKFGELLSDIR 817

Query: 824  GLFNKYSLNDCGSPIDFKSRNFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNWSYAEDF 883
             +F K+SLNDC SP+DFKSRNF +SLLTCHSLR VDG LLGDPLDFKMFQFT WS+ EDF
Sbjct: 818  QVFPKFSLNDCSSPLDFKSRNFFMSLLTCHSLRSVDGNLLGDPLDFKMFQFTGWSFEEDF 877

Query: 884  QDFKFHSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLLGVIRSFEFVSE 943
            Q   FHSL E R+     PEN+ I PAVVHP++ + EN FT+NDPHN LGV+RSFEF+SE
Sbjct: 878  QKRAFHSLYEGRHEDDVFPENSEIIPAVVHPDSNNRENTFTDNDPHNFLGVVRSFEFLSE 937

Query: 944  LRRMSVIVKPYGENVFWGFTKGAPEVISEICNKSTLPANYEQILQQYTHNGYRVIACAGK 1003
            LRRMSVIVK   ++V+W FTKGAPEVISEICNKSTLPA++E++L+ YTHNGYRVIACAGK
Sbjct: 938  LRRMSVIVKTNNDDVYWSFTKGAPEVISEICNKSTLPADFEEVLRCYTHNGYRVIACAGK 997

Query: 1004 TLPKRTWRFAQKVSREEVESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNV 1063
            TLPKRTW ++QKVSREEVESN+EFLGF++F+NKLK  T+ TL SLQDA IR+IMCTGDN+
Sbjct: 998  TLPKRTWLYSQKVSREEVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNI 1057

Query: 1064 LTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLILDGVTLEPM---NGS 1120
            LTAISVGRE+GLI  S V+VP IND     E +I+WRDV++ D ILD  TL+P+   N S
Sbjct: 1058 LTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNS 1117

Query: 1121 ------SDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQG 1174
                   +YT+AV+GDVFRLLF++   +PE Y+N +LL SSIYARMSPDEKHEL+ QLQ 
Sbjct: 1118 VESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQK 1177

Query: 1175 LDYVVGFCGDGANDCGALKAADVGXXXXXXXXXXXXPFTSSVFEISCILDVIKEGRASLT 1234
            LDY VGFCGDGANDCGALKAADVG            PFTS +F ISC+LDVI+EGRA+L 
Sbjct: 1178 LDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIFNISCVLDVIREGRAALV 1237

Query: 1235 TSFSCFQYMSLYSAIQFVTVTMLYSRGINLGDFQFLYIDLFLIVPIAIFMSWSKPYHKLV 1294
            TSF+CFQYMSLYSAIQF+T+T+LYSRG NLGDFQFLYIDL LIVPIAI MSWSK Y K+ 
Sbjct: 1238 TSFACFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPIAICMSWSKSYEKID 1297

Query: 1295 KKRPSANLVSPKILAPLVANIAIILVFQATPWLVVQAMRWYQAPVVGGDDAVQSSDNTVL 1354
            KKRPSANLVSPKIL PL+ ++ ++ +FQ  PW++VQ M WY  P+VGGDDAVQSSDNTVL
Sbjct: 1298 KKRPSANLVSPKILVPLLISVFLVFLFQFIPWIIVQKMSWYIKPIVGGDDAVQSSDNTVL 1357

Query: 1355 FFFSNFQYVLTAIVLSVGPPYREPMSKNLGFITDVVISIILNVVLMMVPVDSTLGKVFQL 1414
            FF SNFQY+LTAIVLSVGPPYREPMSKN  FI D+ +SI  +++LM +  +S LGK+ QL
Sbjct: 1358 FFVSNFQYILTAIVLSVGPPYREPMSKNFEFIVDITVSIGASLLLMTLDTESYLGKMLQL 1417

Query: 1415 TDISSGFKGYLLIWAVLNYFAQLYIPCRCKG 1445
            T IS+ F  ++++W +LNY+AQLYIP   KG
Sbjct: 1418 TPISNSFTMFIIVWVILNYYAQLYIPPSIKG 1448

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 1741 bits (4508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 866/1456 (59%), Positives = 1075/1456 (73%), Gaps = 45/1456 (3%)

Query: 5    DLSHRGSTNGRNSRMRPSFSSARTGSSSNTLTSATVVDNNSTEAYAGATFETVPSSIVSF 64
            D  + GS +  N+R R SFSS +T SSSNT+TS+T+++  ++EAYAGA+FE VPSSIVSF
Sbjct: 4    DSRNAGSFSSNNARFRASFSSTKTTSSSNTMTSSTILEQRNSEAYAGASFEAVPSSIVSF 63

Query: 65   HHPHSFHTNGNSMLESASNSNELHSRSHEAEXXXXXXXXXXXXQGPSRTPNFRYFSEEEI 124
            HHPHS+ +     ++    S   ++ S                + PSR  +FR+FSE+++
Sbjct: 64   HHPHSYRSGAFGSVDMLERSRR-NTGSESVLLSPVRSRTSEISRTPSRATHFRFFSEQQL 122

Query: 125  ELAEGVSSTLESADYDINWDGTPTYEQERLHYHNPSGRSSIRSGTGHXXXXXXXXXXXXX 184
            E AEG +STLE  DYD +WD TP YEQERLH +  S RSS+R+G+               
Sbjct: 123  ENAEGAASTLEYTDYDTDWDATPAYEQERLHMNPRSSRSSLRNGSVGRGPSSTRAQSIQS 182

Query: 185  XXXXXXXXXXXXPTRQSQNRRENANQVFGTSPHXXXXXXXXXXXDRVPAGI--------- 235
                              N R  A    G SP            +R+P  +         
Sbjct: 183  YGAM-------------DNHRGRA-PYDGGSPRSSSSSSQYTFRERIPIEVEEEVGSVEL 228

Query: 236  --DDXXXXXXXXXXXXXXXXXDRRFLDDEDRNSSQDQASETKKKTSSYHAEYLKPQYHDR 293
              D+                 D RF  DE    S+ Q    KK   +YHAEYLKP+YHDR
Sbjct: 229  ADDNISSGHSDAESEDGLLNDDNRFTIDE---VSEPQYVSGKK---AYHAEYLKPRYHDR 282

Query: 294  FFPQNIPHLQFQRFYIAEEDLVVGIAGFRTSKFGKICYYLMSVITLGLFYLLLRWVPRYK 353
            F+P+N+PHL  QRFYIAEED+VVGIAG+RTS +    Y +   +TLG+ Y+L +W+PRYK
Sbjct: 283  FYPRNVPHLHMQRFYIAEEDMVVGIAGYRTSAWKTYIYNIFCCLTLGMLYILCKWIPRYK 342

Query: 354  VRLCGKKTHLAKAEWVVVENEFGELSIIEVSRRWYNRPLSTLLSMDKIADITEDIPNHHQ 413
            V+ CG KT L KAEWVVVEN++ ELSII V R WYNRPLST+L + +       + N  +
Sbjct: 343  VKFCGSKTFLGKAEWVVVENQYSELSIINVKRIWYNRPLSTVLPLKR------GLLNS-R 395

Query: 414  RHHHESKENPNIPIMISFSYRYFNLIYSPIEDLFKINSNWTDADWLSLSSIQKGLPTSVV 473
             +HHES+ENPNIPI+ISF YRY  LIYSP+ D+F+ N+NW D DW  LS + +GLP ++ 
Sbjct: 396  HYHHESEENPNIPILISFEYRYLTLIYSPLTDIFQTNTNWADPDWTDLSLVSRGLPNNIH 455

Query: 474  EDRMLAFGRNNINLKQKTSLEILFDEVLHPFYVFQIFSILLWLADNYYYYAACIFIISML 533
            EDRM+AFG+N+INL+QKT+ +ILFDE LHPFY+FQIFSI+LW+ D YYYYA CIFIIS+L
Sbjct: 456  EDRMIAFGKNSINLRQKTTSQILFDEALHPFYIFQIFSIILWMFDAYYYYATCIFIISVL 515

Query: 534  SIIDTLVETKKTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVPGDVYEISDPSLSTFPC 593
            S+IDTLVETK++S+RL+E+S  +C+VRVYRDGFW QV SS+LVPGD+YE++DPSLS  PC
Sbjct: 516  SVIDTLVETKQSSERLSELSQFYCDVRVYRDGFWSQVPSSDLVPGDIYELTDPSLSLLPC 575

Query: 594  DSLLLSGDCIVNESMLTGESVPVSKIPASDETIYQLLEDFQKTQISNFLAKSFLFNGTKI 653
            DS+L+SGDC+VNESMLTGESVPVSK+ A+ ET+ QLL+DF  TQ+S+F++KSFLFNGTK+
Sbjct: 576  DSILISGDCLVNESMLTGESVPVSKVAATRETMLQLLDDFMDTQLSSFVSKSFLFNGTKL 635

Query: 654  IRVRIGGEQSTALAMVVRTGFSTTKGSLLRSMIFPKPSGFKFYEDSFKYIGFMTLIALAG 713
            IRVR    QS AL MV RTGFSTTKGSL+RSM+FPKP+GFKFYEDSFKYIG++++IAL G
Sbjct: 636  IRVRATAGQSIALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFG 695

Query: 714  FSISCINFIRLGLAYKVMILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPT 773
            F++S I F+RLGL  + MILRALDIIT+VVPPALPA+LSIG  FA+ RLKKKGIFCI+PT
Sbjct: 696  FAVSFIQFLRLGLDKRTMILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPT 755

Query: 774  RVNVSGKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITNVRGLFNKYSLND 833
            RVNV GKIDVMCFDKTGTLTEDGLDVLGVHV +P   Q  +   L+T+V+ L    SL+D
Sbjct: 756  RVNVGGKIDVMCFDKTGTLTEDGLDVLGVHVVQPL-QQEMKISKLVTDVKDLLQSLSLSD 814

Query: 834  CGSPIDFKSRNFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNWSYAEDFQDFKFHSLNE 893
            C S  D K++NFLVSLLTCHSLR+VDGELLGDP DFKM QFT WS  E+  + K HSL E
Sbjct: 815  CVSTRDMKAKNFLVSLLTCHSLRMVDGELLGDPFDFKMVQFTKWSDEEETGNRKVHSLYE 874

Query: 894  ERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLLGVIRSFEFVSELRRMSVIVKP 953
            ER++ ST+PEN+  APA+VHP   S + +F E +P N++G++RSFEF+S LRRMSVIVKP
Sbjct: 875  ERHDGSTMPENSRFAPAIVHP---SGKGRFIEREPSNVIGIVRSFEFLSNLRRMSVIVKP 931

Query: 954  YGENVFWGFTKGAPEVISEICNKSTLPANYEQILQQYTHNGYRVIACAGKTLPKRTWRFA 1013
            + ENVF  FTKGAPEVI E+C+K TLP +YE +L  YTHNGYRVIACAGK L +++W ++
Sbjct: 932  FSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHHYTHNGYRVIACAGKKLTRQSWLYS 991

Query: 1014 QKVSREEVESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRES 1073
            QKVSREE+ESN+EFLGF++FENKLK +T  TL SL  A IR+IMCTGDNVLTAISVGRE+
Sbjct: 992  QKVSREEIESNLEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREA 1051

Query: 1074 GLITESHVFVPQIND-NMDPNEDLIIWRDVDDCDLILDGVTLEPMNG-SSDYTIAVTGDV 1131
            GL+    VFV  IND +     D+I W++V +    LD VTL P++G + DYT+AVTG+V
Sbjct: 1052 GLVESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEV 1111

Query: 1132 FRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQGLDYVVGFCGDGANDCGA 1191
            FRLLFK ++   E  IN +LLK+SIYARMSPDEKHELV +LQ + Y VGFCGDGANDCGA
Sbjct: 1112 FRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQSIGYQVGFCGDGANDCGA 1171

Query: 1192 LKAADVGXXXXXXXXXXXXPFTSSVFEISCILDVIKEGRASLTTSFSCFQYMSLYSAIQF 1251
            LKAAD+G            PFTS +FEISC+LDV+KEGRA+L TSF+CFQYMSLYSA QF
Sbjct: 1172 LKAADIGISLSEAEASVAAPFTSRLFEISCVLDVMKEGRAALVTSFACFQYMSLYSATQF 1231

Query: 1252 VTVTMLYSRGINLGDFQFLYIDLFLIVPIAIFMSWSKPYHKLVKKRPSANLVSPKILAPL 1311
            VT+ +LYSRG NLGDFQFLYIDLFLIVP+A+FMSWSKPY  L KKRP+ANLVSPKIL PL
Sbjct: 1232 VTILILYSRGSNLGDFQFLYIDLFLIVPLAVFMSWSKPYEVLAKKRPTANLVSPKILIPL 1291

Query: 1312 VANIAIILVFQATPWLVVQAMRWYQAPVVGGDDAVQSSDNTVLFFFSNFQYVLTAIVLSV 1371
            + +I I+ VFQ  PWL VQ M+WY+ PVVG D+ V SSDNT+LFF SNFQY+L A+VLSV
Sbjct: 1292 LVHIVILFVFQLVPWLAVQHMKWYRQPVVGDDEHVASSDNTILFFVSNFQYILVAVVLSV 1351

Query: 1372 GPPYREPMSKNLGFITDVVISIILNVVLMMVPVDSTLGKVFQLTDISSGFKGYLLIWAVL 1431
            GPPYREPMSKN+GFI DV++S++ +  +M +  DSTLG++FQLT+ S  F   ++ W  L
Sbjct: 1352 GPPYREPMSKNVGFIADVLVSLVASCRIMFLSPDSTLGRLFQLTEASHPFCLLIIGWVFL 1411

Query: 1432 NYFAQLYIPCRCKGLF 1447
            NY+AQLYIP   K LF
Sbjct: 1412 NYYAQLYIPPAFKTLF 1427

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 1735 bits (4493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 840/1444 (58%), Positives = 1058/1444 (73%), Gaps = 20/1444 (1%)

Query: 7    SHRGSTNGRNSRMRPSFSSARTGSSSNTLTSATVVDNNSTEAYAGATFETVPSSIVSFHH 66
            S  GS++    R R SFSSAR+ ++S TLTS+ ++D+N++E+YAGA FE VPSSIVSFH 
Sbjct: 4    SQHGSSS-HAQRTRASFSSARSNATSATLTSSVIIDHNNSESYAGAAFEAVPSSIVSFHR 62

Query: 67   PHSFHTNGNSMLESASNSNELHSRSHEAEXXXXXXXXXXXXQGPSRTPNFRYFSEEEIEL 126
            PHSF ++   M+ S+ NSN L   +                +  S   NFR+F++E++  
Sbjct: 63   PHSFQSS--HMMGSSLNSNMLERTTGAIHETEPLYQGNDHSRSSSNNRNFRFFTDEQVSQ 120

Query: 127  AEGVSSTLESADYDINWDGTPTYEQE-RLHYHNPSGRSSIRSGTGHXXXXXXXXXXXXXX 185
            AEG++ TLE+ DYDI+WD  P YEQE R   +  S RSSIR  +                
Sbjct: 121  AEGIA-TLENTDYDIDWDAAPAYEQENRAGSYMGSRRSSIRDISRRSSLSTSPYGSIDHR 179

Query: 186  XXXXXXXXXXXPTRQSQNRRENANQVFGTSPHXXXXXXXXXXXDRVPAGIDDXXXXXXXX 245
                         R +   R   +QV+ TS H           +R+P  ++D        
Sbjct: 180  G------------RSASKSRPRYDQVYQTSTHSSSSLSRYSVRERIPVEVEDQDDNSLDV 227

Query: 246  XXXXXXXXXDRRFLDDEDRNS-SQDQASETKKKTSSYHAEYLKPQYHDRFFPQNIPHLQF 304
                           +   N  S +   +T ++ S  H E+LKPQYHD+F+P+       
Sbjct: 228  HSSDQSLASSHSNTSNYGGNEGSVNPHDDTTQRKSQNHHEFLKPQYHDKFYPEFKADRHI 287

Query: 305  QRFYIAEEDLVVGIAGFRTSKFGKICYYLMSVITLGLFYLLLRWVPRYKVRLCGKKTHLA 364
            QR YI+EED+V+ IAG++TSKF  + Y L+ + TLG  +L+ +W+P+YKVR+ G+K  LA
Sbjct: 288  QRAYISEEDMVIVIAGYKTSKFMSLVYNLLCIFTLGGLFLIGKWLPKYKVRIVGRKAPLA 347

Query: 365  KAEWVVVENEFGELSIIEVSRRWYNRPLSTLLSMDKIADITEDIPNHHQRHHHESKENPN 424
            KAEW+V+ENE GE +I E +R WYNR LST+L +D   + TE+  +  QRHHH S+ENPN
Sbjct: 348  KAEWLVLENEHGEFTIEEPTREWYNRTLSTILMLDSKTE-TEEFEHGFQRHHHTSEENPN 406

Query: 425  IPIMISFSYRYFNLIYSPIEDLFKINSNWTDADWLSLSSIQKGLPTSVVEDRMLAFGRNN 484
            +PI+ISF YRY   +YSP++D+FK N+NW D DW+ L +  KGL + + EDR+LAF +N 
Sbjct: 407  LPILISFQYRYIKFVYSPLDDIFKTNNNWVDFDWVDLETTSKGLSSGIQEDRVLAFDKNQ 466

Query: 485  INLKQKTSLEILFDEVLHPFYVFQIFSILLWLADNYYYYAACIFIISMLSIIDTLVETKK 544
            INLK KT+ +ILFDEVLHPFY+FQ+ SI+LW  D YYYYA CIF+IS+LSI+DTL+ETKK
Sbjct: 467  INLKMKTTSQILFDEVLHPFYIFQVLSIILWSLDEYYYYAGCIFLISLLSILDTLIETKK 526

Query: 545  TSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVPGDVYEISDPSLSTFPCDSLLLSGDCIV 604
             S+ LAE+SH +CEVRV R+GFW  + SSELVPGD+YEISDP+L+  PCDS+LLSGDCIV
Sbjct: 527  ISRTLAEMSHFNCEVRVLREGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILLSGDCIV 586

Query: 605  NESMLTGESVPVSKIPASDETIYQLLEDFQKTQISNFLAKSFLFNGTKIIRVRIGGEQST 664
            NESMLTGESVPVSK PAS+ETI QL +DFQ TQIS FL+KSFLFNGT +IR +I    S 
Sbjct: 587  NESMLTGESVPVSKYPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSV 646

Query: 665  ALAMVVRTGFSTTKGSLLRSMIFPKPSGFKFYEDSFKYIGFMTLIALAGFSISCINFIRL 724
            ALAM VRTGFSTTKGSL+RSM+FPKPSGFKFY DSFKYIGFM +IA  GFSISCINFI+L
Sbjct: 647  ALAMAVRTGFSTTKGSLIRSMVFPKPSGFKFYSDSFKYIGFMAIIAFFGFSISCINFIKL 706

Query: 725  GLAYKVMILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVM 784
            GL  + MILRALDIITIVVPPALPATL+IG SFA+ RLK+KGIFCIAPTRVN+ GKIDVM
Sbjct: 707  GLDKRTMILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVM 766

Query: 785  CFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITNVRGLFNKYSLNDCGSPIDFKSRN 844
            CFDKTGTLTEDGLDVLGV V+         F  LI++   +F K+SL DC +P D+K RN
Sbjct: 767  CFDKTGTLTEDGLDVLGVRVSCAATRNKASFSDLISDTHDIFPKFSLKDCSNPDDYKRRN 826

Query: 845  FLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNWSYAEDFQDFKFHSLNEERNNKSTLPEN 904
            FL+SLLTCHSLRVVDGELLGDPLDFKMFQFT WSY EDFQ+ +FHSL EER+     PEN
Sbjct: 827  FLISLLTCHSLRVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFHSLYEERHEGQNFPEN 886

Query: 905  AGIAPAVVHPNAESTENKFTENDPHNLLGVIRSFEFVSELRRMSVIVKPYGENVFWGFTK 964
              I PA+VHPN     NKF +NDP+N+LG+IRSFEF+SELRRMSVIVKP  ENV+W +TK
Sbjct: 887  NDIIPAIVHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVKPNNENVYWAYTK 946

Query: 965  GAPEVISEICNKSTLPANYEQILQQYTHNGYRVIACAGKTLPKRTWRFAQKVSREEVESN 1024
            GAPEVI +ICN +TLP++Y+ IL  YTH+GYRVIACAGKTLPK TW ++QKV REEVESN
Sbjct: 947  GAPEVIIDICNPATLPSDYDDILNFYTHSGYRVIACAGKTLPKNTWLYSQKVRREEVESN 1006

Query: 1025 MEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVP 1084
            MEFLGF++F+NKLK +T+PTL+ L+ A IR++MCTGDNVLTAISVG+E  LITE  V+VP
Sbjct: 1007 MEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVP 1066

Query: 1085 QINDNMDPNEDLIIWRDVDDCDLILDGVTLEPMNG-SSDYTIAVTGDVFRLLFKNNEVLP 1143
             +  +    + +I W ++ + + ILD  TL+P++  S  YT+A+TG+VFR++F N +   
Sbjct: 1067 TVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYS 1126

Query: 1144 ESYINMVLLKSSIYARMSPDEKHELVGQLQGLDYVVGFCGDGANDCGALKAADVGXXXXX 1203
            E Y+N +LLK SI+ARMSPDEKHELV QLQ +DY VGFCGDGANDCGALKAADVG     
Sbjct: 1127 EEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGISLSE 1186

Query: 1204 XXXXXXXPFTSSVFEISCILDVIKEGRASLTTSFSCFQYMSLYSAIQFVTVTMLYSRGIN 1263
                   PFTS +F+I+C+LDVIKEGRASL TSF+CFQYMSLYSAIQF+++T+LYSRG N
Sbjct: 1187 AEASVAAPFTSKIFDITCVLDVIKEGRASLVTSFACFQYMSLYSAIQFISITILYSRGSN 1246

Query: 1264 LGDFQFLYIDLFLIVPIAIFMSWSKPYHKLVKKRPSANLVSPKILAPLVANIAIILVFQA 1323
            LGDFQFLYIDL LI+PIA+ MSWSKPYH+L KKRPSANLVSPKIL PL+ +I  + +FQ 
Sbjct: 1247 LGDFQFLYIDLLLIIPIAVTMSWSKPYHELAKKRPSANLVSPKILVPLILDIVFLFLFQF 1306

Query: 1324 TPWLVVQAMRWYQAPVVGGDDAVQSSDNTVLFFFSNFQYVLTAIVLSVGPPYREPMSKNL 1383
             PW+ +Q   WY  P+VGGDDAVQSSDNTVLF+ SNFQY+LT++VLS+GPPYREP+  N+
Sbjct: 1307 LPWIWIQGRPWYIKPIVGGDDAVQSSDNTVLFYISNFQYILTSVVLSIGPPYREPVHHNV 1366

Query: 1384 GFITDVVISIILNVVLMMVPVDSTLGKVFQLTDISSGFKGYLLIWAVLNYFAQLYIPCRC 1443
             ++ D+ +S++++ V+M+V  DS LG + QLT I +G    + IW +LNY+   ++P + 
Sbjct: 1367 QYVRDIALSVLVSFVIMLVNPDSKLGNLLQLTSIPTGLIILIPIWCMLNYYVLTHVPPKV 1426

Query: 1444 KGLF 1447
            K  F
Sbjct: 1427 KQYF 1430

>Scas_665.30
          Length = 1439

 Score = 1667 bits (4316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 796/1186 (67%), Positives = 954/1186 (80%), Gaps = 11/1186 (0%)

Query: 266  SSQDQASETKKKTSS---YHAEYLKPQYHDRFFPQNIPHLQFQRFYIAEEDLVVGIAGFR 322
            S++D  S  KK T+S   Y  EYLKPQYH++F+P N+  L +QRFYI EEDLVVGIAG+ 
Sbjct: 28   STEDTHSHHKKTTTSGGGYQTEYLKPQYHEKFYPSNVADLYYQRFYITEEDLVVGIAGYS 87

Query: 323  TSKFGKICYYLMSVITLGLFYLLLRWVPRYKVRLCGKKTHLAKAEWVVVENEFGELSIIE 382
            TSKF    Y  + +++ GL YLLLRW+P YKV+L G K  L KAEWVV+ENEFGE SI  
Sbjct: 88   TSKFKNAIYNFICIVSFGLLYLLLRWLPSYKVKLIGTKVPLGKAEWVVLENEFGEFSIEP 147

Query: 383  VSRRWYNRPLSTLLSMDKIADITEDIPNHHQRHHHE-----SKENPNIPIMISFSYRYFN 437
            + R WYNRP+ST+L +D      + I +   +H H      +++NPNIPI+I+F YRY  
Sbjct: 148  IKREWYNRPISTILPLDDPFQEIDGINDESYQHRHHHYHHVTEKNPNIPILITFQYRYIT 207

Query: 438  LIYSPIEDLFKINSNWTDADWLSLSSIQKGLPTSVVEDRMLAFGRNNINLKQKTSLEILF 497
             IYSP+ED+FK N+NWTD DW+ LSS  +GL + V EDR+LAF  N INL+ KT  E+LF
Sbjct: 208  FIYSPVEDIFKTNNNWTDPDWVDLSSTLRGLSSGVQEDRILAFDSNQINLRVKTVAELLF 267

Query: 498  DEVLHPFYVFQIFSILLWLADNYYYYAACIFIISMLSIIDTLVETKKTSQRLAEVSHSHC 557
            +EVLHPFYVFQIFSI+LW  D YYYYA CIF+IS+LSI+DTLVET++T + LA++SH  C
Sbjct: 268  NEVLHPFYVFQIFSIILWSLDEYYYYAGCIFLISILSIVDTLVETRRTQKSLADMSHFAC 327

Query: 558  EVRVYRDGFWVQVSSSELVPGDVYEISDPSLSTFPCDSLLLSGDCIVNESMLTGESVPVS 617
            EVRV+RD FW  V+S++LVPGD+YEISDPSL+ FPCDSLLLSGDCIVNESMLTGESVPVS
Sbjct: 328  EVRVFRDEFWTNVNSADLVPGDIYEISDPSLTVFPCDSLLLSGDCIVNESMLTGESVPVS 387

Query: 618  KIPASDETIYQLLEDFQKTQISNFLAKSFLFNGTKIIRVRIGGEQSTALAMVVRTGFSTT 677
            K PA  ET+ QLL+DFQ TQIS++L+KSFLFNGT IIR RI   QS ALAMVVRTGFSTT
Sbjct: 388  KFPAEPETMLQLLDDFQNTQISSYLSKSFLFNGTTIIRARIPYGQSAALAMVVRTGFSTT 447

Query: 678  KGSLLRSMIFPKPSGFKFYEDSFKYIGFMTLIALAGFSISCINFIRLGLAYKVMILRALD 737
            KGSL+RSM+FPKP+GFKFYEDSFKYIG M LIAL GFSISCI FI++GL  + MILRALD
Sbjct: 448  KGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIALFGFSISCIQFIKIGLDKRTMILRALD 507

Query: 738  IITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFDKTGTLTEDGL 797
            IITIVVPPALPATL+IG  FA++RLKKKGIFCI+PTRVN+ GKID++CFDKTGTLTE+GL
Sbjct: 508  IITIVVPPALPATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDILCFDKTGTLTENGL 567

Query: 798  DVLGVHVAEPQGHQNFRFGALITNVRGLFNKYSLNDCGSPIDFKSRNFLVSLLTCHSLRV 857
            DVLGV +  P  H +F+F  L+ +V  LF K+SLNDC SP D++++NF +SLLTCHSLRV
Sbjct: 568  DVLGVQLCVPSSHNSFQFADLVQDVHKLFPKFSLNDCSSPRDYRAKNFFISLLTCHSLRV 627

Query: 858  VDGELLGDPLDFKMFQFTNWSYAEDFQDFKFHSLNEERNNKSTLPENAGIAPAVVHPNAE 917
            VD EL+GDPLDFKMFQFT WSY EDFQ+ +FHS  EER + + LPEN  I PAVVHPN+ 
Sbjct: 628  VDNELIGDPLDFKMFQFTKWSYEEDFQEKEFHSTYEERRHDNALPENIDIIPAVVHPNSA 687

Query: 918  STENKFTENDPHNLLGVIRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPEVISEICNKS 977
              EN F +NDPHN LG+IRSFEF+SELRRMSVIVKP  E+V+W FTKGAPEVI++ICNK+
Sbjct: 688  DPENTFIDNDPHNFLGIIRSFEFLSELRRMSVIVKPSNEDVYWAFTKGAPEVITQICNKA 747

Query: 978  TLPANYEQILQQYTHNGYRVIACAGKTLPKRTWRFAQKVSREEVESNMEFLGFVVFENKL 1037
            TLPAN+E++L  YTH GYRVIACAG+ LP+ TW ++QKVSREEVESNMEFLGF++FENKL
Sbjct: 748  TLPANFEEMLNYYTHKGYRVIACAGRVLPRNTWLYSQKVSREEVESNMEFLGFIIFENKL 807

Query: 1038 KPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLI 1097
            K  T  TL +LQ+A IR++MCTGDNVLTAISVGR+  LI    V+VP + +     +  I
Sbjct: 808  KKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSI 867

Query: 1098 IWRDVDDCDLILDGVTLEPMNGSS--DYTIAVTGDVFRLLFKN-NEVLPESYINMVLLKS 1154
            IWRDVD+ D  LD  TL P+N SS   YT+A+TGD+FR++F + N  + E YIN VLLK 
Sbjct: 868  IWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVLLKG 927

Query: 1155 SIYARMSPDEKHELVGQLQGLDYVVGFCGDGANDCGALKAADVGXXXXXXXXXXXXPFTS 1214
            +IYARMSPDEKHEL+ QLQ L+Y VGFCGDGANDCGALKAADVG            PFTS
Sbjct: 928  TIYARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTS 987

Query: 1215 SVFEISCILDVIKEGRASLTTSFSCFQYMSLYSAIQFVTVTMLYSRGINLGDFQFLYIDL 1274
             VF+ISC+LDVIKEGRA L TSFSCFQYMSLYSAIQF+T+T+LYSRG NLGDFQFLYIDL
Sbjct: 988  QVFDISCVLDVIKEGRACLVTSFSCFQYMSLYSAIQFITITVLYSRGSNLGDFQFLYIDL 1047

Query: 1275 FLIVPIAIFMSWSKPYHKLVKKRPSANLVSPKILAPLVANIAIILVFQATPWLVVQAMRW 1334
             LIVPIAIFMSWSKPY K+VKKRPSANLVSPKIL PL+A+I ++L+FQ  PW++VQ   W
Sbjct: 1048 LLIVPIAIFMSWSKPYDKIVKKRPSANLVSPKILIPLLASIVVVLLFQIIPWIIVQGEEW 1107

Query: 1335 YQAPVVGGDDAVQSSDNTVLFFFSNFQYVLTAIVLSVGPPYREPMSKNLGFITDVVISII 1394
            Y  P+VGGDD V+SSDNT+LFF SNFQY+LTA++LSVGPPYREPMS+N+GFI DV+ISI+
Sbjct: 1108 YMKPIVGGDDVVESSDNTILFFISNFQYILTAVILSVGPPYREPMSRNIGFIVDVIISIV 1167

Query: 1395 LNVVLMMVPVDSTLGKVFQLTDISSGFKGYLLIWAVLNYFAQLYIP 1440
            L++ LM +   S LGK FQLT+IS  FK ++LIW V+NYF QLY+P
Sbjct: 1168 LSIWLMFIDSSSFLGKKFQLTEISFKFKLFILIWVVINYFVQLYVP 1213

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 56/125 (44%), Positives = 77/125 (61%), Gaps = 7/125 (5%)

Query: 45   STEAYAGATFETVPSSIVSFHHPHSFHTNGNSMLESASNSNELHSRSHEAE--XXXXXXX 102
            +TE Y+G TFETVPSSIVSFHHP SF +  +++  ++  S+ L  R  + E         
Sbjct: 1301 NTETYSGVTFETVPSSIVSFHHPRSFQS--SNIFGTSVGSSTLGRRGRDTEPLITSHSPS 1358

Query: 103  XXXXXQGPSRTPNFRYFSEEEIELAEGVSSTLESADYDINWDGTPTYEQERLHYHNPSGR 162
                 +  SR P F +F+E++I  AEG +STLE+ DY+  WD TP+YEQERL  +  S R
Sbjct: 1359 PIRRSRSSSRNPQFHFFTEDQINNAEG-TSTLENTDYNTPWDATPSYEQERL--YGTSNR 1415

Query: 163  SSIRS 167
            +S RS
Sbjct: 1416 TSRRS 1420

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
            Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
            start by similarity
          Length = 1206

 Score =  317 bits (811), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 231/759 (30%), Positives = 375/759 (49%), Gaps = 119/759 (15%)

Query: 466  KGLPTSVVEDRMLAFGRNNINLKQKTSLEILFDEVLHPFYVFQIFSILLWLADNYYYYAA 525
            KGL   +   + L +G N+ ++   T LE+  +  + PF++FQ+F + LWL D+ +YY+ 
Sbjct: 163  KGLNGDLTHHKRL-YGENSFDIPIPTFLELFKEHAVAPFFIFQLFCVALWLFDDLWYYS- 220

Query: 526  CIFIISMLSIIDTLVETKKTSQRLAEVSHSHC------EVRVYRDGFWVQVSSSELVPGD 579
             +F + M+      +E     QRL  +            + V+RDG WV++ + +L P D
Sbjct: 221  -LFNLFMI----VAMEATSVFQRLTTLKEFRTMGIKPYAINVFRDGKWVEMQTDKLFPMD 275

Query: 580  VYEISDPSL-STFPCDSLLLSGDCIVNESMLTGESVPVSKIPASDETIYQLLEDFQKTQI 638
            +  I+  +  S  PCD LL+ G CIVNE+ML+GES P+ K     E+I +L     + Q+
Sbjct: 276  LVSITRTAEDSAIPCDLLLIDGSCIVNEAMLSGESTPLLK-----ESI-KLRPANDQLQL 329

Query: 639  SNFLAKSFLFNGTKIIRVR--------IGGEQSTALAMVVRTGFSTTKGSLLRSMIFPKP 690
                  + L  GTK ++V         I      ALA+V +TGF T++GSL+R MIF   
Sbjct: 330  DGVDKNAVLHGGTKALQVTAPENRTGVITPPDGGALAVVTKTGFETSQGSLVRVMIFSAE 389

Query: 691  SGFKFYEDSFKYIGFMTLIALAGFSISCINFIRLGLAYKVMILRALDIITIVVPPALPAT 750
                  +++  +I F+ + A+           R+G     +IL  + IIT VVPP LP  
Sbjct: 390  RVDVGNKEALYFILFLLIFAIVASWYVWKEGTRMGRIQSKLILDCILIITSVVPPELPME 449

Query: 751  LSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGH 810
            L++  + ++A L K  ++C  P R+  +G+IDV CFDKTGTLT + L          +G 
Sbjct: 450  LTMAVNSSLAALSKFYVYCTEPFRIPYAGRIDVCCFDKTGTLTAEDLVF--------EGL 501

Query: 811  QNFRFGALITNVRGLFNKYSLNDCGSPIDFKSRNFLVSLLTCHSL-RVVDGELLGDPLDF 869
                 G+ I  ++      S ND        S+  L ++   H+L ++ DGE++GDP++ 
Sbjct: 502  AGLHDGSDIRTLK------SANDA-------SQEVLSAIGAAHALVKLDDGEIVGDPMEK 548

Query: 870  KMFQFTNWSYAEDFQDFKFHSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPH 929
               + ++W+   DF+D                         V    A++           
Sbjct: 549  ATLKASSWTV--DFKD------------------------VVKRAGADN----------- 571

Query: 930  NLLGVIRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPEVISEICNKSTLPANYEQILQQ 989
              + ++R F+F S L+R + I      N F+   KGAPE I E  N  ++P++Y+ I + 
Sbjct: 572  --IRILRRFQFSSSLKRSASIASQ--SNRFFAAVKGAPETIRERLN--SVPSDYDDIYKS 625

Query: 990  YTHNGYRVIACAGKTLPKRTWRFAQKVSREEVESNMEFLGFVVFENKLKPSTTPTLASLQ 1049
            +T +G RV+A A K LPK +      + R+E+E+ + F  F+VF   LK     T+  L 
Sbjct: 626  FTRSGSRVLALAYKDLPKMSNSQIDNIDRDEIETGLTFGAFLVFHCPLKDDAIETIKMLN 685

Query: 1050 DAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLIL 1109
            ++  RSIM TGDN LTA+ V +E G++    +    +++ +D +   ++ RDV++     
Sbjct: 686  ESSHRSIMITGDNPLTAVHVAKEVGIVDRETLI---LDEPIDGSSHALVMRDVNE----- 737

Query: 1110 DGVTLEPMNGSSD----------YTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYAR 1159
                ++P N  +D          Y +AVTG   +LL  + +      +  V+  + IYAR
Sbjct: 738  --TIVKPFNPDADTFDEKEIFQKYDLAVTGHALKLLQGHKQ------LRDVIRHTWIYAR 789

Query: 1160 MSPDEKHELVGQLQGLDYVVGFCGDGANDCGALKAADVG 1198
            +SP +K  ++  L+ + Y    CGDG ND GALK A VG
Sbjct: 790  VSPSQKEFILITLKDMGYQTLMCGDGTNDVGALKQAHVG 828

 Score = 70.9 bits (172), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 94/434 (21%), Positives = 176/434 (40%), Gaps = 76/434 (17%)

Query: 1045 LASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDD 1104
            L +L+D G +++MC GD          + G + ++HV +  +N   D  + L   R +D+
Sbjct: 799  LITLKDMGYQTLMC-GDGT-------NDVGALKQAHVGIALLNGTEDSLKKLQEQRKIDN 850

Query: 1105 CDLILDGVTL--------------------EPMNGSSDYTIAVTGDVFRLLFKNNEVLPE 1144
               + +   L                     P + + +Y  A+         K  E+ PE
Sbjct: 851  VKTMYEKQCLFMDRWNQPHPPVPIAIAHLYPPGSNNPNYLKAMEQ-------KGVEITPE 903

Query: 1145 --SYINMVLLKSSIYARMSPDEKHELVGQLQGLDYVVGFCGDGAN-DCGALKAADVGXXX 1201
                   V  K ++  +  P +K          D + G  G+  + D  +LK  D     
Sbjct: 904  MRKLAMEVSSKPAVVKKTEPSKK----SATDLADMISGSLGEMEDEDAPSLKLGDASCAA 959

Query: 1202 XXXXXXXXXPFTSSVFEISCILDVIKEGRASLTTSFSCFQYMSLYSAIQFVTVTMLYSRG 1261
                     PFTS +  ++ + ++I++GR +L  +   ++ ++L   I   +++++Y  G
Sbjct: 960  ---------PFTSKLANVNAVTNIIRQGRCALINTIQMYKILALNCLISAYSLSVIYLAG 1010

Query: 1262 INLGDFQFLYIDLFLIVPIAIFMSWSKPYHKLVKKRPSANLVSPKILAPLVANIAI---I 1318
            +  GD Q     L L V   + +S  KP  KL K+RP   + +  I+  ++   A+    
Sbjct: 1011 VKFGDGQATVSGLLLSVCF-LSISRGKPLEKLSKERPQPGIFNIYIMGSILGQFAVHILT 1069

Query: 1319 LVFQATPWLVVQAMRWYQAPVVGGD-DAVQSSDNTVLFFFSNFQYVLTAIVLSVGPPYRE 1377
            LV+  T    ++     + P V  + + V S  NT +F     Q V T +V   G P+RE
Sbjct: 1070 LVYITTEIYKIEP----REPQVDLEKEFVPSLLNTGIFMVQLAQQVSTFVVNYQGEPFRE 1125

Query: 1378 PMSKNLGFITDVV-ISII-----------LNVVLMMVPVDSTLGKVFQLTDISSGFKGYL 1425
             +  N G    +V +S++           LN  +  VP+D     +F++    +    + 
Sbjct: 1126 NIKNNKGMYYGIVGVSVLALCGSTEFIPELNAAMKFVPMDD----IFKMKLTGTLLLDFF 1181

Query: 1426 LIWAVLNYFAQLYI 1439
              WA   +F   ++
Sbjct: 1182 GSWAFELFFKYFFM 1195

>CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharomyces
            cerevisiae YEL031w SPF1 P-type ATPase, hypothetical start
          Length = 1214

 Score =  317 bits (811), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 223/740 (30%), Positives = 366/740 (49%), Gaps = 107/740 (14%)

Query: 480  FGRNNINLKQKTSLEILFDEVLHPFYVFQIFSILLWLADNYYYYAA--CIFIISMLSIID 537
            +G N  ++   T LE+  +  + P +VFQ+F + LWL D Y+Y +      I+SM     
Sbjct: 175  YGNNEFDIPIPTFLELFKEHAVAPLFVFQVFCVALWLLDEYWYLSLFNLFMILSM----- 229

Query: 538  TLVETKKTSQRLAEVSHSHC------EVRVYRDGFWVQVSSSELVPGDVYEISDPSL-ST 590
               E     QRL  +            + V RDG WV++ ++EL+P DV  +   +  S 
Sbjct: 230  ---EAASVFQRLTALKEFRTMGVKPYAINVLRDGKWVEMQTNELLPMDVVSVVRTAEDSA 286

Query: 591  FPCDSLLLSGDCIVNESMLTGESVPVSKIPASDETIYQLLEDFQKTQISNFLAKSFLFNG 650
             PCD +L+ G CIVNE+ML+GES P+ K     E+I +L    ++ QI      S L  G
Sbjct: 287  LPCDLILVDGTCIVNEAMLSGESTPLLK-----ESI-RLRPGNEELQIEGTDKISVLHGG 340

Query: 651  TKIIRV----RIGGEQST----ALAMVVRTGFSTTKGSLLRSMIFPKPSGFKFYEDSFKY 702
            TK+++V    + G   S     A+A+V +TGF T++GSL+R MI+         +++  +
Sbjct: 341  TKVLQVTTPEKTGKVPSPPDGGAIAIVTKTGFETSQGSLVRVMIYSSERVGVDNKEALYF 400

Query: 703  IGFMTLIALAGFSISCINFIRLGLAYKVMILRALDIITIVVPPALPATLSIGASFAIARL 762
            I F+ + A+       +   ++G     +IL  + IIT VVPP LP  L++  + +++ L
Sbjct: 401  ILFLLIFAVVASWYVWVEGTKMGRVQSKLILDCILIITSVVPPELPMELTMAVNSSLSAL 460

Query: 763  KKKGIFCIAPTRVNVSGKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITNV 822
             K  ++C  P R+  +G+IDV CFDKTGTLT + L   G+               L ++ 
Sbjct: 461  SKFYVYCTEPFRIPFAGRIDVCCFDKTGTLTGEDLVFEGL-------------AGLSSDP 507

Query: 823  RGLFNKYSLNDCGSPIDFKSRNFLVSLLTCHSL-RVVDGELLGDPLDFKMFQFTNWSYAE 881
            + + + YS  DC +     S + +V     H+L R+ DGE++GDP++    +   W+  +
Sbjct: 508  KDIRHLYSATDCPN-----STSLVVG--AAHALVRLEDGEIVGDPMEKATLKALKWTVEK 560

Query: 882  DFQDFKFHSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLLGVIRSFEFV 941
              + F       E+N + T                                 ++R F+F 
Sbjct: 561  GDKVFN------EKNGQVT---------------------------------ILRRFQFS 581

Query: 942  SELRRMSVIVKPYGENVFWGFTKGAPEVISEICNKSTLPANYEQILQQYTHNGYRVIACA 1001
            S L+R S +    G+   +   KGAPE I E     T+PANY++I + +T +G RV+A A
Sbjct: 582  SALKRSSSVATHDGK--LYSAVKGAPETIRE--RLFTIPANYDEIYKSFTRSGSRVLALA 637

Query: 1002 GKTLPKRTWRFAQKVSREEVESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGD 1061
             K L K +    +   RE  E ++EF GF++F   LK     T+  L ++  R +M TGD
Sbjct: 638  SKKLEKMSQSQIEDADREHFERDLEFNGFLIFHCPLKHDAIETIQMLNESAHRCVMITGD 697

Query: 1062 NVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDC---DLILDGVTLEPMN 1118
            N LTA+ V +E G++    + V  +++    N+D +++R+V++    + ++   + E   
Sbjct: 698  NPLTAVHVAKEVGIVKGETLIVDMVDNG---NDDKLVFRNVEETLSFEFVVSKDSFEKYG 754

Query: 1119 GSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQGLDYV 1178
                Y +AVTG     L  +++      +  ++  + IYAR+SP +K  ++  L+ + Y 
Sbjct: 755  IFDKYDLAVTGHALEALKGHHQ------LQDLIRHAWIYARVSPAQKEFILNNLKDMGYQ 808

Query: 1179 VGFCGDGANDCGALKAADVG 1198
               CGDG ND GALK A VG
Sbjct: 809  TLMCGDGTNDVGALKQAHVG 828

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 102/233 (43%), Gaps = 18/233 (7%)

Query: 1211 PFTSSVFEISCILDVIKEGRASLTTSFSCFQYMSLYSAIQFVTVTMLYSRGINLGDFQFL 1270
            PFTS +  +S + ++I++GR +L  +   ++ ++L   I   +++++Y  G+  GD Q  
Sbjct: 961  PFTSKLANVSAVTNIIRQGRCALVNTIQMYKILALNCLISAYSLSIIYMAGVKFGDGQAT 1020

Query: 1271 YIDLFLIVPIAIFMSWSKPYHKLVKKRPSANL----VSPKILAPLVANIAIILVFQATPW 1326
               L L V   + +S  KP  KL K RP A +    +   IL+  V +I  ++      +
Sbjct: 1021 TSGLLLSVCF-LSISRGKPLQKLSKARPQAGIFNVYIMGSILSQFVVHIGTLI------Y 1073

Query: 1327 LVVQAMRWY-QAPVVGGDDAVQSS-DNTVLFFFSNFQYVLTAIVLSVGPPYREPMSKNLG 1384
            L  +  R   + P V  +     S  NT +F     Q V T  V   G P+RE +  N G
Sbjct: 1074 LTNEIYRLEPREPQVDLEKEFAPSLLNTGIFIIQLVQQVSTFAVNYQGEPFRENIRSNKG 1133

Query: 1385 FITDV--VISIILNVVLMMVPVDSTLGKVFQLTDISSGFKGYLLIWAVLNYFA 1435
                +  V  + L      +P    L +  +   +   FK  L I   +++F 
Sbjct: 1134 MYYGLLGVTGLALASATEFIP---ELNEAMKFVPMEDDFKMKLTITLFVDFFG 1183

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
            (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score =  305 bits (781), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 224/761 (29%), Positives = 373/761 (49%), Gaps = 121/761 (15%)

Query: 466  KGLPTSVVEDRMLAFGRNNINLKQKTSLEILFDEVLHPFYVFQIFSILLWLADNYYYYAA 525
            +GL   +   ++L +G N  ++   + LE+  +  + PF+VFQIF + LWL D  +Y + 
Sbjct: 164  RGLSGDLTHMKLL-YGENTFDIPVPSFLELFKEHAVEPFFVFQIFCVALWLFDQMWYLSL 222

Query: 526  ----CIFIISMLSIIDTLVETKKTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVPGDVY 581
                 IF +  +S+   L     T +    +      + V+RD  W  + ++EL+P D+ 
Sbjct: 223  FNLFMIFAMEAVSVFQRLT----TLKEFKTMGIKPYGINVFRDSKWQLLQTNELLPMDLI 278

Query: 582  EIS----DPSLSTFPCDSLLLSGDCIVNESMLTGESVPVSKIPASDETIYQLLEDFQKTQ 637
             ++    D +LS   CD +L+ G CIVNE+ML+GES P+ K     E++ +L    +K Q
Sbjct: 279  SVTRTDEDSALS---CDMILVDGTCIVNEAMLSGESTPLLK-----ESV-KLRSSEEKLQ 329

Query: 638  ISNFLAKSFLFNGTKIIRVRIGGEQST---------ALAMVVRTGFSTTKGSLLRSMIFP 688
            +      S L  GTK+++V    + S+         ALA+V +TGF T++G+L+R MI+ 
Sbjct: 330  VEGLDKNSVLHGGTKVLQVTAPEKGSSSIPAPPDGGALAVVSKTGFETSQGALVRVMIYS 389

Query: 689  KPSGFKFYEDSFKYIGFMTLIALAGFSISCINFIRLGLAYKVMILRALDIITIVVPPALP 748
                    +++  +I F+ + A+A      +   R+G     +IL  + IIT VVP  LP
Sbjct: 390  SERVSVGNKEALYFILFLLIFAIAASWYVWVEGTRMGRVQSKLILDCILIITSVVPSELP 449

Query: 749  ATLSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFDKTGTLTEDGLDVLGVHVAEPQ 808
              L++  + ++A L K  ++C  P R+ ++G+IDV CFDKTGTLT  G D++   +A   
Sbjct: 450  MELTMAVNNSLAVLSKFYVYCTEPFRIPLAGRIDVCCFDKTGTLT--GEDLVFEGLAGLA 507

Query: 809  GHQNFRFGALITNVRGLFNKYSLNDCGSPIDFKSRNFLVSLLTCHSL-RVVDGELLGDPL 867
            G            V  LF    +     P+D    N ++     H+L R+ D E++GDP+
Sbjct: 508  GKNQ--------PVNHLFKGTEV-----PLD---TNLVIG--AAHALVRLDDDEVVGDPM 549

Query: 868  DFKMFQFTNWSYAEDFQDFKFHSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTEND 927
            +      T W                            G+  ++              N+
Sbjct: 550  EKATLAATGW--------------------------KVGVKDSL-------------SNE 570

Query: 928  PHNLLGVIRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPEVISEICNKSTLPANYEQIL 987
                + ++R F+F S L+R S I     ++  +   KGAPE I E    S +P +Y+Q+ 
Sbjct: 571  KVGDISILRRFQFSSALKRSSTIAVHNKQH--YSAVKGAPETIRE--RLSQVPTDYDQVY 626

Query: 988  QQYTHNGYRVIACAGKTLPKRTWRFAQKVSREEVESNMEFLGFVVFENKLKPSTTPTLAS 1047
            + +T  G RV+A A K LP  + +  +K+ RE VES++EF GF+VF   LK     T+  
Sbjct: 627  KSFTRAGSRVLALASKKLPSMSIKQIEKLEREAVESDLEFKGFLVFHCPLKDDAIETIKM 686

Query: 1048 LQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDL 1107
            L ++  R IM TGDN LTA+ V +E  ++    +    +++ +D +   +++R++++   
Sbjct: 687  LNESSHRCIMITGDNPLTAVHVAKEVAIVERETLI---LDEPIDGSSHALVFRNIEE--- 740

Query: 1108 ILDGVTLEPMNGSSD----------YTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIY 1157
                  + P N   D          Y IAVTG   +LL  +++      +N ++  + +Y
Sbjct: 741  ----TIVNPFNPEKDTFEHSKLFAKYDIAVTGHALQLLSGHSQ------LNELIRHTWVY 790

Query: 1158 ARMSPDEKHELVGQLQGLDYVVGFCGDGANDCGALKAADVG 1198
            AR+SP +K  ++  L+ + Y    CGDG ND GALK A VG
Sbjct: 791  ARVSPAQKEFIMNSLKDMGYQTLMCGDGTNDVGALKQAHVG 831

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 82/177 (46%), Gaps = 5/177 (2%)

Query: 1211 PFTSSVFEISCILDVIKEGRASLTTSFSCFQYMSLYSAIQFVTVTMLYSRGINLGDFQFL 1270
            PFTS +  +S + ++I++GR +L  +   ++ ++L   I   +++++Y  G+  GD Q  
Sbjct: 964  PFTSKLANVSAVTNIIRQGRCALINTIQMYKILALNCLITAYSLSVIYLAGVKFGDVQAT 1023

Query: 1271 YIDLFLIVPIAIFMSWSK--PYHKLVKKRPSANLVSPKILAPLVANIAIILVFQATPWLV 1328
               L + V    F+S S+  P  KL K+RP   + +  I+  ++   A+ +   A     
Sbjct: 1024 VSGLLITV---CFLSISRGQPLEKLSKERPQPGIFNVYIMGSILGQFAVHIAALAYINRE 1080

Query: 1329 VQAMRWYQAPVVGGDDAVQSSDNTVLFFFSNFQYVLTAIVLSVGPPYREPMSKNLGF 1385
            +  +   +  +    D   S  NT +F     Q V T  V   G P+RE +  N G 
Sbjct: 1081 IYFLEPREPQIDLEKDFSPSLLNTGIFLIQLAQQVSTFAVNYQGEPFRENIRSNKGM 1137

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transporting
            ATPase, member of the P-type ATPase superfamily of
            membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score =  301 bits (770), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 227/747 (30%), Positives = 360/747 (48%), Gaps = 121/747 (16%)

Query: 480  FGRNNINLKQKTSLEILFDEVLHPFYVFQIFSILLWLADNYYYYAA--CIFIISMLSIID 537
            +G N+ ++   T +E+  +  + P +VFQ+F + LWL D ++YY+      IISM     
Sbjct: 177  YGENSFDIPIPTFMELFKEHAVAPLFVFQVFCVALWLLDEFWYYSLFNLFMIISM----- 231

Query: 538  TLVETKKTSQRLAEVSHSHC------EVRVYRDGFWVQVSSSELVPGDVYEISDPSL-ST 590
               E     QRL  +            + V+R+  WV + ++EL+P D+  I+  +  S 
Sbjct: 232  ---EAAAVFQRLTALKEFRTMGIKPYTINVFRNKKWVALQTNELLPMDLVSITRTAEESA 288

Query: 591  FPCDSLLLSGDCIVNESMLTGESVPVSKIPASDETIYQLLEDFQKTQISNFLAKSFLFNG 650
             PCD +LL G  IVNE+ML+GES P+ K     E+I +L       Q+      + L  G
Sbjct: 289  IPCDLILLDGSAIVNEAMLSGESTPLLK-----ESI-KLRPSEDNLQLDGVDKIAVLHGG 342

Query: 651  TKIIRVRIGGEQST--------ALAMVVRTGFSTTKGSLLRSMIFPKPSGFKFYEDSFKY 702
            TK ++V     +S         ALA+V +TGF T++GSL+R MI+         +++  +
Sbjct: 343  TKALQVTPPEHKSDIPPPPDGGALAIVTKTGFETSQGSLVRVMIYSAERVSVDNKEALMF 402

Query: 703  IGFMTLIALAGFSISCINFIRLGLAYKVMILRALDIITIVVPPALPATLSIGASFAIARL 762
            I F+ + A+       +   ++G     +IL  + IIT VVPP LP  L++  + ++A L
Sbjct: 403  ILFLLIFAVIASWYVWVEGTKMGRIQSKLILDCILIITSVVPPELPMELTMAVNSSLAAL 462

Query: 763  KKKGIFCIAPTRVNVSGKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITNV 822
             K  ++C  P R+  +G+IDV CFDKTGTLT + L   G+              A   N+
Sbjct: 463  AKFYVYCTEPFRIPFAGRIDVCCFDKTGTLTGEDLVFEGLA----------GISADSENI 512

Query: 823  RGLFNKYSLNDCGSPIDFKSRNFLVSLLTCHSL-RVVDGELLGDPLDFKMFQFTNWSYAE 881
            R L+         S  +      LV +   H+L ++ DG+++GDP++    +   W+   
Sbjct: 513  RHLY---------SAAEAPESTILV-IGAAHALVKLEDGDIVGDPMEKATLKAVGWAV-- 560

Query: 882  DFQDFKFHSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLLGVIRSFEFV 941
                        ER N S   E  G                         L +IR F+F 
Sbjct: 561  ------------ERKN-SNYREGTG------------------------KLDIIRRFQFS 583

Query: 942  SELRRMSVIVKPYGENVFWGFTKGAPEVISEICNKSTLPANYEQILQQYTHNGYRVIACA 1001
            S L+R + I      +  +   KGAPE I E    S +P NY++I + +T +G RV+A A
Sbjct: 584  SALKRSASIAS--HNDALFAAVKGAPETIRE--RLSDIPKNYDEIYKSFTRSGSRVLALA 639

Query: 1002 GKTLPKRTWRFAQKVSREEVESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGD 1061
             K+LPK +      ++R++VES + F GF++F   LK     T+  L ++  RSIM TGD
Sbjct: 640  SKSLPKMSQSKIDDLNRDDVESELTFNGFLIFHCPLKDDAIETIKMLNESSHRSIMITGD 699

Query: 1062 NVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLILDGVTLEPMNGSS 1121
            N LTA+ V +E G++    + + +   +   +++ +++RDV++   I       P + S 
Sbjct: 700  NPLTAVHVAKEVGIVFGETLILDRAGKS---DDNQLLFRDVEETVSI-------PFDPSK 749

Query: 1122 D----------YTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQ 1171
            D          Y IAVTG      +  N +   S +  +L  + +YAR+SP +K  L+  
Sbjct: 750  DTFDHSKLFDRYDIAVTG------YALNALEGHSQLRDLLRHTWVYARVSPSQKEFLLNT 803

Query: 1172 LQGLDYVVGFCGDGANDCGALKAADVG 1198
            L+ + Y    CGDG ND GALK A VG
Sbjct: 804  LKDMGYQTLMCGDGTNDVGALKQAHVG 830

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/208 (25%), Positives = 92/208 (44%), Gaps = 17/208 (8%)

Query: 1182 CGDGAND-CGALKAADVGXXXXXXXXXXXXPFTSSVFEISCILDVIKEGRASLTTSFSCF 1240
             GD   D   ALK  D              PFTS +  +S + ++I++GR +L  +   +
Sbjct: 942  AGDAQGDEAPALKLGDASCAA---------PFTSKLANVSAVTNIIRQGRCALVNTIQMY 992

Query: 1241 QYMSLYSAIQFVTVTMLYSRGINLGDFQFLYIDLFLIVPIAIFMSWSKPYHKLVKKRPSA 1300
            + ++L   I   +++++Y  G+  GD Q     L L V   + +S  KP  KL K+RP +
Sbjct: 993  KILALNCLISAYSLSIIYMAGVKFGDGQATVSGLLLSVCF-LSISRGKPLEKLSKQRPQS 1051

Query: 1301 NLVSPKILAPLVANIAI---ILVFQATPWLVVQAMRWYQAPVVGGDDAVQSSDNTVLFFF 1357
             + +  I+  +++  A+    LV+  T    +  +   +  V    +   S  NT +F  
Sbjct: 1052 GIFNVYIMGSILSQFAVHIATLVYITTE---IYKLEPREPQVDLEKEFAPSLLNTGIFII 1108

Query: 1358 SNFQYVLTAIVLSVGPPYREPMSKNLGF 1385
               Q V T  V   G P+RE +  N G 
Sbjct: 1109 QLVQQVSTFAVNYQGEPFRENIRSNKGM 1136

>Scas_583.14*
          Length = 875

 Score =  216 bits (549), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 159/545 (29%), Positives = 260/545 (47%), Gaps = 90/545 (16%)

Query: 665  ALAMVVRTGFSTTKGSLLRSMIFPKPSGFKFYEDSFKYIGFMTLIALAGFSISCINFIRL 724
            AL +V +TGF T +GSL+R MI+         +++  +I F+   A+       +   ++
Sbjct: 19   ALVVVTKTGFETYQGSLVRVMIYSAERVGVDNKEALMFILFLLNFAVVASWYVWVEGTKM 78

Query: 725  GLAYKVMILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVM 784
            G     +IL  + IIT VVPP LP  L++  + ++A L K  ++C  P R+ ++G+IDV 
Sbjct: 79   GRIQSKLILDCILIITYVVPPELPMELTMAVNSSLAALSKFYVYCTEPFRIPLAGRIDVC 138

Query: 785  CFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITNVRGLFNKYSLNDCGSPIDFKSRN 844
            CFDKTGTLT + L   G+     +            +VR LF+           +  S+ 
Sbjct: 139  CFDKTGTLTGEDLVFEGLAGLSDKSE----------DVRHLFSS----------EDASQE 178

Query: 845  FLVSLLTCHSL-RVVDGELLGDPLDFKMFQFTNWSYAEDFQDFKFHSLNEERNNKSTLPE 903
             ++ +   H+L ++ DGE++GDP++    +   W                          
Sbjct: 179  TILVVGAAHALVKLDDGEIVGDPMEKATLKALGW-------------------------- 212

Query: 904  NAGIAPAVVHPNAESTENKFTENDPHNLLGVIRSFEFVSELRRMSVIVKPYGENVFWGFT 963
                         +   N FT       L ++R F+F S L+R S +   + + +F    
Sbjct: 213  -------------KVEGNDFTSRPKTGKLQILRRFQFSSALKRSSSVAS-HKDKLFTA-V 257

Query: 964  KGAPEVISEICNKSTLPANYEQILQQYTHNGYRVIACAGKTLPKRTWRFAQKVSREEVES 1023
            KGAPE I E    + +P NY++I + +T +G RV+A A K+LP  + +    + R+E+E+
Sbjct: 258  KGAPETIRE--RLAVVPKNYDEIYKSFTRSGSRVLALASKSLPNLSSKQLDDLDRDEIET 315

Query: 1024 NMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFV 1083
             + F GF+VF   LKP    T+  L ++  RSIM TGDN LTA+ V +E  ++T   + +
Sbjct: 316  GLTFNGFLVFHCPLKPDAVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAIVTGETLIL 375

Query: 1084 PQINDNMDPNEDLIIWRDVDDCDLILDGVTLEPMNGSSD----------YTIAVTGDVFR 1133
             +     D     +++ +V++   I       P + +SD          Y IAVTG    
Sbjct: 376  DKSETVGDGK---LLFFNVEETIKI-------PFDPASDKFDHRELFDKYDIAVTGYALN 425

Query: 1134 LLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQGLDYVVGFCGDGANDCGALK 1193
            LL  +      S +  ++  + +YAR+SP +K  ++  L+ + Y    CGDG ND GALK
Sbjct: 426  LLEDH------SQLKDLIRHTWVYARVSPSQKEFILNNLKEMGYQTLMCGDGTNDVGALK 479

Query: 1194 AADVG 1198
             A VG
Sbjct: 480  QAHVG 484

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 112/250 (44%), Gaps = 35/250 (14%)

Query: 1211 PFTSSVFEISCILDVIKEGRASLTTSFSCFQYMSLYSAIQFVTVTMLYSRGINLGDFQFL 1270
            PFTS + ++S + ++I++GR +L  +   ++ ++L   I   +++++Y  G+  GD Q  
Sbjct: 621  PFTSKLSKVSAVTNIIRQGRCALVNTIQMYKILALNCLISAYSLSIIYMAGVKFGDAQAT 680

Query: 1271 YIDLFLIVPIAIFMSWSKPYHKLVKKRPSANLVSPKILAPLVANIAI---ILVFQATPWL 1327
               L L V   + +S  KP  KL K+RP   + +  I+  +++  A+    LV+      
Sbjct: 681  VSGLLLSVCF-LSISRGKPIQKLSKQRPQKGIFNVYIMGSILSQFAVHIFTLVYITREIY 739

Query: 1328 VVQAMRWYQAPVVGGDDAVQSS-DNTVLFFFSNFQYVLTAIVLSVGPPYREPMSKN---- 1382
            +++     + P V  +     S  NT +F     Q V T  V   G P+RE +  N    
Sbjct: 740  ILEP----REPQVDLEKEFAPSLLNTGIFIIQLVQQVSTFAVNYQGEPFRENIRNNRGMY 795

Query: 1383 ---LGFITDVVISII-----LNVVLMMVPVDSTLGKVFQLTDISSGFKGYLLI-----WA 1429
               LG  +  ++S       LN  +  VP+D      F+LT       G LL+     WA
Sbjct: 796  FGLLGVSSLALVSATEFMPELNEAMNFVPMDDIFK--FKLT-------GTLLLDFFGSWA 846

Query: 1430 VLNYFAQLYI 1439
               +F   ++
Sbjct: 847  AEYFFKYFFM 856

>Kwal_14.1498
          Length = 939

 Score =  125 bits (314), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 207/934 (22%), Positives = 361/934 (38%), Gaps = 174/934 (18%)

Query: 465  QKGLPT-SVVEDRMLAFGRNNINLKQKTSLEILF------DEVLHPFYVFQIFSILLWLA 517
            Q GLPT SVVE+R   +G+N I+ ++   L   F      D ++       + S ++   
Sbjct: 50   QNGLPTMSVVEERRAQYGKNEISSEEDEPLWWKFVTTFVGDPLILLLIGSAVISFIMGNI 109

Query: 518  DNYYYYAACIFIISMLSIIDTLVETKKTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVP 577
            D+       I I+  +  +     ++K+ + L  +    C   + R G   ++ +S LVP
Sbjct: 110  DDAVSITLAIVIVVTVGFVQEY-RSEKSLEALNRLVPDQC--HLIRCGQESKLLASVLVP 166

Query: 578  GDV--YEISDPSLSTFPCDSLLLSG-DCIVNESMLTGESVPVSKIPASDETIYQLLEDFQ 634
            GDV  + + D      P D  ++   D  + ES LTGE+ PV K  A+      + ++F 
Sbjct: 167  GDVVRFRVGD----RIPADLRIIEAVDLSIEESNLTGENEPVHKSTAT------VNKEFY 216

Query: 635  KTQISNFLAKS----FLFNGTKIIRVRIGGEQSTALAMVVRTGFSTTKGSLLRSMIFPKP 690
            K  + + +  S      F GT    VR G  +   +     T F      ++ ++  PK 
Sbjct: 217  KENLGSIVPVSERSCIAFMGT---LVREGHGRGIVIGTAKNTAFGKV-FEMMNAIEKPKT 272

Query: 691  SGFKFYEDSFKYIGFMTLIALAGFSISCINFIRLGLAYKVMILRALDIITIVVPPALPAT 750
                  +   K + FM+ I +    I C+  +  G ++  M   ++ +    +P  LP  
Sbjct: 273  PLQTAMDKLGKDLSFMSFIVIG---IICLIGVIQGRSWLEMFQISVSLAVAAIPEGLPII 329

Query: 751  LSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGH 810
            +++  +  + R+ K+         V   G ++V+C DKTGTLT + + V  V       +
Sbjct: 330  VTVTLALGVLRMAKRRAIIRRLPSVETLGSVNVICSDKTGTLTANHMSVNKVWCLGSMSN 389

Query: 811  QNFRFGALITNVRGLFNKYSLNDCGSPIDFKSRNFLVSLLTCHSLRVVDGELLGDPLDFK 870
            ++     L     G F K    D  + +  ++ N   +    H       + LG+P D  
Sbjct: 390  KS-NILKLDKATSGSFKKNLTEDLRATL--RTGNLCNNSTYSHE----HAKYLGNPTDIA 442

Query: 871  MFQFTNWSYAEDFQDFKFHSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPHN 930
            + +  +          KF  L +ER             P V   +               
Sbjct: 443  LLEVLH----------KF-GLEDER-------------PQVTRSD--------------- 463

Query: 931  LLGVIRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPEVISEICNKSTLPANYEQILQQY 990
                     F S+ + M+V VK      F    KGA E I E   KST   N E  + + 
Sbjct: 464  ------EISFNSKRKFMAVKVKE-ANGKFVVHVKGAYEKILE---KSTHFINAENKVVKL 513

Query: 991  THNGYRVIACAGKTLPK---RTWRFAQ---------KVSREEVESNMEFLGFVVFENKLK 1038
              N  + I  +   L     RT  FAQ         K++ +++ + + F G +   +  +
Sbjct: 514  DSNLRQAITDSADALASDGLRTLAFAQLELSNGNSKKLTEDDI-NGLTFAGLLGMNDPPR 572

Query: 1039 PSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLII 1098
            PS    +  L +  +  IM TGD   TA+S+ R+ G        +P +N           
Sbjct: 573  PSVKAAVERLSEGSVHIIMITGDAENTAVSIARQIG--------IPVVNPE--------- 615

Query: 1099 WRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYA 1158
                                     T  +TGD         + + E  +  ++   +I+A
Sbjct: 616  -------------------------TAVLTGDKL-------DHMSEDQLASIIDHVNIFA 643

Query: 1159 RMSPDEKHELVGQLQGLDYVVGFCGDGANDCGALKAADVGXXXXXXXXXXXXPFTSSVF- 1217
            R +P+ K  +V  LQ    +V   GDG ND  ALK AD+G              +  V  
Sbjct: 644  RATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLT 703

Query: 1218 --EISCILDVIKEGRASLTT--SFSCFQYMSLYSAIQFVTVTMLYSRGINLGDFQFLYID 1273
              + S IL  I+EG+       +F  FQ  +  +A+  V +   +     L   Q L+I+
Sbjct: 704  DDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAIATAFKLPNPLNAMQILWIN 763

Query: 1274 LFLIVPIAIFMSWSKPYHKLVKKRP---SANLVSPKILAPLVANIAIILVFQATPWLVVQ 1330
            + +  P A  +      H+++KK P   +  +++  +   L+ + A+I++   T ++ ++
Sbjct: 764  ILMDGPPAQSLGVEPVDHEVMKKPPRKRADKILTKAVFQRLLQSAALIII--GTIYVFIK 821

Query: 1331 AMRWYQAPVVGGDDAVQSSDNTVLF----FFSNF 1360
             M          D  V + D T+ F    FF  F
Sbjct: 822  EM--------AEDGEVTARDTTMTFTCFVFFDMF 847

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
            cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score =  117 bits (292), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 184/855 (21%), Positives = 316/855 (36%), Gaps = 192/855 (22%)

Query: 558  EVRVYRDGFWVQVSSSELVPGDVYEISDPSLSTFPCDSLLLSGDCIVNESMLTGESVPVS 617
            +V V RD     +S   L+ GD+ ++   +    P D +L+ G+C  +ES LTGES  + 
Sbjct: 158  QVVVVRDAAESLISIHNLLVGDLLKLQ--TGDVVPADCVLVRGECETDESALTGESNTIK 215

Query: 618  KIPASDETIYQLL---EDFQKTQISNFLAKS--------FLFNGTKIIRVRIGGEQSTAL 666
            K+P +D   Y       D   T  S     +         L +G++++          A 
Sbjct: 216  KLPLADALEYHSAHGGRDIGDTSASGASGAADDSRCPDCMLISGSRVL-------SGLAS 268

Query: 667  AMVVRTGFSTTKGSLLRSMI-----FPKPSGFKFYEDSFKYIGFMTLIAL---------- 711
            A+V   G ++  G  + S+       P         D+    G +  I L          
Sbjct: 269  AIVTNVGVNSVHGKTMASLKEDSEDTPLQMRLSQLTDNISVYGCVAAITLFVVLFARYLS 328

Query: 712  ----AGFSISCINFIRLGLAYKVMILRALDIITIVVPPALPATLSIGASFAIARLKKKGI 767
                +G     +     G  +  + + A+ +I + VP  LP  +++  +FA  R+ K G 
Sbjct: 329  YILPSGGKYHDLPPAEKGSKFMDIFITAITVIVVAVPEGLPLAVTLALAFATTRMTKDGN 388

Query: 768  FCIAPTRVNVSGKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITNVRGLFN 827
                       G    +C DKTGTLTE+                      ++T VRG   
Sbjct: 389  LVRVLRSCETMGSATAVCSDKTGTLTEN----------------------IMTVVRGTLG 426

Query: 828  KYSLNDCGSPIDFKSRNFLVSLLTCHSL--RVVDGELLGDPLDFKMFQF---TNWSYAED 882
            +   +D G+     S++ LV    C  L   V+   ++ +   F+   +    N++  +D
Sbjct: 427  RAGFDDIGAD---PSKSNLVFKKKCSDLLRTVIYDNIVLNSTAFENKDYKDPNNYNSIDD 483

Query: 883  FQDFKF-HSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLL--------- 932
             Q  +    + +    K    E   +A A     AE  +  +  +     L         
Sbjct: 484  SQPRRLIRRITQTLQKKKPDDEENLLAHA-----AEGRQEPYIGSKTETALLSLARKSFG 538

Query: 933  ---GVIRSF----------EFVSEL------RRMSVIVKPYGENV------FWGFTKGAP 967
               G ++SF          E + ++      R+ S IV     N       F  + KGA 
Sbjct: 539  LKFGALQSFRGHPEKLPTVETIVQIIPFESSRKWSAIVVKLNSNKENEGKKFRLYVKGAA 598

Query: 968  EVISEICN-KSTLPANYEQILQQ-----------YTHNGYRVIACAGKTLPKRTW---RF 1012
            E++++ C  K+       +I Q+              +  R I+ A        W     
Sbjct: 599  EIVAKACTLKNVCNEGISEIDQKSKDDIEEQIFSLAKDALRAISLAHMDFDVNEWPPKEL 658

Query: 1013 AQKVSREEV---------ESNMEFL---GFVVFENKLKPSTTPTLASLQDAGIRSIMCTG 1060
            A   +  E          + ++E L     V  ++ L+ +   ++A  Q AG+   M TG
Sbjct: 659  ADPENSHEALAVKLIDPKKPHLEGLTLDAIVGIQDPLRENVKNSVAQCQKAGVTVRMVTG 718

Query: 1061 DNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLILDGVTLEPMNGS 1120
            DN+LTA ++ R  G+++   +                                       
Sbjct: 719  DNLLTAKAIARNCGILSSKSL--------------------------------------- 739

Query: 1121 SDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQGLDYVVG 1180
            +D   A+ G  FR        L +S    +L K  + AR SP++K  LV  L+ +  VV 
Sbjct: 740  NDSACAMEGPAFR-------KLSDSERKRILPKLRVLARSSPEDKKILVRALKEMGEVVA 792

Query: 1181 FCGDGANDCGALKAADVGXXXXXXXXXXXXPFTSSVF---EISCILDVIKEGR--ASLTT 1235
              GDG ND  ALK ADVG              +  +    + S I++ IK GR  A+   
Sbjct: 793  VTGDGTNDAPALKLADVGFSMGITGTEVAREASDIILMTDDFSAIVNAIKWGRCVAASIK 852

Query: 1236 SFSCFQYMSLYSAIQFVTVTMLYSRGIN--LGDFQFLYIDLFLIVPIAIFMSWSKPYHKL 1293
             F  FQ +   +A+    VT + S  +   L   Q L+++L +    A+ ++  KP   +
Sbjct: 853  KFIQFQLIVNVTAVLLTFVTSVISSDVKSVLTAVQLLWVNLIMDTLAALALATDKPDPNI 912

Query: 1294 VKKRP---SANLVSP 1305
            + ++P   S  L++P
Sbjct: 913  MDRKPKGRSTPLITP 927

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
            Ca2+-transporting P-type ATPase, member of the cation
            transporting (E1-E2) P-type ATPase superfamily, functions
            to pump Ca2+ into the vacuole [3522 bp, 1173 aa]
          Length = 1173

 Score =  115 bits (288), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 197/886 (22%), Positives = 349/886 (39%), Gaps = 186/886 (20%)

Query: 558  EVRVYRDGFWVQVSSSELVPGDVYEISDPSLSTFPCDSLLLSGDCIVNESMLTGESVPVS 617
            ++ V R+   + +S   ++ GDV  IS  +    P D +++SG C  +ES +TGES  + 
Sbjct: 193  KIIVIRNDQEILISIHHVLVGDV--ISLQTGDVVPADCVMISGKCEADESSITGESNTIQ 250

Query: 618  KIPASDETIYQLLEDFQK------------------TQISNFLAKSFLFNGTKIIRVRIG 659
            K P  +      L DF+K                   +  N +A   L +G++I+     
Sbjct: 251  KFPVDNS-----LRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGSRIL----- 300

Query: 660  GEQSTALAMVVRTGFSTTKGSLLRSM-IFPKPSGFKFY----EDSFKYIGFMTLIALAGF 714
                    ++   G ++  G  + S+   P+ +  + +     D+    G ++ I L  F
Sbjct: 301  --SGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVYGCVSAIIL--F 356

Query: 715  SISCINFI----------------RLGLAYKVMILRALDIITIVVPPALPATLSIGASFA 758
             +    ++                + G  +  + + ++ +I + VP  LP  +++  +FA
Sbjct: 357  LVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVIVVAVPEGLPLAVTLALAFA 416

Query: 759  IARLKKKGIFCIAPTRVNVSGKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGAL 818
              R+ K G            G    +C DKTGTLTE+   V+ V    P G+  F     
Sbjct: 417  TTRMTKDGNLVRVLRSCETMGSATAVCSDKTGTLTEN---VMTVVRGFP-GNSKFDDSKS 472

Query: 819  --ITNVRGLFNKYSLND-CGSPIDFKSRNFLVSLLTCHSLRVVDGEL------------L 863
              ++  R L +K    + C S +    RN L++ +  +S    + +             +
Sbjct: 473  LPVSEQRKLNSKKVFEENCSSSL----RNDLLANIVLNSTAFENRDYKKNDKNTNGSKNM 528

Query: 864  GDPLDF-----KMFQFTNWSYAEDFQDFKFHSLNEERNNK--STLPENAGIAPAVVHPNA 916
               L F         F      ED +D  F ++N+ R      +  E A ++ A +    
Sbjct: 529  SKNLSFLDKCKSRLSFFKKGNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGL 588

Query: 917  ESTENKFTENDPH---NLLGVIRSFEFVSELRRMSVIVK-PYGEN---VFWGFTKGAPEV 969
            +  E ++  + P    N+  V+++  F S  +   ++VK   G+N    +  F KGA E+
Sbjct: 589  QPGELQYLRDQPMEKFNIEKVVQTIPFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAEI 648

Query: 970  ISEICN-KSTLPANYEQI-----------LQQYTHNGYRVIACAGKTLPK-RTWRFAQKV 1016
            +S+ C+ K       E+I           ++    +  R I+ A K   +  +W   Q  
Sbjct: 649  VSKNCSYKRNSDDTLEEINEDNKKETDDEIKNLASDALRAISVAHKDFCECDSWPPEQ-- 706

Query: 1017 SREEVESNMEFL-------------GFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNV 1063
             R++   N+  L             G +  ++ L+     ++   Q AG+   M TGDN+
Sbjct: 707  LRDKDSPNIAALDLLFNSQKGLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNI 766

Query: 1064 LTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLILDGVTLEPMNGSSDY 1123
            LTA ++ R   +++                       D+                 SS+ 
Sbjct: 767  LTAKAIARNCAILST----------------------DI-----------------SSEA 787

Query: 1124 TIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQGLDYVVGFCG 1183
              A+ G  FR L KN  +        +L    + AR SP++K  LV  L+G+  VV   G
Sbjct: 788  YSAMEGTEFRKLTKNERI-------RILPNLRVLARSSPEDKRLLVETLKGMGDVVAVTG 840

Query: 1184 DGANDCGALKAADVGXXXXXXXXXXXXPFTSSVF---EISCILDVIKEGRASLTTSFSCF 1240
            DG ND  ALK ADVG              +  +    + S I++ IK GR  ++ S   F
Sbjct: 841  DGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFSAIVNAIKWGRC-VSVSIKKF 899

Query: 1241 QYMSLYSAIQFVTVTMLYSRGIN-----LGDFQFLYIDLFLIVPIAIFMSWSKPYHKLVK 1295
                L   I  V +T + S   +     L   Q L+I+L +    A+ ++  KP   ++ 
Sbjct: 900  IQFQLIVNITAVILTFVSSVASSDETSVLTAVQLLWINLIMDTLAALALATDKPDPNIMD 959

Query: 1296 KRP---SANLVSPKILAPLVANIAIILVFQATPWLVVQAMRWYQAP 1338
            ++P   S +L+S       V+   +IL  QAT  L+V  +  +  P
Sbjct: 960  RKPRGRSTSLIS-------VSTWKMILS-QATLQLIVTFILHFYGP 997

>Kwal_47.17547
          Length = 1240

 Score =  110 bits (276), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 184/854 (21%), Positives = 309/854 (36%), Gaps = 200/854 (23%)

Query: 558  EVRVYRDGFWVQVSSSELVPGDVYEISDPSLSTFPCDSLLLSGDCIVNESMLTGESVPVS 617
            EV V R+G    +S  +++ GD+  +    +   P D +L+ G C  +ES LTGES  + 
Sbjct: 187  EVIVLRNGDEHLISIHDILVGDILSLQTGDV--VPADCILVKGSCECDESALTGESATIK 244

Query: 618  KIPASDETIYQLLEDFQKTQIS--------NFLAKSFLFNGTKIIRVRIGGEQSTALAMV 669
            K  A+ +  Y+  +    T  +          +    L +G+K++            A+V
Sbjct: 245  K--AAIDVCYEKYKQLSATDAAIDIGTPGAEKVPDPMLISGSKLL-------SGLGRAVV 295

Query: 670  VRTGFSTTKGSLLRSM-IFPKPSGFKFYEDSFK---------------YIGFMTLIA--L 711
               G ++  G  L ++ +  + +  +   DS                 +I FM  +A   
Sbjct: 296  TSVGVNSMHGRTLMALKVEAETTPLQERLDSLANSISVYGSAAALLLFFILFMRFLANLK 355

Query: 712  AGFSISCINFIRLGLAYKVMILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIA 771
             G  +  +   + G  +  + +  + +I + VP  LP  +++  +FA  R+ K G     
Sbjct: 356  KGGELHDLTPAQKGSRFMNIFIVGITVIVVAVPEGLPLAVTLALAFATTRMAKDGNLVRV 415

Query: 772  PTRVNVSGKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITNVRGLFNKYSL 831
                   G    +C DKTGTLTE+ + V                      V+G       
Sbjct: 416  LRACETMGSATAVCSDKTGTLTENRMTV----------------------VKGFLGSTFF 453

Query: 832  NDCGS--PIDFKSRNFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNWSYAEDFQDF--- 886
            ++  S  P D ++   L     C        EL  D L       T +   E+ +D    
Sbjct: 454  DEAESVGPSDSETDVDLAIANECSE------ELKKDVLTNITLNSTAFENKENEEDKVSN 507

Query: 887  --KFHSLNEE-----RNNKSTLP-------ENAGIAPAVVHPN-------------AEST 919
               FH   +      RNNKS  P       ENA    A   P              A + 
Sbjct: 508  ENPFHKPRKSLFPWSRNNKSKKPATAKELVENA----AADQPKEPFLGSKTETALLAFAQ 563

Query: 920  ENKFTEN-----DPHNLLGVIRSFEFV--SELRRMSVIVKPYGENVFWGFTKGAPEVISE 972
            +N   +N     D  + LG+ +  + +     R+   IV  Y   +   + KGA E++  
Sbjct: 564  KNLGMQNLHHYRDEPDCLGIEKIVQIIPFESSRKWGGIVVKYKNGLHRFYIKGAAELLLR 623

Query: 973  IC-------NKSTLPANYE-----QILQQYTHNGYRVIACAGKTLPK-RTW--------- 1010
             C       +K TL +  +     Q +        R I+ A +  P    W         
Sbjct: 624  RCMQKRASDSKLTLISQKDFDEESQTITNLAAEALRAISLAHRDYPNCPNWPPSELQDEV 683

Query: 1011 ---------RFAQKVSR--------EEVESNMEFLGFVVFENKLKPSTTPTLASLQDAGI 1053
                      F  +VSR        +E+ S M   G V  ++ L+     ++   Q AG+
Sbjct: 684  EPEAASPDLLFGDEVSRSDSVSEPAQELVSPMVLDGIVGIQDPLRKGVRKSVEQCQKAGV 743

Query: 1054 RSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLILDGVT 1113
               M TGDN+LTA ++ ++  +++E     P+                            
Sbjct: 744  TVRMVTGDNILTATAIAKKCSILSEEQAENPES--------------------------- 776

Query: 1114 LEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQ 1173
                        ++ G  FR L     V        +L    + AR SP++K  LV  L+
Sbjct: 777  ------------SMEGPRFRKLSNKERV-------RILPNLRVLARSSPEDKRILVETLK 817

Query: 1174 GLDYVVGFCGDGANDCGALKAADVGXXXXXXXXXXXXPFTSSVF---EISCILDVIKEGR 1230
             +  VV   GDG ND  ALK ADVG              +  +    + S I++ IK GR
Sbjct: 818  KMGDVVAVTGDGTNDAPALKLADVGFSMGIAGTEVAREASDIILMTDDFSAIVNAIKWGR 877

Query: 1231 ASLTT--SFSCFQYMSLYSAI--QFVTVTMLYSRGINLGDFQFLYIDLFLIVPIAIFMSW 1286
               T+   F  FQ     +A+   FV+          L   Q L+++L +    A+ ++ 
Sbjct: 878  CVSTSIKKFIQFQLTVNVTAVVLTFVSAVASSEEASVLTAVQLLWVNLIMDTLAALALAT 937

Query: 1287 SKPYHKLVKKRPSA 1300
             KP   +++++P  
Sbjct: 938  DKPDENILERKPKG 951

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
            Ca2+-transporting P-type ATPase of Golgi membrane
            involved in Ca2+ and Mn2+ import into Golgi [2853 bp, 950
            aa]
          Length = 950

 Score =  110 bits (275), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 201/921 (21%), Positives = 368/921 (39%), Gaps = 161/921 (17%)

Query: 475  DRMLAFGRNNINLKQKTSL------EILFDEVLHPFYVFQIFSILLWLADNYYYYAACIF 528
            +R   +G N I ++   SL        + D ++       + S+ +   D+       IF
Sbjct: 66   NRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSITLAIF 125

Query: 529  IISMLSIIDTLVETKKTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVPGDV--YEISDP 586
            I+  +  +     ++K+ + L ++  + C   + R G    V +S LVPGD+  + I D 
Sbjct: 126  IVVTVGFVQEY-RSEKSLEALNKLVPAEC--HLMRCGQESHVLASTLVPGDLVHFRIGD- 181

Query: 587  SLSTFPCDSLLLSG-DCIVNESMLTGESVPVSKIPASDETIYQLLEDFQKTQISNFLAKS 645
                 P D  ++   D  ++ES LTGE+ PV K   + +TI +   + Q   I     +S
Sbjct: 182  ---RIPADIRIIEAIDLSIDESNLTGENEPVHK---TSQTIEKSSFNDQPNSIVPISERS 235

Query: 646  FL-FNGTKIIRVRIGGEQSTALAMVVRTGFSTTKGSLLRSM--IFPKPSGFKFYEDSFKY 702
             + + GT +       ++     +VV TG +T+ G++   M  I    +  +   D  K 
Sbjct: 236  CIAYMGTLV-------KEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMD--KL 286

Query: 703  IGFMTLIALAGFSISCINFIRLGLAYKVMILRALDIITIVVPPALPATLSIGASFAIARL 762
               ++L++     + C+  I  G ++  M   ++ +    +P  LP  +++  +  + R+
Sbjct: 287  GKDLSLVSFIVIGMICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRM 346

Query: 763  -KKKGIFCIAPTRVNVSGKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITN 821
             K+K I    P+ V   G ++V+C DKTGTLT + + V  +   +   ++         N
Sbjct: 347  AKRKAIVRRLPS-VETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNK--------LN 397

Query: 822  VRGL-FNKYSLNDCGSPIDFKSRNFLVSLLT---CH--SLRVVDGELLGDPLDFKMFQFT 875
            V  L  NK + N  G+  ++ + +   +L     C+  S        LG+P D  +    
Sbjct: 398  VLSLDKNKKTKNSNGNLKNYLTEDVRETLTIGNLCNNASFSQEHAIFLGNPTDVALL--- 454

Query: 876  NWSYAEDFQDFKFHSLNEERNNKSTLPENAG---IAPAVVHPNAESTENKFTENDPHNLL 932
                 E   +F+   +         LP N+    +A  +++P     +NK T       +
Sbjct: 455  -----EQLANFEMPDIRNTVQKVQELPFNSKRKLMATKILNP----VDNKCT-------V 498

Query: 933  GVIRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPEVISEICNKSTLPANYEQILQQYTH 992
             V  +FE +  L   +  +K  G+      T+     I+E  N                 
Sbjct: 499  YVKGAFERI--LEYSTSYLKSKGKKT-EKLTEAQKATINECAN-------------SMAS 542

Query: 993  NGYRVIACAGKTLPKRTWRFAQKVSREEVESNMEFLGFVVFENKLKPSTTPTLASLQDAG 1052
             G RV   A  TL   +         E++  ++ F G +   +  +P+    +  L   G
Sbjct: 543  EGLRVFGFAKLTLSDSSTPLT-----EDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGG 597

Query: 1053 IRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLILDGV 1112
            +  IM TGD+  TA+++ ++ G        +P I+  +                 +L G 
Sbjct: 598  VHIIMITGDSENTAVNIAKQIG--------IPVIDPKLS----------------VLSGD 633

Query: 1113 TLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQL 1172
             L+ M   SD  +A   D               ++N       I+AR +P+ K  +V  L
Sbjct: 634  KLDEM---SDDQLANVID---------------HVN-------IFARATPEHKLNIVRAL 668

Query: 1173 QGLDYVVGFCGDGANDCGALKAADVGXXXXXXXXXXXXPFTSSVF---EISCILDVIKEG 1229
            +    VV   GDG ND  ALK +D+G              +  V    + S IL  I+EG
Sbjct: 669  RKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFSTILTAIEEG 728

Query: 1230 RASLTT--SFSCFQYMSLYSAIQFVTVTMLYSRGINLGDFQFLYIDLFLIVPIAIFMSWS 1287
            +       +F  FQ  +  +A+  V ++  +     L   Q L+I++ +  P A  +   
Sbjct: 729  KGIFNNIQNFLTFQLSTSVAALSLVALSTAFKLPNPLNAMQILWINILMDGPPAQSLGVE 788

Query: 1288 KPYHKLVKKRP---SANLVSPKILAPLVANIAIILVFQATPWLVVQAMRWYQAPVVGGDD 1344
               H+++KK P   +  +++  ++  L+   A I+V   T ++ V+ M          D 
Sbjct: 789  PVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIV--GTVYIFVKEM--------AEDG 838

Query: 1345 AVQSSDNTVLF----FFSNFQ 1361
             V + D T+ F    FF  F 
Sbjct: 839  KVTARDTTMTFTCFVFFDMFN 859

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
            complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 193/857 (22%), Positives = 331/857 (38%), Gaps = 173/857 (20%)

Query: 542  TKKTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVPGDV--YEISDPSLSTFPCD-SLLL 598
            ++K+ + L ++  + C +   R G    V +S LVPGD+  +++ D      P D  ++ 
Sbjct: 144  SEKSLEALHKLVPASCHL--IRFGAETHVLASCLVPGDLVYFKVGD----RIPADVRIIE 197

Query: 599  SGDCIVNESMLTGESVPVSK--IPASDETIYQLLEDFQKTQISNFLAKSFLFNGTKIIRV 656
            S D  ++ES LTGE+ PV K   P +  T      D     I      S  + GT +   
Sbjct: 198  STDLSLDESTLTGETEPVHKSCTPVNSAT----YSDVPGGIIPIGERTSIAYMGTLV--- 250

Query: 657  RIGGEQSTALAMVVRTGFSTTKGSLLRSM--IFPKPSGFKFYEDSFK----YIGFMTLIA 710
                 +     +VV TG  T  G++   M  I    +  +   D+ +    Y+ F+    
Sbjct: 251  ----REGHGKGIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLSYVRFV---- 302

Query: 711  LAGFSISCINFIRLGLAYKVMILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFCI 770
            L+G  I  +  I+ G ++  M   ++ +    +P  LP  +++  +  + R+  +     
Sbjct: 303  LSGI-IFLLGVIQ-GRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVR 360

Query: 771  APTRVNVSGKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITNVRGLFNKYS 830
                V   G ++V+C DKTGTLT + +    +       ++N        +  GL  K  
Sbjct: 361  RLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSLEAKSSGGLPGKLP 420

Query: 831  -----LNDCGSPIDFKSRNFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNWSYAEDFQD 885
                 L+D     D K+   + S+    S     G+ LG+P D  +         E  Q 
Sbjct: 421  NLKNYLSD-----DVKATLRIGSICNNASFSHEHGKYLGNPTDIALL--------EVLQK 467

Query: 886  FKFHSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLLGVIRSFEFVSELR 945
            F    L +ER   + + E                                    F S+ +
Sbjct: 468  F---DLVDERPTTTRVDE----------------------------------LTFNSKRK 490

Query: 946  RMSVIV-KPYGENVFWGFTKGAPEVISEICNKSTLPANYEQILQQYTHNGYRVIACAGKT 1004
             M+V V  P        + KGA E I E   +S         +++ + +   +I    K+
Sbjct: 491  YMAVKVDSPANSGKHIIYVKGAFERILE---RSASFIGGAGKVEKLSDSHKSLINDCAKS 547

Query: 1005 LPK---RTWRFAQ------KVSREEVESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRS 1055
            L     RT  FAQ      K   +    N+ F+G +  ++  + +  P +  L   G+  
Sbjct: 548  LASEGLRTLAFAQLECSTNKPMNDSTIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHV 607

Query: 1056 IMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLILDGVTLE 1115
            IM TGD   TA+++ R+ G        +P IN  +                 +L G  L+
Sbjct: 608  IMITGDAENTAVNIARQIG--------IPVINPEIS----------------VLTGDRLD 643

Query: 1116 PMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQGL 1175
             M   +D  +A   D               ++N       I+AR +P+ K  +V  LQ  
Sbjct: 644  QM---TDDQLAGVID---------------HVN-------IFARATPEHKLNIVRALQKR 678

Query: 1176 DYVVGFCGDGANDCGALKAADVGXXXXXXXXXXXXPFTSSVF---EISCILDVIKEGRAS 1232
              +V   GDG ND  ALK AD+G              +  V    + S IL  I+EG+  
Sbjct: 679  GDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLTDDDFSTILTAIEEGKGI 738

Query: 1233 LTT--SFSCFQYMSLYSAIQFVTVTMLYSRGINLGDFQFLYIDLFLIVPIAIFMSWSKPY 1290
                 SF  FQ  +  +A+  V +   +     L   Q L+I++ +  P A  +      
Sbjct: 739  FNNIQSFLTFQLSTSVAALSLVAIATAFKLQNPLNAMQILWINILMDGPPAQSLGVEPVD 798

Query: 1291 HKLVKKRP---SANLVSPKILAPLVANIAIILVFQATPWLVVQAMRWYQAPVVGGDDAVQ 1347
            H++++K P   S  +++P+++  L+ N A I+    T ++ ++ M          D  V 
Sbjct: 799  HEVMRKPPRKRSDKILTPQVMRRLLINAAFII--GGTIYVFIKEMTE--------DGQVT 848

Query: 1348 SSDNTVLF----FFSNF 1360
            + D T+ F    FF  F
Sbjct: 849  ARDTTMTFTCFVFFDMF 865

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
            Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 951

 Score =  106 bits (265), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 212/941 (22%), Positives = 369/941 (39%), Gaps = 158/941 (16%)

Query: 444  EDLFKINSNWTDADWLSLSSIQKGLPTSVVEDRMLAFGRNNINLKQKTSLEILF------ 497
            E L K++   TDA  L LSS+++         R   +G N I++    SL   F      
Sbjct: 53   ETLHKLD---TDAK-LGLSSVEEA------TKRRQYYGPNEISVDDDESLVKKFLSNFVE 102

Query: 498  DEVLHPFYVFQIFSILLWLADNYYYYAACIFIISMLSIIDTLVETKKTSQRLAEVSHSHC 557
            D ++       I S+ L   D+       I I+  +  +     ++K+ + L ++    C
Sbjct: 103  DRLILLLMGSAIISVFLGNIDDAISITMAIVIVVTVGFVQEY-RSEKSLEALNKLVPQEC 161

Query: 558  EVRVYRDGFWVQVSSSELVPGDV--YEISDPSLSTFPCD-SLLLSGDCIVNESMLTGESV 614
               + R G    V ++ LVPGD+  + I D      P D  ++   D  ++ES LTGE+ 
Sbjct: 162  --HLIRGGRESNVLATNLVPGDLVRFRIGD----RIPADIRIIECNDLTIDESNLTGETD 215

Query: 615  PVSKIPASDETIYQLLEDFQKTQISNFLAKSFLFNGTKIIRVRIGGEQSTALAMVVRTGF 674
            PV K      +   L  D    Q ++ +    +   T I  +    ++     +VV TG 
Sbjct: 216  PVHK------SYKALSRDSYNDQPNSIVP---VAERTNIAYMGTLVKEGNGRGIVVGTGR 266

Query: 675  STTKGSLLRSM--IFPKPSGFKFYEDSFKYIGFMTLIALAGFSISCINFIRLGLAYKVMI 732
             T+ G++   M  I    +  +   D  K    ++L +     I C+  I  G ++  M 
Sbjct: 267  ETSFGNVFEMMSSIEKPKTPLQLTMD--KLGKDLSLASFVVIGIICVVGIIQGRSWLEMF 324

Query: 733  LRALDIITIVVPPALPATLSIGASFAIARL-KKKGIFCIAPTRVNVSGKIDVMCFDKTGT 791
              ++ +    +P  LP  +++  +  + R+ K+K I    P+ V   G ++V+C DKTGT
Sbjct: 325  QISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPS-VETLGSVNVICSDKTGT 383

Query: 792  LTEDGLDVLGVHVAEPQGHQNFRFGALITNVRGLFNKYSLNDCGSPIDFKSRNFLVSLLT 851
            LT + + V  +       ++     +L  N  G    Y L D     D K+     +L  
Sbjct: 384  LTSNHMTVSKIWCLGSMANK-LNVLSLDKNKGGNLKNY-LTD-----DVKTTLLCGNLCN 436

Query: 852  CHSLRVVDGELLGDPLDFKMFQFTNWSYAEDFQDFKFHSLNEERNNKSTLPENAGIAPAV 911
              S      + LG+P D  +         E  Q F+   +  E      L  N+      
Sbjct: 437  NASYSQEHAKYLGNPTDVALL--------EQLQKFELADVRSEYTKVKELSFNS------ 482

Query: 912  VHPNAESTENKFTENDPHNLLGVIRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPEVIS 971
                 +    K  +N+    L +  +FE +  L + S  +   G+      T G  E I 
Sbjct: 483  ---KRKMMATKIQDNEKKTTLFIKGAFERI--LDKSSSYLTEKGK--IEKLTAGHRETII 535

Query: 972  EICNKSTLPANYEQILQQYTHNGYRVIACAGKTLPKRTWRFAQKVSREEVESNMEFLGFV 1031
            +  N  TL +            G RV+A A + +   + +       E+  S++ F G +
Sbjct: 536  DCAN--TLAS-----------EGLRVLAFAKRAMTDSSSKLV-----EDDISDLVFTGLI 577

Query: 1032 VFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMD 1091
               +  + S    +      GI  IM TGD+  TA+++ R+ G        +P I    D
Sbjct: 578  GMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIG--------IPVI----D 625

Query: 1092 PNEDLIIWRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVL 1151
            P   ++                              +GD      K NE+  +   N V+
Sbjct: 626  PKLSVL------------------------------SGD------KLNEMTDDQLAN-VI 648

Query: 1152 LKSSIYARMSPDEKHELVGQLQGLDYVVGFCGDGANDCGALKAADVGXXXXXXXXXXXXP 1211
               +I+AR +P+ K  +V  L+    VV   GDG ND  ALK AD+G             
Sbjct: 649  DHVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKE 708

Query: 1212 FTSSVF---EISCILDVIKEGRASLTT--SFSCFQYMSLYSAIQFVTVTMLYSRGINLGD 1266
             +  +    + S IL  I+EG+       +F  FQ  +  +A+  V ++  +     L  
Sbjct: 709  ASDMILTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNPLNA 768

Query: 1267 FQFLYIDLFLIVPIAIFMSWSKPYHKLVKKRP---SANLVSPKILAPLVANIAIILVFQA 1323
             Q L+I++ +  P A  +      H+++KK P   +  +++ ++L  L+   + I++   
Sbjct: 769  MQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTAELLKRLIGTASCIIL--G 826

Query: 1324 TPWLVVQAMRWYQAPVVGGDDAVQSSDNTVLF----FFSNF 1360
            T ++ V+ M          D  V + D T+ F    FF  F
Sbjct: 827  TVYVFVKEM--------AEDGQVTARDTTMTFTCFVFFDMF 859

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
            Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 1280

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 186/856 (21%), Positives = 317/856 (37%), Gaps = 200/856 (23%)

Query: 558  EVRVYRDGFWVQVSSSELVPGDVYEISDPSLSTFPCDSLLLSGDCIVNESMLTGESVPVS 617
            +V V R+G    +S  +L+ GDV  IS  +    P D++L+SG C  +ES LTGES  + 
Sbjct: 240  DVVVIRNGDEHLISIHDLLVGDV--ISLQTGDVVPADAVLISGSCECDESALTGESDTIK 297

Query: 618  KI---PASDETIYQLLE-----DFQKTQISNFLAKSFLFNGTKIIRVRIGGEQSTALAMV 669
            K+   PA  E   Q+ E     D     +   +    L +G+K++   IG       A++
Sbjct: 298  KVALKPAL-EKYKQIFEKDPTIDIGSHGVGEKVPDPLLISGSKLLS-GIGN------AVI 349

Query: 670  VRTGFSTTKGSLLRSMIF-----PKPSGFKFYEDSFKYIGFMTLIALAGFSISCINFI-- 722
               G ++  G ++ ++       P         D+    G M   AL  F I  I F+  
Sbjct: 350  TSVGENSVNGRIMMALKTESESTPLQERLSNLADNISIYGCMA--ALVLFIILFIRFLTY 407

Query: 723  -------------RLGLAYKVMILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFC 769
                         + G  +  + + A+ +I + VP  LP  +++  +FA  R+ K G   
Sbjct: 408  LPNGKKYHDLPPAQKGSKFMNIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNLV 467

Query: 770  IAPTRVNVSGKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITNVRGLFNKY 829
                     G    +C DKTGTLTE+ + V                      V+G     
Sbjct: 468  RVLRACETMGSATAICSDKTGTLTENRMTV----------------------VKGFAGNL 505

Query: 830  SLNDCGSPIDFKSRNFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNWSYAE------DF 883
              +D     + + ++ +V    C      D  LL D L       T +   E      D 
Sbjct: 506  GFDDTTHAENKEIKSAVVLRSNC------DASLLTDILSNISLNSTAFENKESQHKDKDV 559

Query: 884  QDFKFHSLNE-----ERNNKST------LPENAGIAPAVVHPNAESTENKFTE-----ND 927
             +  +H   +      RNN+++      + EN       +    E+    F +      D
Sbjct: 560  DENPYHKSRKSLFPWSRNNRTSQLIADAMKEN---DEQFLGSKTETALLAFAQKSLGMKD 616

Query: 928  PHNL------LG---VIRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPEVISEIC---- 974
             H L      LG   V++   F S  +  ++ V+      +  + KGA E++ ++C    
Sbjct: 617  VHKLRTKPSDLGIDKVVQVIPFESSRKWGAIAVQLADNKGYRFYAKGAAEILLKVCSNQR 676

Query: 975  --NKSTLPANYE------QILQQYTHNGYRVIACAGKTLPKRTW---RFAQK-------- 1015
              + S +P N +      + +Q    +  R I+   +    + W    FA          
Sbjct: 677  NSDNSIVPMNQDLYDESFKKIQDMASHALRTISLVHRDF--KEWPPKEFADSTDPSIASP 734

Query: 1016 --VSREEVE------SNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAI 1067
              V   E++        M     V  ++ L+     ++   Q AG+   M TGDN+LTA 
Sbjct: 735  DLVMGHELDHKNLSSEGMTLDAMVGLQDPLREGVKESVEQCQRAGVTVRMVTGDNILTAR 794

Query: 1068 SVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLILDGVTLEPMNGSSDYTIAV 1127
            ++ R   +++E                                        G +D   A+
Sbjct: 795  AISRNCNILSEE---------------------------------------GYNDPECAM 815

Query: 1128 TGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQGLDYVVGFCGDGAN 1187
             G  FR        LP   +  V+ K  + AR SP++K  LV  L+ +  VV   GDG N
Sbjct: 816  EGPTFR-------KLPYKKMLRVIPKLRVLARSSPEDKRILVETLKKMGEVVAVTGDGTN 868

Query: 1188 DCGALKAADVGXXXXXXXXXXXXPFTSSVF---EISCILDVIKEGRASLTTSFSCFQYMS 1244
            D  ALK ADVG              +  +    + + I++ IK GR     S S  +++ 
Sbjct: 869  DAPALKLADVGFSMGISGTEVAREASDIILMTDDFTAIVNAIKWGRC---VSVSIKKFIQ 925

Query: 1245 LYSAIQFVTVTMLYSRGIN-------LGDFQFLYIDLFLIVPIAIFMSWSKPYHKLVKKR 1297
                +    V + +   +        L   Q L+++L +    A+ ++  KP   ++ ++
Sbjct: 926  FQLTVNITAVILTFVSAVASAEETSVLTAVQLLWVNLIMDTLAALALATDKPDEFILDRK 985

Query: 1298 PSANLVSPKILAPLVA 1313
            P          APL+A
Sbjct: 986  PKGR------DAPLIA 995

>Kwal_23.3160
          Length = 1100

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 197/857 (22%), Positives = 337/857 (39%), Gaps = 169/857 (19%)

Query: 462  SSIQKGLPTSVVEDRMLAFGRNNINLKQKTSLE-ILFDEVLHPFYVFQIFSILLWLADNY 520
            + +Q GL ++    R+  +G N++    K   + IL  ++ +   +    S+++ LA   
Sbjct: 37   TDLQAGLRSAEATARVSQYGENSLGDDSKIDFKSILLHQICNAMILVLFISMVITLAIRD 96

Query: 521  YYYAACI-FIISMLSIIDTLVETKKTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVPGD 579
            +     I F++ +   I +  E K +    +  S S     V RDG    + S +LVPGD
Sbjct: 97   WISGGVIAFVVFINVAIGSYQEYKASKTMNSLKSLSTPSAHVIRDGNDETIPSKQLVPGD 156

Query: 580  VYEISDPSLSTFPCDSLLLSGDCI---VNESMLTGESVPVSKIPASDETIYQLLEDFQKT 636
            +  +   +  T P D  L+  +C+    +E++LTGES+P++K  +    +Y   ED   T
Sbjct: 157  LCVVK--AGDTVPADLRLI--ECVNFETDEALLTGESLPIAKEASQ---VYPATED---T 206

Query: 637  QISNFLAKSFLFNGTKIIRVRIGGEQSTALAMVVRTGFSTTKGSLLRSM----------- 685
             + + L  +  F  + + + R  G       +VV+TG +T  G + +S+           
Sbjct: 207  PVGDRL--NLAFASSTVSKGRATG-------IVVKTGLNTEIGKIAQSLKGDNSLISKDE 257

Query: 686  --IFPKPSGFKFYEDSFKYIGFMT---------LIALAGFSISCINFIRLGLAYKVMILR 734
               F   +G         ++G  T          +A+  F I+ +  I +    K ++ +
Sbjct: 258  NKTFWANAGITLAATIGSFLGTTTGTPLHRKLSKLAVLLFFIAVVFAIVVMATQKFVVNK 317

Query: 735  ALDIITIVV-----PPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFDKT 789
             + I  I V     P +L   L+I  S     +  + +       +   G ++ +C DKT
Sbjct: 318  EVAIYAICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKT 377

Query: 790  GTLTEDGLDVLGVHVAEPQGHQNFRFGALITNVRGLFNKYSLNDCG-------SPIDFKS 842
            GTLT+  + V    V          FG +   V    N +   D G       SP  +K 
Sbjct: 378  GTLTQGKMIVKQAWVPS--------FGTI--TVSNSSNPFDPTDGGIELIPRFSPHQYKH 427

Query: 843  RNFL-VSLLTCHSLRVVDGELLGDPLDFKMFQFTNW-------SYAEDFQD-----FKFH 889
             +   V ++T    +  + +L   P       F NW       + A  +QD     +K H
Sbjct: 428  DSTEDVGIITSFKNKFYNDKL---PAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAH 484

Query: 890  SLNEER-----NNKSTLPENAGIAPAVVHPNAESTEN-----KFTENDPHNLLGVIRSFE 939
                E       +K  +P NA  A      ++ES E+     K +  +PH     I  F 
Sbjct: 485  GDPTEIAIQVFAHKLDMPRNALTAED--KSDSESDEDAALGEKTSSVEPH--YKHIAEFP 540

Query: 940  FVSELRRMSVIVKPYGE-NVFWGFTKGAPEVISEICNKSTLP-------------ANYEQ 985
            F S ++RMS +     E N    FTKGA E + + C K  LP              + E+
Sbjct: 541  FDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTK-WLPDGCNESDAKPMTEEDKEE 599

Query: 986  I---LQQYTHNGYRVIACAGKTLPKRTWRFAQKVS------REEVESNMEFLGFVVFENK 1036
            +   ++  +  G RV+A A K+  +     A KVS      R+ VES++ F G V   + 
Sbjct: 600  VFKNVETLSSEGLRVLAFATKSFTESQ---ALKVSEDLRKNRDFVESDLIFQGLVGIYDP 656

Query: 1037 LKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDL 1096
             +  T   +     AGI   M TGD   TA ++ +E G++  +    P            
Sbjct: 657  PRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLYHYP------------ 704

Query: 1097 IIWRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSI 1156
               ++V D                   ++ +T   F       + L +  I+ +LL   +
Sbjct: 705  ---KEVVD-------------------SMVMTAAQF-------DQLTDEEIDNLLLLPLV 735

Query: 1157 YARMSPDEKHELVGQLQGLDYVVGFCGDGANDCGALKAADVGXXXXXXXXXXXXPFTSSV 1216
             AR +P  K  ++  L   +      GDG ND  +LK A+VG              +  V
Sbjct: 736  IARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIV 795

Query: 1217 FE---ISCILDVIKEGR 1230
                  + IL+ ++EGR
Sbjct: 796  LSDDNFASILNAVEEGR 812

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
            (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score =  100 bits (250), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 179/842 (21%), Positives = 341/842 (40%), Gaps = 148/842 (17%)

Query: 462  SSIQKGLPTSVVEDRMLAFGRNNINLKQKTSLE-ILFDEVLHPFYVFQIFSILLWLADNY 520
            + +++GL       R+   G N +  ++  ++  IL  ++ +   +  I S+++ LA   
Sbjct: 35   TDLRRGLTAEEARARLEVVGDNTLGEEEGINVRAILLKQMCNAMILVLIISMVIALAIKD 94

Query: 521  YYYAACI-FIISMLSIIDTLVETK--KTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVP 577
            +     I F++++   I    E    KT   L ++S      RV R+G  V ++S+++VP
Sbjct: 95   WISGGVIAFVVALNVSIGAYQEYNACKTMNSLKDLSTPSA--RVIRNGEDVVMASAQVVP 152

Query: 578  GDVYEISDPSLSTFPCDSLLLSG-DCIVNESMLTGESVPVSKIPASDETIYQLLEDFQKT 636
            GD+ ++      T P D  L+   +   +E++LTGE++PV+K PA+   +++     Q T
Sbjct: 153  GDIVQVRVGD--TVPADLRLVEALNLETDEALLTGEALPVAKDPAA---VFE-----QDT 202

Query: 637  QISNFLAKSFLFNGTKIIRVRIGGEQSTALAMVVRTGFSTTKGSLLRSMIFPK------- 689
             + + L  +  F  + + + R  G       +VVRTG  +  G +  S+   +       
Sbjct: 203  PVGDRL--NLAFASSTVSKGRATG-------IVVRTGLRSEIGKIAESLQGKQSLISRDE 253

Query: 690  -PSGFKFYEDSFK-----YIGF---------MTLIALAGFSISCINFIRLGLAYKVMILR 734
              SG +    + K     ++G          +  +AL  F+I+ +  + +    K ++ R
Sbjct: 254  NKSGLQNTVLTVKASVGSFLGTNVGTPLHRKLAKLALILFAIAVLFALIVMATQKFIVNR 313

Query: 735  ALDIITIVV-----PPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFDKT 789
             + I  I V     P +L   L+I  S     +  + +       +   G ++ +C DKT
Sbjct: 314  EVAIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKT 373

Query: 790  GTLTEDGLDVLGVHVAEPQGHQNFRFGALITNVRGLFNKYSLNDCG-----SPIDFK-SR 843
            GTLT+  + +  + V E        FG ++ N   +    ++ D       SP +++   
Sbjct: 374  GTLTQGKMILKQLWVPE--------FGTVVVNRSNVPFDPTVGDVSLIPRFSPWEYQHDE 425

Query: 844  NFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNWSYAEDFQD----FKFHSLNEERNNKS 899
               V ++     R     L   P      +F +W +     +    FK     E R +  
Sbjct: 426  EEDVGIIANFKQRWQSNSL---PKGLNPRKFESWLHTATLANIATVFKDSDSKEWRAHGD 482

Query: 900  TLPENAGI---APAVVHP-NAESTE------NKFTENDPHNLLGVIRSFEFVSELRRMSV 949
              P    I   A  + HP +A +TE      +   +ND   +      F F S ++RMS 
Sbjct: 483  --PTEIAIQVFATRMDHPHHALTTEQDEEDSDSSQQNDAARIYEHAAEFPFDSSIKRMSA 540

Query: 950  I-VKPYGENVFWGFTKGAPEVISEICNKSTL--------PANYE--QILQQ----YTHNG 994
            + +    +N    FTKGA E + + C +  L        P   +  +I+Q+     ++ G
Sbjct: 541  VYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNEG 600

Query: 995  YRVIACAGKTLP-KRTWRFAQKVSREE--VESNMEFLGFVVFENKLKPSTTPTLASLQDA 1051
             RV+A A KT+P +      ++++++   VES++ F G V   +  +  T   +     A
Sbjct: 601  LRVLAFATKTIPAEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRA 660

Query: 1052 GIRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLILDG 1111
            GI   M TGD   TA ++ +E G++  +    P+         +++              
Sbjct: 661  GINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPK---------EVV-------------- 697

Query: 1112 VTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQ 1171
                              D+  +     + L +  ++ + +   + AR +P  K  ++  
Sbjct: 698  ------------------DIMVMTATQFDSLTDEELDQLPVLPLVIARCAPQTKVRMIDA 739

Query: 1172 LQGLDYVVGFCGDGANDCGALKAADVGXXXXXXXXXXXXPFTSSVFE---ISCILDVIKE 1228
            L   +      GDG ND  +LK A+VG              +  V      + IL+ ++E
Sbjct: 740  LHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEE 799

Query: 1229 GR 1230
            GR
Sbjct: 800  GR 801

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
            involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 186/845 (22%), Positives = 320/845 (37%), Gaps = 158/845 (18%)

Query: 462  SSIQKGLPTSVVEDRMLAFGRNNINLKQKTSLE-ILFDEVLHPFYVFQIFSILLWLADNY 520
            + I +GL T+ + +R+   G N +    K +++ I   ++ +   +  I S+++  A   
Sbjct: 33   THINQGLNTTQIAERLGLIGENTLGDDSKINIKGIFISQICNAMIMVLIISMVISFAIKD 92

Query: 521  YYYAACIFIISMLSIIDTLVETKKTSQRLAEV-SHSHCEVRVYRDGFWVQVSSSELVPGD 579
            +     I  +  ++++    +    S+ +  + S S     V R G  + + S ELVPGD
Sbjct: 93   WISGGVIAFVVFINVVIGAYQEYNASKTMNSLKSLSTPSAHVIRAGNDLTIESKELVPGD 152

Query: 580  VYEISDPSLSTFPCDSLLLSG-DCIVNESMLTGESVPVSKIPASDETIYQLLEDFQKTQI 638
            +  I      T P D  L    +   +E++LTGES+PV+K   S   +Y+     Q T +
Sbjct: 153  ICIIR--VGDTVPADLRLFEAINLETDEALLTGESLPVAK---SHGEVYE-----QDTPV 202

Query: 639  SNFLAKSFLFNGTKIIRVRIGGEQSTALAMVVRTGFSTTKGSLLRSMIFPKPSGFKFYED 698
             + L  +  F  + + + R       A  +V++T  +T  G + +S+   K        D
Sbjct: 203  GDRL--NLAFAASTVTKGR-------ATGIVIKTALNTEIGKIAKSL---KSEASLISRD 250

Query: 699  SFKYIGFMTLIALA-------GFSISCINFIRLG-LAY---------------------- 728
              K  G    I L        G S+      +L  LA                       
Sbjct: 251  KSKSFGRNLWITLRESIGTFLGTSVGTPLHRKLSQLAILLFVVAVIFAIVVMGTQKFKVN 310

Query: 729  KVMILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFDK 788
            K + + A+ +   ++P +L   L+I  S     +  + +       +   G ++ +C DK
Sbjct: 311  KQVAIYAICVALSMIPSSLVVVLTITMSAGAKVMATRHVIIRKLDSLEALGAVNDICSDK 370

Query: 789  TGTLTEDGLDVLGVHVAEPQ------GHQNFRFGALITNVRGL--FNKYSLN-----DCG 835
            TGTLT+  +  +   V  PQ       + N  F   I  ++ +  F+ Y        D G
Sbjct: 371  TGTLTQGKM--IAKQVWIPQFGTINVQNSNEPFNPTIGEIQLIPKFSPYQYKHDDEEDVG 428

Query: 836  SPIDFKSRNFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNWSYAEDFQDFKFHSLNEER 895
               DFKS+ +               + LG PL+  +F  T W Y     +      + E 
Sbjct: 429  MITDFKSKYY--------------ADELG-PLNVSLF--TQWLYTATLANIATVFRDPET 471

Query: 896  NNKSTLPENAGIAPAVVHPNAE------STENKFTENDPHNLLGV--IRSFEFVSELRRM 947
             +     +   IA  V     +      + E+   E + HN +    +  + F S ++RM
Sbjct: 472  QDWKAHGDPTEIAIQVFATRMDLPRRVLTGEDNDDEKNIHNDITFEHVAEYPFDSSVKRM 531

Query: 948  SVIVKPYGEN---VFWGFTKGAPEVISEICNK-STLPANYEQILQQ------------YT 991
            S I K   E    ++  FTKGA E + + CN   T P    Q L +             +
Sbjct: 532  SAIYKNVEEPKAPIYEVFTKGAFERVLQCCNSWYTTPDGSPQPLTEEDLETVQKNVDTLS 591

Query: 992  HNGYRVIACAGKTLPKRTWRFAQKV---SREEVESNMEFLGFVVFENKLKPSTTPTLASL 1048
              G RV+A A KT  +  +   +      R+ VE+N+ FLG V   +  +  +   +   
Sbjct: 592  SEGLRVLAFAKKTFNESQFTINKDKLLKERDFVENNLTFLGLVGIYDPPRRESLAAVKKC 651

Query: 1049 QDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLI 1108
              AGI   M TGD   TA S+ +E G++  +    P+                       
Sbjct: 652  HLAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPK----------------------- 688

Query: 1109 LDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHEL 1168
                  E +N    + +    D   L  K  + LP        +   + AR +P  K  +
Sbjct: 689  ------EVVN----FMVMTATDFDALSDKEIDELP--------VLPLVIARCAPQTKVRM 730

Query: 1169 VGQLQGLDYVVGFCGDGANDCGALKAADVGXXXXXXXXXXXXPFTSSVF---EISCILDV 1225
            +  L   +      GDG ND  +LK A+VG              +  V      + IL+ 
Sbjct: 731  IEALHRRNRFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNA 790

Query: 1226 IKEGR 1230
            ++EGR
Sbjct: 791  VEEGR 795

>Scas_707.48*
          Length = 741

 Score = 99.0 bits (245), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 172/776 (22%), Positives = 306/776 (39%), Gaps = 139/776 (17%)

Query: 476  RMLAFGRNNINLKQKTSLEILF------DEVLHPFYVFQIFSILLWLADNYYYYAACIFI 529
            R L +G N I +++  SL   F      D ++       + S ++   D+       I I
Sbjct: 67   RKLVYGANEIVIEEDESLWKKFLSSFVEDRLILLLIGSAVVSFIMGNIDDAVSITLAIVI 126

Query: 530  ISMLSIIDTLVETKKTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVPGDV--YEISDPS 587
            +  +  +     ++K+ + L ++  + C   + R G    V +S LVPGD+  ++I D  
Sbjct: 127  VVSVGFVQEY-RSEKSLEALNKLVPAEC--HLIRCGQESHVLASGLVPGDLVHFKIGD-- 181

Query: 588  LSTFPCDSLLLSG-DCIVNESMLTGESVPVSKIPASDETIYQLLEDFQKTQISNFLAKSF 646
                P D  ++   D  ++ES LTGE+ PV K  ++ E       D   + I        
Sbjct: 182  --RIPADLRIIEAVDLSIDESNLTGENEPVHK--SAKEVNKDSFNDQPNSIIPISDRTCV 237

Query: 647  LFNGTKIIRVRIGGEQSTALAMVVRTGFSTTKGS---LLRSMIFPKPSGFKFYEDSFKYI 703
             + GT +       ++     +VV  G +T+ G+   +L ++  PK       +++   +
Sbjct: 238  AYMGTLV-------KEGHGKGIVVGIGKNTSFGAIFEMLSNIEKPKTP----LQNAMDKL 286

Query: 704  GF-MTLIALAGFSISCINFIRLGLAYKVMILRALDIITIVVPPALPATLSIGASFAIARL 762
            G  ++L +     + C+  I  G ++  M   ++ +    +P  LP  +++  +  + R+
Sbjct: 287  GKDLSLFSFIVIGLICLVGILQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRM 346

Query: 763  -KKKGIFCIAPTRVNVSGKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITN 821
             K+K I    P+ V   G ++V+C DKTGTLT + +    +   +   ++     +L  +
Sbjct: 347  AKRKAIVRRLPS-VETLGSVNVICSDKTGTLTSNHMTASKIWCLDSMANKANVL-SLEKS 404

Query: 822  VRGLFNKYSLNDCGSPIDFKSRNFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNWSYAE 881
              G    Y   D       KS   + ++    S     G+ LG+P D  +         E
Sbjct: 405  KSGSLKNYLTED------VKSTLTIGNICNNASFSQEHGKYLGNPTDIALL--------E 450

Query: 882  DFQDFKFHSLNEERNNKSTLPENAG---IAPAVVHPNAESTENKFTENDPHNLLGVIRSF 938
                F    +         +P N+    +A  +V+     +E K++       L V  +F
Sbjct: 451  QLSKFDLSDIRPTFKKVQEIPFNSKRKFMAVKIVN-----SEGKYS-------LCVKGAF 498

Query: 939  EFVSELRRMSVIVKPYGENVFWGFTKGAPEVISEICNKSTLPANYEQILQQYTHNGYRVI 998
            E V  L + S  +   G+      T+G  +VI E  N                  G R++
Sbjct: 499  EKV--LSQCSHYLNQKGKT--EKLTQGQRDVIIETAN-------------SLASEGLRML 541

Query: 999  ACAGKTLPKRTWRFAQKVSREEVESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMC 1058
            A A  TLP            EE   ++ F G +   +  +P+  P +  L   G+  IM 
Sbjct: 542  AFAKTTLPDSPTLLT-----EESVGDLIFTGLIGMNDPPRPTVKPAIEQLLQGGVHIIMI 596

Query: 1059 TGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLILDGVTLEPMN 1118
            TGD+  TA+++ R+ G+     V  P+++                    +L G   + +N
Sbjct: 597  TGDSENTAVNIARQIGI----PVLDPKLS--------------------VLSG---DKLN 629

Query: 1119 GSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQGLDYV 1178
              SD  +A   D               ++N       I+AR +P+ K  +V  L+    V
Sbjct: 630  EMSDDQLANVID---------------HVN-------IFARATPEHKLNIVRALRKRGDV 667

Query: 1179 VGFCGDGANDCGALKAADVGXXXXXXXXXXXXPFTSSVF---EISCILDVIKEGRA 1231
            V   GDG ND  ALK AD+G              +  V    + S IL  I+EG+ 
Sbjct: 668  VAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMVLTDDDFSTILTAIEEGKG 723

>Kwal_23.5789
          Length = 1133

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 181/808 (22%), Positives = 327/808 (40%), Gaps = 190/808 (23%)

Query: 570  VSSSELVP------GDVYEISDPSLSTFPCDSLLL-----SGDCIVNESMLTGES----- 613
            +S S+LVP      GD+ +I   + +  P D +LL     SG+  +    L GE+     
Sbjct: 245  LSKSQLVPSKDLKVGDLIKIGKGARA--PADLVLLQSSEPSGEIFIKTDQLDGETDWKLR 302

Query: 614  --VPVSKIPASDETIYQL--LEDFQKTQISNFLAK-SFLFNGTKIIRV-------RIGGE 661
               P+++  + D+ +Y++       +  I+NFL K +F    ++ + V        +   
Sbjct: 303  IACPLTQHLSQDDLLYRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFAS 362

Query: 662  QSTALAMVVRTGFSTTKGSLLRSMIFPKPSGFKFYEDSFK-------YIGFMTLIALAGF 714
              TA+A VV TG + T+ ++  SM   K    +   +S         +I  + L+A AGF
Sbjct: 363  AGTAIACVVYTG-ADTRQAMNTSMSSVKTGLLELEINSLSKILCACVFILSVALVAFAGF 421

Query: 715  SISCINFIRLGLAYKVMILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTR 774
            + +          + V I+R L + + ++P +L   L +G S    +++      I  T 
Sbjct: 422  NNN---------DWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDS--TIPETI 470

Query: 775  VNVS------GKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGAL--ITN-VRGL 825
            V  S      G+I+ +  DKTGTLT++ +++  +H+    G  ++    +  +T+ VR +
Sbjct: 471  VRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHL----GTVSYTMDTMDIVTDYVRAM 526

Query: 826  FNKYSLNDCGSPIDFKS------RNFLVSLLTCHSLRVV--DGELL---GDPLDFKMFQF 874
             +  +LN    P   K       R+ +++L  CH +     DGEL      P +  + +F
Sbjct: 527  SD--NLNSSAVPSASKKDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDEIAIVKF 584

Query: 875  TNWSYAEDFQDFKFHSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLLGV 934
            T        +         +R++ + L + +G                   N  +++L V
Sbjct: 585  T--------ESVGLTLFRRDRHSITLLHDQSGT------------------NFEYDILHV 618

Query: 935  IRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPEVISEICNKSTLPANYEQILQQYTHNG 994
               F F S+ +RM +++    ++ +W   KGA  V+S+I  K+      E+        G
Sbjct: 619  ---FPFNSDNKRMGIVIFDKQKDEYWFLQKGADVVMSKIVQKNDW---LEEETGNLAREG 672

Query: 995  YRVIACAGKTLPKRTWRFAQK---------VSRE---------EVESNMEFLGFVVFENK 1036
             R +    K L K+  +   K         ++RE          +E ++E LG    E+K
Sbjct: 673  LRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDK 732

Query: 1037 LKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDL 1096
            L+     ++  L++AGI+  M TGD V TA  V   + L++    +V  +     P   L
Sbjct: 733  LQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQ-YVHTVTKVNKPEGAL 791

Query: 1097 IIWRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVL-LKSS 1155
                             LE +  +++  + + G+   L     E   + +  +V+ L + 
Sbjct: 792  ---------------THLELLKINTNSCLLIDGESLGLYL---EYYRQQFFEIVVNLPAV 833

Query: 1156 IYARMSPDEKHELVGQLQGLDYVVGFC-GDGANDCGALKAADVGXXXXXXXXXXXXPFTS 1214
            I  R +P +K ++   ++ +      C GDG ND   +++ADVG                
Sbjct: 834  IACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGI------------- 880

Query: 1215 SVFEISCILDVIKEGR-ASLTTSFSCFQYMSLYSAI---------------QFVTVTMLY 1258
                      V KEG+ ASL   FS  Q+  L   +               QFV      
Sbjct: 881  ----------VGKEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRSAKLAQFVI----- 925

Query: 1259 SRGINLGDFQFLYIDLFLIVPIAIFMSW 1286
             RG+ +   Q +Y       PIA++  W
Sbjct: 926  HRGLLISVCQAVYSISSKFEPIALYQGW 953

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-like
            ATPases family in the superfamily of P-type ATPases,
            overproduction confers neomycin resistance [3456 bp, 1151
            aa]
          Length = 1151

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 143/635 (22%), Positives = 251/635 (39%), Gaps = 147/635 (23%)

Query: 708  LIALAGFSISCINFIRLGLAYKVMILRALDIITIVVPPALPATLSIGASFAIARLKKKGI 767
            L+A AGF             + + ILR L + + ++P +L   L +  S    +++    
Sbjct: 429  LVAFAGFH---------NDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDK- 478

Query: 768  FCIAPTRVNVS------GKIDVMCFDKTGTLTEDGLDVLGVHV------AEPQGHQNFRF 815
              I  T V  S      G+I+ +  DKTGTLT++ + +  +H+      +E     +   
Sbjct: 479  -TIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYV 537

Query: 816  GALITNVRGLFN--KYSLNDCGSPIDFKSRNFLVSLLTCHSLRVV--DGELL---GDPLD 868
             +L+++     N  K +L+     + F+ R+ +++L  CH++     D EL      P +
Sbjct: 538  QSLVSSKNDSLNNSKVALSTTRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQAASPDE 597

Query: 869  FKMFQFTNWSYAEDFQDFKFHSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTENDP 928
              + +FT        +         +R++ S L E++G            T N       
Sbjct: 598  IAIVKFT--------ESVGLSLFKRDRHSISLLHEHSG-----------KTLN------- 631

Query: 929  HNLLGVIRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPEVISEICNKSTLPANYEQILQ 988
                 +++ F F S+ +RM +IV+    + +W   KGA  V+S+I   +      E+   
Sbjct: 632  ---YEILQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGADTVMSKIVESNDW---LEEETG 685

Query: 989  QYTHNGYRVIACAGKTLPKRTWRFAQK---------VSREE---------VESNMEFLGF 1030
                 G R +    K L K+ +   QK         ++R++         +E ++E LG 
Sbjct: 686  NMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGL 745

Query: 1031 VVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNM 1090
               E+KL+     ++  L++AGI+  M TGD V TA  V   + LI+    +V  I    
Sbjct: 746  TGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQ-YVHTITKVT 804

Query: 1091 DPNEDLIIWRDVDDCDLILDGV--TLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYIN 1148
             P                 +G    LE +  + +  + + G+   +  K+ E   E +  
Sbjct: 805  RP-----------------EGAFNQLEYLKINRNACLLIDGESLGMFLKHYE--QEFFDV 845

Query: 1149 MVLLKSSIYARMSPDEKHELVGQLQGLDYVVGFC-GDGANDCGALKAADVGXXXXXXXXX 1207
            +V L + I  R +P +K ++   ++ +      C GDG ND   ++ ADVG         
Sbjct: 846  VVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGI------ 899

Query: 1208 XXXPFTSSVFEISCILDVIKEGR-ASLTTSFSCFQYMSLYSAI---------------QF 1251
                             V KEG+ ASL   FS  Q+  L   +               QF
Sbjct: 900  -----------------VGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQF 942

Query: 1252 VTVTMLYSRGINLGDFQFLYIDLFLIVPIAIFMSW 1286
            V       RG+ +   Q +Y    L  PIA++  W
Sbjct: 943  VM-----HRGLIIAICQAVYSICSLFEPIALYQGW 972

>CAGL0K12034g complement(1161299..1164562) highly similar to sp|P13587
            Saccharomyces cerevisiae YDR040c ENA1 or sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 or sp|Q12691
            Saccharomyces cerevisiae YDR038c ENA5, hypothetical start
          Length = 1087

 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 181/852 (21%), Positives = 333/852 (39%), Gaps = 168/852 (19%)

Query: 466  KGLPTSVVEDRMLAFGRNNINLKQKTSLE-ILFDEVLHPFYVFQIFSILLWLADNYYYYA 524
            KG+     + R+   G N++    K   + +L  ++ +   +  I S+++  A   +   
Sbjct: 31   KGISPEEFQARLAQCGENSLGDDAKIDYKAMLIHQICNAMILVLIISMIISFAIRDWITG 90

Query: 525  ACI-FIISMLSIIDTLVETKKTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVPGD--VY 581
              I F+I +  II  + E K +    A  + S     V R+G    V S+++VPGD  V 
Sbjct: 91   GVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHVIRNGNSEVVDSTDVVPGDLVVV 150

Query: 582  EISDPSLSTFPCDSLLLSGDCI-VNESMLTGESVPVSKIPASDETIYQLLEDFQKTQISN 640
            ++ D    T P D  L+S      +E++LTGES+PVSK         ++ +D  +T + +
Sbjct: 151  KVGD----TIPADLRLVSQQNFETDEALLTGESLPVSK------DANEIFDD--ETPVGD 198

Query: 641  FLAKSFLFNGTKIIRVRIGGEQSTALAMVVRTGFSTTKGSLLRSM-----IFPKPSGFKF 695
             +  +  F+ + +++ R  G       + ++TG +T  G + +S+     +  +     +
Sbjct: 199  RI--NLAFSSSTVVKGRAQG-------IAIKTGLNTEIGKIAKSLRGGNELISRDPAKTW 249

Query: 696  YEDSF--------KYIGF---------MTLIALAGFSISCINFIRLGLAYKVMILRALDI 738
            Y++++         ++G          ++ +A+  F I+ +  I +  + K  + R + I
Sbjct: 250  YQNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAI 309

Query: 739  ITIVV-----PPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFDKTGTLT 793
              + V     P +L   L+I  S   A +  + +       +   G ++ +C DKTGTLT
Sbjct: 310  YAVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLT 369

Query: 794  EDGLDVLGVHVAEPQGHQNFRFGALITNVRGLFN--------KYSLN---DCGSPIDFKS 842
            +  +    + V +    Q       +   +G  N        +YS N   D G   +FK 
Sbjct: 370  QGKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSHNETEDVGIMQNFKD 429

Query: 843  R------------NFLVSLLTCHSLRVV----------DGELLGDPLDFKMFQFTNWSYA 880
            +                  L   SL  +          + +  GDP +  +  F      
Sbjct: 430  KYEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAHGDPTEIAIQVFAT---- 485

Query: 881  EDFQDFKFHSLNEERNNKSTLPENAGIAP-AVVHPNAESTENKFTENDPHNLLGVIRSFE 939
                D   H L  ER++   + E+  ++  ++   +A +   KF              F 
Sbjct: 486  --RMDLPRHVLTGERDD---MDEDEIMSSVSLSEKDATAANAKFRH---------AAEFP 531

Query: 940  FVSELRRMSVIVKPYGENVFWGFTKGAPEVISEIC--------NKSTL--PANYEQI--- 986
            F S ++RMS + +      +  +TKGA E +   C        N +T+   A+ + I   
Sbjct: 532  FDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNTATVMTDADVDTIKEN 591

Query: 987  LQQYTHNGYRVIACAGKTLPKR--TWRFAQKV--SREEVESNMEFLGFVVFENKLKPSTT 1042
            +   +  G RV+A A K+ PK        QK+   R+  E+ + FLG +   +  +  T 
Sbjct: 592  IDSMSSEGLRVLAFANKSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREETA 651

Query: 1043 PTLASLQDAGIRSIMCTGDNVLTAISVGRESGLI-TESHVFVPQINDNMDPNEDLIIWRD 1101
              +     AGI   M TGD   TA ++ +E G++ T  + +  ++ D M           
Sbjct: 652  GAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVDIM----------- 700

Query: 1102 VDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMS 1161
                                     +TG  F       + L E  I+ + +   + AR S
Sbjct: 701  ------------------------VMTGKQF-------DNLSEDEIDNLPVLPLVIARCS 729

Query: 1162 PDEKHELVGQLQGLDYVVGFCGDGANDCGALKAADVGXXXXXXXXXXXXPFTSSVF---E 1218
            P  K  ++  L   +      GDG ND  +LK A+VG              +  V     
Sbjct: 730  PQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLSDDN 789

Query: 1219 ISCILDVIKEGR 1230
             + IL+ ++EGR
Sbjct: 790  FASILNAVEEGR 801

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 188/858 (21%), Positives = 332/858 (38%), Gaps = 171/858 (19%)

Query: 462  SSIQKGLPTSVVEDRMLAFGRNNINLKQKTSLE-ILFDEVLHPFYVFQIFSILLWLADNY 520
            +S+ +GL       R+ A G N +    K   + ++  +V +   +  + S+ +  A   
Sbjct: 31   TSLTEGLTQDESLRRLKAVGENTLGDDTKIDYKAMVLHQVCNAMIMVLVISMAISFAVRD 90

Query: 521  YYYAACIFIISMLSIIDTLVETKKTSQRLAEVSH-SHCEVRVYRDGFWVQVSSSELVPGD 579
            +     I  +  ++++  LV+  K ++ +  + + S     V R+G    ++S ++VPGD
Sbjct: 91   WITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGD 150

Query: 580  V--YEISDPSLSTFPCD-SLLLSGDCIVNESMLTGESVPVSKIPASDETIYQLLEDFQKT 636
            +   ++ D    T P D  L+ + +   +ES+LTGES+PVSK    D  +  +    ++T
Sbjct: 151  ICLVKVGD----TIPADLRLIETKNFDTDESLLTGESLPVSK----DANL--VFGKEEET 200

Query: 637  QISNFLAKSFLFNGTKIIRVRIGGEQSTALAMVVRTGFSTTKGSLLRSM------IFPKP 690
             + + L  +  F+ + +++ R  G       +V++T  ++  G + +S+      I   P
Sbjct: 201  SVGDRL--NLAFSSSAVVKGRAKG-------IVIKTALNSEIGKIAKSLQGDSGLISRDP 251

Query: 691  S-----------------------GFKFYEDSFKYIGFMTLIALAGFSISCINFIRLGLA 727
            S                       G   +    K    +  IA+  F+I  +   +  + 
Sbjct: 252  SKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVL-FAIIVMASQKFDVD 310

Query: 728  YKVMILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFD 787
             +V I  A+ +   ++P +L   L+I  S   A +  + +       +   G ++ +C D
Sbjct: 311  KRVAIY-AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSD 369

Query: 788  KTGTLTEDGLDVLGVHVAEPQGHQNFRFGAL-ITNVRGLFN----KYSLNDCGSPIDFK- 841
            KTGTLT+  +  L   +  P      RFG + I+N    FN      SL    SP ++  
Sbjct: 370  KTGTLTQGKM--LARQIWIP------RFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSH 421

Query: 842  SRNFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNW-------SYAEDFQD-----FKFH 889
            + +  V +L     R+ + +L   P D  M  F  W       + A  F+D     +K H
Sbjct: 422  NEDGDVGILQNFKDRLYEKDL---PEDIDMDLFQKWLETATLANIATVFKDDATDCWKAH 478

Query: 890  SLNEERN-----NKSTLPENAGIAPAVVHPNAESTENKFTENDPHNL-----------LG 933
                E        K  LP NA           E + N+  END  +L             
Sbjct: 479  GDPTEIAIQVFATKMDLPHNA--------LTGEKSTNQSNENDQSSLSQHNEKPGSAQFE 530

Query: 934  VIRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPEVISEICNK----------STLPANY 983
             I  F F S ++RMS +        +  + KGA E I   C+                + 
Sbjct: 531  HIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDV 590

Query: 984  EQILQQ---YTHNGYRVIACAGKTLPKRTWRFAQ----KVSREEVESNMEFLGFVVFENK 1036
            E I +     ++ G RV+  A K+  K      Q      +R   ES++ FLG +   + 
Sbjct: 591  ETIRKNVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDP 650

Query: 1037 LKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLI-TESHVFVPQINDNMDPNED 1095
             +  T   +     AGI   M TGD V TA ++ +E G++ T  + +  +I D+M     
Sbjct: 651  PRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSM----- 705

Query: 1096 LIIWRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSS 1155
                                           +TG  F       + L E  ++ + +   
Sbjct: 706  ------------------------------VMTGSQF-------DGLSEEEVDDLPVLPL 728

Query: 1156 IYARMSPDEKHELVGQLQGLDYVVGFCGDGANDCGALKAADVGXXXXXXXXXXXXPFTSS 1215
            + AR SP  K  ++  L          GDG ND  +LK A+VG              +  
Sbjct: 729  VIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDI 788

Query: 1216 VF---EISCILDVIKEGR 1230
            V      + IL+ ++EGR
Sbjct: 789  VLSDDNFASILNAVEEGR 806

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 96.7 bits (239), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 188/858 (21%), Positives = 332/858 (38%), Gaps = 171/858 (19%)

Query: 462  SSIQKGLPTSVVEDRMLAFGRNNINLKQKTSLE-ILFDEVLHPFYVFQIFSILLWLADNY 520
            +S+ +GL       R+ A G N +    K   + ++  +V +   +  + S+ +  A   
Sbjct: 31   TSLTEGLTQDESLRRLKAVGENTLGDDTKIDYKAMVLHQVCNAMIMVLVISMAISFAVRD 90

Query: 521  YYYAACIFIISMLSIIDTLVETKKTSQRLAEVSH-SHCEVRVYRDGFWVQVSSSELVPGD 579
            +     I  +  ++++  LV+  K ++ +  + + S     V R+G    ++S ++VPGD
Sbjct: 91   WITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGD 150

Query: 580  V--YEISDPSLSTFPCD-SLLLSGDCIVNESMLTGESVPVSKIPASDETIYQLLEDFQKT 636
            +   ++ D    T P D  L+ + +   +ES+LTGES+PVSK    D  +  +    ++T
Sbjct: 151  ICLVKVGD----TIPADLRLIETKNFDTDESLLTGESLPVSK----DANL--VFGKEEET 200

Query: 637  QISNFLAKSFLFNGTKIIRVRIGGEQSTALAMVVRTGFSTTKGSLLRSM------IFPKP 690
             + + L  +  F+ + +++ R  G       +V++T  ++  G + +S+      I   P
Sbjct: 201  SVGDRL--NLAFSSSAVVKGRAKG-------IVIKTALNSEIGKIAKSLQGDSGLISRDP 251

Query: 691  S-----------------------GFKFYEDSFKYIGFMTLIALAGFSISCINFIRLGLA 727
            S                       G   +    K    +  IA+  F+I  +   +  + 
Sbjct: 252  SKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVL-FAIIVMASQKFDVD 310

Query: 728  YKVMILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFD 787
             +V I  A+ +   ++P +L   L+I  S   A +  + +       +   G ++ +C D
Sbjct: 311  KRVAIY-AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSD 369

Query: 788  KTGTLTEDGLDVLGVHVAEPQGHQNFRFGAL-ITNVRGLFN----KYSLNDCGSPIDFK- 841
            KTGTLT+  +  L   +  P      RFG + I+N    FN      SL    SP ++  
Sbjct: 370  KTGTLTQGKM--LARQIWIP------RFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSH 421

Query: 842  SRNFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNW-------SYAEDFQD-----FKFH 889
            + +  V +L     R+ + +L   P D  M  F  W       + A  F+D     +K H
Sbjct: 422  NEDGDVGILQNFKDRLYEKDL---PEDIDMDLFQKWLETATLANIATVFKDDATDCWKAH 478

Query: 890  SLNEERN-----NKSTLPENAGIAPAVVHPNAESTENKFTENDPHNL-----------LG 933
                E        K  LP NA           E + N+  END  +L             
Sbjct: 479  GDPTEIAIQVFATKMDLPHNA--------LTGEKSTNQSNENDQSSLSQHNEKPGSAQFE 530

Query: 934  VIRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPEVISEICNK----------STLPANY 983
             I  F F S ++RMS +        +  + KGA E I   C+                + 
Sbjct: 531  HIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDV 590

Query: 984  EQILQQ---YTHNGYRVIACAGKTLPKRTWRFAQ----KVSREEVESNMEFLGFVVFENK 1036
            E I +     ++ G RV+  A K+  K      Q      +R   ES++ FLG +   + 
Sbjct: 591  ETIRKNVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDP 650

Query: 1037 LKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLI-TESHVFVPQINDNMDPNED 1095
             +  T   +     AGI   M TGD V TA ++ +E G++ T  + +  +I D+M     
Sbjct: 651  PRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSM----- 705

Query: 1096 LIIWRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSS 1155
                                           +TG  F       + L E  ++ + +   
Sbjct: 706  ------------------------------VMTGSQF-------DGLSEEEVDDLPVLPL 728

Query: 1156 IYARMSPDEKHELVGQLQGLDYVVGFCGDGANDCGALKAADVGXXXXXXXXXXXXPFTSS 1215
            + AR SP  K  ++  L          GDG ND  +LK A+VG              +  
Sbjct: 729  VIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDI 788

Query: 1216 VF---EISCILDVIKEGR 1230
            V      + IL+ ++EGR
Sbjct: 789  VLSDDNFASILNAVEEGR 806

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
            Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 96.3 bits (238), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 189/858 (22%), Positives = 321/858 (37%), Gaps = 181/858 (21%)

Query: 541  ETKKTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVPGDV--YEISDPSLSTFPCD-SLL 597
            +++K+ + L ++  + C   + R G    V +S LVPGD+  +++ D      P D  ++
Sbjct: 132  KSEKSLEALNKLVPAEC--HLTRSGQLSHVLASNLVPGDLVRFKVGD----RIPADLRIV 185

Query: 598  LSGDCIVNESMLTGESVPVSKIP-ASDETIYQLLEDFQKTQISNFLAKSFLFNGTKIIRV 656
             S D  V+ES LTGE+ PV K   A D   Y        + I         F GT +   
Sbjct: 186  ESIDLCVDESNLTGENEPVHKSSGAVDPKNYS---HIPGSIIPVGDRNCIGFMGTLV--- 239

Query: 657  RIGGEQSTALAMVVRTGFSTTKGSLLRSMIFPKPSGFKFYEDSFKYIGFMTLIALAGFSI 716
                 +     +V+ TG  T  GS+   M     SG    +   +     T +   G  +
Sbjct: 240  ----REGHGKGIVIATGKHTVFGSVFEMM-----SGIDKPKTPLQ-----TAMDKLGQDL 285

Query: 717  SCINFIRL----------GLAYKVMILRALDIITIVVPPALPATLSIGASFAIARLKKKG 766
            S ++F+ +          G ++  M   A+ +    +P  LP  +++  +  + R+ K+ 
Sbjct: 286  SYMSFVLIGIICLIGIIQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRK 345

Query: 767  IFCIAPTRVNVSGKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITNVRGLF 826
                    V   G ++V+C DKTGTLT + +                     ++ +  L 
Sbjct: 346  AIVRRLPSVETLGSVNVICSDKTGTLTANHM--------------------TVSKIWCLG 385

Query: 827  NKYSLNDCGSPIDFKSRNFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNWSYAEDFQDF 886
            +  +  +C +    K R   +      +LR+  G +             N +Y+++   +
Sbjct: 386  SMENKTNCLALSKVKERPIKMEQDVATTLRI--GNIC-----------NNGTYSQEHLKY 432

Query: 887  KFHSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLLGVIRSFEFVSELRR 946
              +            P +  I  ++ H         F  ND  N +  I    F S+ + 
Sbjct: 433  LGN------------PTDIAILESLQH---------FGINDCRNSVNKINEIPFNSKRKF 471

Query: 947  MSVIVKPYGENVFWGFTKGAPEVISEICNKSTLPANYEQILQQYTHNGYRVIACAGKTLP 1006
            M+V      + V   + KGA E I E   KS      +  + +   N   +I  A   L 
Sbjct: 472  MAVKTIDANDKVVV-YVKGAFEKIVE---KSINYIGRDGKVHKLKPNDKAIINDAAVALA 527

Query: 1007 K---RTWRFAQ---------KVSREEVESNMEFLGFVVFENKLKPSTTPTLASLQDAGIR 1054
                RT  FA+         K   E++   + F G +   +  +P+    +  L    + 
Sbjct: 528  SEGLRTLAFAELEVSATHGDKEFNEDMVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVH 587

Query: 1055 SIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLILDGVTL 1114
             IM TGD   TA+S+ R+ G        +P IN                    +L G  L
Sbjct: 588  VIMITGDAENTAVSIARQIG--------IPVINPEYS----------------VLSGDKL 623

Query: 1115 EPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQG 1174
            + M   +D  +A                  S I+ V    +++AR +P+ K  +V  LQ 
Sbjct: 624  DQM---TDDQLA------------------SVIDHV----NVFARATPEHKLNIVRALQK 658

Query: 1175 LDYVVGFCGDGANDCGALKAADVGXXXXXXXXXXXXPFTSSVF---EISCILDVIKEGRA 1231
               +V   GDG ND  ALK AD+G              +  V    + S IL  I+EG+ 
Sbjct: 659  RGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKG 718

Query: 1232 SLTT--SFSCFQYMSLYSAIQFVTVTMLYSRGINLGDFQFLYIDLFLIVPIAIFMSWSKP 1289
                  +F  FQ  +  +A+  V ++        L   Q L+I++ +  P A  +     
Sbjct: 719  IFNNIQNFLTFQLSTSVAALSLVAISTSLKLPNPLNAMQILWINILMDGPPAQSLGVEPV 778

Query: 1290 YHKLVKKRPSANLVSPKILAPLVAN---IAIILVFQATPWLVVQAMRWYQAPVVGGDDAV 1346
             H++++K P     + KIL   V     I+   +   T ++ V+ M          D  V
Sbjct: 779  DHEVMRKPPRKR--TDKILTDAVLKRVLISACFIIVGTIYVFVKEM--------AEDGQV 828

Query: 1347 QSSDNTVLF----FFSNF 1360
             S D T+ F    FF  F
Sbjct: 829  TSRDTTMTFTCFVFFDMF 846

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
            involved in Na+ and Li+ efflux, required for Na+
            tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 184/856 (21%), Positives = 338/856 (39%), Gaps = 167/856 (19%)

Query: 462  SSIQKGLPTSVVEDRMLAFGRNNINLKQKTSLE-ILFDEVLHPFYVFQIFSILLWLADNY 520
            +S+ +GL       R+   G N +    K   + ++  +V +   +  + S+++  A + 
Sbjct: 31   TSLTEGLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCNAMIMVLLISMIISFAMHD 90

Query: 521  YYYAACIFIISMLSIIDTLVETKKTSQRLAEVSH-SHCEVRVYRDGFWVQVSSSELVPGD 579
            +     I  +  ++++  LV+  K ++ +  + + S     V R+G    ++S ++VPGD
Sbjct: 91   WITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGD 150

Query: 580  V--YEISDPSLSTFPCD-SLLLSGDCIVNESMLTGESVPVSKIPASDETIYQLLEDFQKT 636
            +   ++ D    T P D  L+ + +   +ES+LTGES+PVSK    D  +  +    ++T
Sbjct: 151  ICLVKVGD----TIPADLRLIETKNFDTDESLLTGESLPVSK----DANL--VFGKEEET 200

Query: 637  QISNFLAKSFLFNGTKIIRVRIGGEQSTALAMVVRTGFSTTKGSLLRSM-----IFPKPS 691
             + + L  +  F+ + +++ R  G       +V++T  ++  G + +S+     +  +  
Sbjct: 201  SVGDRL--NLAFSSSAVVKGRAKG-------IVIKTALNSEIGKIAKSLQGDSGLISRDP 251

Query: 692  GFKFYEDSF--------KYIGF---------MTLIALAGFSISCINFIRLGLAYKVMILR 734
               + ++++         ++G          ++ +A+  F I+ +  I +  + K  + +
Sbjct: 252  SKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDK 311

Query: 735  ALDIITIVV-----PPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFDKT 789
             + I  I V     P +L   L+I  S   A +  + +       +   G ++ +C DKT
Sbjct: 312  RVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKT 371

Query: 790  GTLTEDGLDVLGVHVAEPQGHQNFRFGAL-ITNVRGLFN----KYSLNDCGSPIDFK-SR 843
            GTLT+  +  L   +  P      RFG + I+N    FN      SL    SP ++  + 
Sbjct: 372  GTLTQGKM--LARQIWIP------RFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNE 423

Query: 844  NFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNW-------SYAEDFQD-----FKFHSL 891
            +  V +L     R+ + +L   P D  M  F  W       + A  F+D     +K H  
Sbjct: 424  DGDVGILQNFKDRLYEKDL---PEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGD 480

Query: 892  NEERN-----NKSTLPENAGIAPAVVHPNAESTENKFTENDPHNL-----------LGVI 935
              E        K  LP NA           E + N+  END  +L              I
Sbjct: 481  PTEIAIQVFATKMDLPHNA--------LTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHI 532

Query: 936  RSFEFVSELRRMSVIVKPYGENVFWGFTKGAPEVISEICNK----------STLPANYEQ 985
              F F S ++RMS +        +  + KGA E I   C+                + E 
Sbjct: 533  AEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVET 592

Query: 986  ILQQ---YTHNGYRVIACAGKTLPKRTWRFAQ----KVSREEVESNMEFLGFVVFENKLK 1038
            I +     ++ G RV+  A K+  K      Q      +R   ES++ FLG +   +  +
Sbjct: 593  IRKNVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPR 652

Query: 1039 PSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLI-TESHVFVPQINDNMDPNEDLI 1097
              T   +     AGI   M TGD V TA ++ +E G++ T  + +  +I D+M       
Sbjct: 653  NETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSM------- 705

Query: 1098 IWRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIY 1157
                                         +TG  F       + L E  ++ + +   + 
Sbjct: 706  ----------------------------VMTGSQF-------DGLSEEEVDDLPVLPLVI 730

Query: 1158 ARMSPDEKHELVGQLQGLDYVVGFCGDGANDCGALKAADVGXXXXXXXXXXXXPFTSSVF 1217
            AR SP  K  ++  L          GDG ND  +LK A+VG              +  V 
Sbjct: 731  ARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVL 790

Query: 1218 ---EISCILDVIKEGR 1230
                 + IL+ ++EGR
Sbjct: 791  SDDNFASILNAVEEGR 806

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..548354)
            [3501 bp, 1166 aa]
          Length = 1166

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 127/578 (21%), Positives = 235/578 (40%), Gaps = 105/578 (18%)

Query: 664  TALAMVVRTGFSTTKGSLLRSMIFPKPSGFKFYEDSFKYIGFMTLIALAGFSISCINFIR 723
            T +A V+ TG  T      R  +    S  K      +      ++ +  F++S +  + 
Sbjct: 396  TCVACVIYTGTDT------RQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVI 449

Query: 724  LGL---AYKVMILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVS-- 778
             GL    + V I+R L + + ++P +L   L +G S    +++      I  T V  S  
Sbjct: 450  GGLDDDKWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDK--SIPDTIVRTSTI 507

Query: 779  ----GKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITN-VRGLFNKYSLND 833
                G+I+ +  DKTGTLT++ + +  +H+             ++T+ ++ L +  ++  
Sbjct: 508  PEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVS--YTMETMDMVTDYIQTLTSPANMGA 565

Query: 834  CG-------SPIDFKSRNFLVSLLTCHSL--RVVDGEL---LGDPLDFKMFQFTNWSYAE 881
             G         +  + R+ +V+L TCH++     D EL      P +  + +FT      
Sbjct: 566  AGVAVTGSRKEVSQRVRDLVVTLATCHNVTPNFEDNELAYQAASPDEIAIVKFT------ 619

Query: 882  DFQDFKFHSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLLGVIRSFEFV 941
              +         +R++ +   E +G+                  N  +++L V   F F 
Sbjct: 620  --ERVGLSLFKRDRHSLTLFHEYSGV------------------NLQYDILHV---FPFT 656

Query: 942  SELRRMSVIVKPYGENVFWGFTKGAPEVISEICNKSTLPANYEQILQQYTHNGYRVIACA 1001
            S+ +RM +IV+   +N  W   KGA  V+S+I   +      E+ +      G R +  A
Sbjct: 657  SDTKRMGIIVRDRTKNEIWFLQKGADTVMSKIVQSNDW---LEEEVSNMAREGLRTLVIA 713

Query: 1002 GKTLPKRTW-RFAQ-----------------KVSREEVESNMEFLGFVVFENKLKPSTTP 1043
             K L  R + +F++                 +V +  +E N+E LG    E+KL+     
Sbjct: 714  RKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKT 773

Query: 1044 TLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVD 1103
            ++  L++AG++  M TGD V TA  V   + LI+    +V  I      +  L       
Sbjct: 774  SIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQ-YVHTITKLTRRDGAL------- 825

Query: 1104 DCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPD 1163
                      LE +  + +  + + GD   +   +     E +  ++ L   I  R +P 
Sbjct: 826  --------SRLEYLKANRNSCLLIDGDSLAIYMSHYRA--EFFEIVICLPVVIACRCTPQ 875

Query: 1164 EKHE---LVGQLQGLDYVVGFCGDGANDCGALKAADVG 1198
            +K +   L+ ++ G    V   GDG ND   ++ ADVG
Sbjct: 876  QKADVALLIREMTGKR--VCCIGDGGNDVSMIQCADVG 911

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
            complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 182/848 (21%), Positives = 308/848 (36%), Gaps = 196/848 (23%)

Query: 558  EVRVYRDGFWVQVSSSELVPGDVYEISDPSLSTFPCDSLLLSGDCIVNESMLTGESVPVS 617
            EV V R+G    +S  +L+ GD+  +   +    P D +L+ G C  +ES +TGES  + 
Sbjct: 184  EVVVVRNGDKHVISVHDLLVGDLLSLQ--TGDVVPVDCILVEGKCECDESGITGESDTIK 241

Query: 618  KIP-ASDETIYQLLE-DFQKTQISN------FLAKSFLFNGTKIIRVRIGGEQSTALAMV 669
            K+  A    +Y+ +  D     I +       +    L +G+K++            A+V
Sbjct: 242  KVSLAMSLQVYRTVAADNPSADIGSSDNGHSLVPDPMLISGSKLL-------SGIGHAVV 294

Query: 670  VRTGFSTTKGSLLRSM-----IFPKPSGFKFYEDSFKYIGFMTLIALAGFSISCINFIRL 724
               G  +  G ++ ++       P         D     G     ++A F +  + F+R 
Sbjct: 295  TAVGPHSVHGKMMLALKSEPETTPLQERLNTLADDISIYG-----SVAAFLLFVVLFLRF 349

Query: 725  ------GLAYKVMIL-----RALDIITIVV-------PPALPATLSIGASFAIARLKKKG 766
                  G  Y  +       R +DI    V       P  LP  +++  +FA  R+ K G
Sbjct: 350  LSYLPKGRLYHDLPSARKGSRFMDIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDG 409

Query: 767  IFCIAPTRVNVSGKIDVMCFDKTGTLTEDGLDVL-----GVHVAEPQGHQNFRFGALITN 821
                        G    +C DKTGTLT++ + V+       H  +     N    A    
Sbjct: 410  NLVRVLRACETMGSATTVCSDKTGTLTQNKMVVVKGFLGSSHFDDISEDSNC---AQSDA 466

Query: 822  VRGLFNKYSLNDCGSPIDFKSRNFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNWSYAE 881
            +R   ++++LND  + I   S  F        + +V D  +  +P          WS   
Sbjct: 467  LRQDMSQHTLNDILANIALNSTAF-------ENKQVADPVITENPYHKPRRSLFPWS--- 516

Query: 882  DFQDFKFHSLNEERNNKSTLP------------------ENAGIAPAVVHPNAESTENKF 923
                         RNNK   P                  E A ++ A      ES +   
Sbjct: 517  -------------RNNKPKYPAPKDSSVQSAEFFIGSKTEAALLSLAKGSLGLESLQA-- 561

Query: 924  TENDPHNL--LGVIRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPEVISEIC------N 975
              +DPH++    +++   F S  +   ++V+    N +  F KGA E I + C      N
Sbjct: 562  LRDDPHHIGIASIVQMIPFESSRKWAGLVVRLVDGN-YRFFIKGASETIFKSCHYMRSSN 620

Query: 976  KSTL---PANYEQI---LQQYTHNGYRVIACAGK------TLPKRTWRFAQKVSREEVE- 1022
               +   P  + +I   +     +  R I+ A K      + P    R A   S    + 
Sbjct: 621  DDVIKLSPQKHGEIFGLINNLASDALRTISLAHKDFTDISSWPPAELRDASDPSTASPDL 680

Query: 1023 ---------------------SNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGD 1061
                                 S +   G V   + L+P    ++ + Q +G+   M TGD
Sbjct: 681  LLGDEYVPTATDRPSIITNNNSGLILDGVVGIHDPLRPGVKESVKNCQQSGVTVRMITGD 740

Query: 1062 NVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLILDGVTLEPMNGSS 1121
            N+ T  ++ R  G+++ES                                         +
Sbjct: 741  NITTGRAIARACGILSESEY---------------------------------------A 761

Query: 1122 DYTIAVTGDVFRLLFKNN--EVLPESYINMVLLKSSIYARMSPDEKHELVGQLQGLDYVV 1179
            D+  A+ G VFR L +    +  P         K  + AR SP++K   V  L+ ++ VV
Sbjct: 762  DHECAMEGPVFRKLSRRQMMDAAP---------KLKVLARSSPEDKRIFVDILKKMNEVV 812

Query: 1180 GFCGDGANDCGALKAADVGXXXXXXXXXXXXPFTSSVF---EISCILDVIKEGRA-SLT- 1234
               GDG ND  AL  ADVG              +  +    + + I++ IK GR  SL+ 
Sbjct: 813  AVTGDGTNDAPALTLADVGFSMGISGTGVAREASDIILMTDDFTSIVNAIKWGRCVSLSI 872

Query: 1235 TSFSCFQYMSLYSAIQFVTVTMLYSRGIN--LGDFQFLYIDLFLIVPIAIFMSWSKPYHK 1292
              F  FQ     +A+    VT + S   N  L   Q L+++L +    A+ ++  KP   
Sbjct: 873  KKFIQFQLTVNITAVTLTCVTAVTSTEENPVLTAVQLLWVNLIMDTLAALALATDKPDPH 932

Query: 1293 LVKKRPSA 1300
            ++++ P+ 
Sbjct: 933  ILERIPTG 940

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
            cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
            efflux, start by similarity
          Length = 1082

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 180/844 (21%), Positives = 322/844 (38%), Gaps = 156/844 (18%)

Query: 462  SSIQKGLPTSVVEDRMLAFGRNNINLKQKTSLE-ILFDEVLHPFYVFQIFSILLWLA-DN 519
            + I +GL  + + +R+   G N +    K +++ IL  ++ +   +  I S+++ LA  +
Sbjct: 33   THINQGLNNTQIAERLSLVGENTLGDDTKINIKGILISQICNAMIMVLIISMVITLAIKD 92

Query: 520  YYYYAACIFIISMLSIIDTLVETKKTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVPGD 579
            +       F++ +  +I    E   +    +  S S     V RDG  + + S ELVPGD
Sbjct: 93   WISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTPSAHVIRDGNDITIQSKELVPGD 152

Query: 580  --VYEISDPSLSTFPCD-SLLLSGDCIVNESMLTGESVPVSKIPASDETIYQLLEDFQKT 636
              + ++ D    T P D  LL S +   +E++LTGES+PV+K   S   +Y+     + T
Sbjct: 153  ICIIKVGD----TVPADLRLLESINLETDEALLTGESLPVAK---SHSEVYE-----KDT 200

Query: 637  QISNFLAKSFLFNGTKIIRVRIGGEQSTALAMVVRTGFSTTKGSLLRSMIFPKPSGFKFY 696
             + + L  +  F  + + + R       A  +V++T  +T  G + +S+        K  
Sbjct: 201  PVGDRL--NLAFAASTVTKGR-------ATGIVIKTALNTEIGKIAKSLKSETSFISKDE 251

Query: 697  EDSFKYIGFMTL------------------------IALAGFSISCINFIRLGLAYKV-- 730
              SF    ++TL                        I L   ++     +     Y+V  
Sbjct: 252  NKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQLAILLFVVAVIFAIVVMGTQKYRVNK 311

Query: 731  -MILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFDKT 789
             + + A+ +   ++P +L   L+I  S     +  + +       +   G ++ +C DKT
Sbjct: 312  QVAIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKT 371

Query: 790  GTLTEDGLDVLGVHVAEPQ------GHQNFRFGALITNVRGL--FNKYSLN-----DCGS 836
            GTLT+  +  +   V  PQ         N  F   I  +  +  F+ Y        D G 
Sbjct: 372  GTLTQGKM--IAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGI 429

Query: 837  PIDFKSRNFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNWSYAEDFQDFKFHSLNEERN 896
              DFKS             + + GEL   PL+  +F    W Y     +      + E  
Sbjct: 430  IPDFKS-------------KYLAGEL--GPLNVSLFD--QWLYTATLANIATVFQDSETQ 472

Query: 897  NKSTLPENAGIAPAVVHPNAE------STENKFTEND--PHNLLGVIRSFEFVSELRRMS 948
            +     +   IA  V     +      + E+K  E D   ++    +  F F S ++RMS
Sbjct: 473  DWKAHGDPTEIAIQVFATRMDLPRHVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRMS 532

Query: 949  VIVKPYGE---NVFWGFTKGAPEVISEICNK---------STLPANYEQILQQ----YTH 992
             I K   +    ++  FTKGA E + + C+          S L     + +Q+     + 
Sbjct: 533  AIYKNTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSS 592

Query: 993  NGYRVIACAGKTLPKRTWRFAQK---VSREEVESNMEFLGFVVFENKLKPSTTPTLASLQ 1049
             G RV+A A K+  +  +   +      R+ VE  + FLG +   +  +  +   +    
Sbjct: 593  EGLRVLAFAKKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCH 652

Query: 1050 DAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLIL 1109
             AGI   M TGD   TA S+ +E G++  +    P+                        
Sbjct: 653  QAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPK------------------------ 688

Query: 1110 DGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELV 1169
                 E +N    + +    D         + L +  I+ + +   + AR +P  K  ++
Sbjct: 689  -----EVVN----FMVMAATDF--------DALSDQEIDDLRVLPLVIARCAPQTKVRMI 731

Query: 1170 GQLQGLDYVVGFCGDGANDCGALKAADVGXXXXXXXXXXXXPFTSSVFE---ISCILDVI 1226
              L          GDG ND  +LK A+VG              +  V      + IL+ +
Sbjct: 732  EALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAV 791

Query: 1227 KEGR 1230
            +EGR
Sbjct: 792  EEGR 795

>KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, start by similarity
          Length = 1148

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 143/667 (21%), Positives = 255/667 (38%), Gaps = 143/667 (21%)

Query: 671  RTGFSTTKGSLLRSMIFPKPSGFKFYEDSFKYIGFMTLIALAGFSISCINFIRLGLAYKV 730
            R   +TTK      ++  + +G      +  ++  + L+A AGF+ +          + V
Sbjct: 395  RQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNN---------DWYV 445

Query: 731  MILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVS------GKIDVM 784
             I+R L + + ++P +L   L +G S    +++      I  T V  S      G+I+ +
Sbjct: 446  DIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDK--QIEDTIVRTSTIPEDLGRIEYL 503

Query: 785  CFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITNVRGLFNKYSLNDCGSP----IDF 840
              DKTGTLT++ + +  +H+     + N     ++T+     N  + N   +     I  
Sbjct: 504  LSDKTGTLTQNDMQLKKIHLGTV-SYTNETMD-IVTDFIQSMNSRTSNSTPTTTRKNISD 561

Query: 841  KSRNFLVSLLTCHSLRVV--DGELL---GDPLDFKMFQFTNWSYAEDFQDFKFHSLNEER 895
            +  + + +L  CH++     DGEL      P +  + +FT        +         +R
Sbjct: 562  RVIDLVTTLAICHNVTPTFEDGELTYQAASPDEIAIVKFT--------ESVGLSLFRRDR 613

Query: 896  NNKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLLGVIRSFEFVSELRRMSVIVKPYG 955
            ++ S   +++G+                 E D   L      F F S+ +RM VI+    
Sbjct: 614  HSISLFHDHSGMK---------------LEYDIKIL------FPFNSDSKRMGVIIFDKL 652

Query: 956  ENVFWGFTKGAPEVISEICNKSTLPANYEQILQQYTHNGYRVIACAGKTLPKRTWR---- 1011
            +  +W   KGA  V+S I  ++      E+        G R +    K L    +     
Sbjct: 653  KQEYWFLQKGADTVMSSIVVRNDW---LEEETSNMATEGLRTLVIGRKKLSTNLFEQFEK 709

Query: 1012 --------------FAQKVSREEVESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIM 1057
                            Q V R+ +E+++E LG    E+KL+     ++  L++AGI+  M
Sbjct: 710  EYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWM 769

Query: 1058 CTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLILDGVTLEPM 1117
             TGD V TA  V   + LI+    +V  +     P   L                 LE +
Sbjct: 770  LTGDKVETARCVSISAKLISRGQ-YVHTVTKVNKPEGAL---------------HHLEYL 813

Query: 1118 NGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVL-LKSSIYARMSPDEKHEL-VGQLQGL 1175
              + +  + + G+   L     +  P+ + ++V+ L + +  R +P +K ++ V   Q  
Sbjct: 814  QVNQNSCLLIDGESLGLYL---QYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQAT 870

Query: 1176 DYVVGFCGDGANDCGALKAADVGXXXXXXXXXXXXPFTSSVFEISCILDVIKEGR-ASLT 1234
               V   GDG ND   ++ ADVG                          V KEG+ ASL 
Sbjct: 871  GKRVCCIGDGGNDVSMIQCADVGVGI-----------------------VGKEGKQASLA 907

Query: 1235 TSFSCFQYMSLYSAI---------------QFVTVTMLYSRGINLGDFQFLYIDLFLIVP 1279
              FS  Q+  L   +               QFV       RG+ +   Q +Y    +  P
Sbjct: 908  ADFSITQFCHLTKLLLWHGRNSYKSSAKLSQFVI-----HRGLIISVCQAVYSICSMFEP 962

Query: 1280 IAIFMSW 1286
            +A++  W
Sbjct: 963  LALYQGW 969

>Kwal_26.7070
          Length = 1315

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 120/478 (25%), Positives = 196/478 (41%), Gaps = 97/478 (20%)

Query: 771  APTRVNVS------GKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITNVRG 824
            +PT V  S      G+I+ +  DKTGTLT + ++     +A     +        T   G
Sbjct: 537  SPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAATTEDG 596

Query: 825  L---FNKY-----SLNDCGSPIDFKSRNFLVSLLTCHSLRVVDGELLGD-PLDFKMFQFT 875
            +   F K+     +LND   P      +FL  L TCH+   V  E   D  + ++     
Sbjct: 597  IEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHT---VIPEFQEDGSIKYQAASPD 653

Query: 876  NWSYAEDFQDFKFHSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLLGVI 935
              +  E      +  +  + N+ S L E+ G                  +   + LL + 
Sbjct: 654  EGALVEGAASLGYKFIIRKPNSVSVLIEDLG------------------QEQEYQLLNIC 695

Query: 936  RSFEFVSELRRMSVIVK-PYGENVFWGFTKGAPEVISEICNKSTLPANYEQI--LQQYTH 992
               EF S  +RMS I + P GE     F KGA  VI E       P     +  L+ Y  
Sbjct: 696  ---EFNSTRKRMSAIFRLPNGEIKL--FCKGADTVILERLKAGENPYIEATLRHLEDYAA 750

Query: 993  NGYRVIACAGKTLPKRT---WR------------FAQKV--SREEVESNMEFLGFVVFEN 1035
             G R +  A +T+ +     W+             AQK+  + E +E ++  LG    E+
Sbjct: 751  EGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIED 810

Query: 1036 KLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITES-HVFVPQINDNMDPNE 1094
            KL+     T+ +LQDAGI+  + TGD   TA+++G    L++E  ++ +    D     +
Sbjct: 811  KLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRK 870

Query: 1095 DL-----------IIWRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLP 1143
            +L           I  +D++   L++DG +L           A+  D+            
Sbjct: 871  NLTEKLKAISDHQISQQDMNSLALVIDGKSL---------GFALEADL------------ 909

Query: 1144 ESYINMV--LLKSSIYARMSPDEKHELVGQLQ-GLDYVVGFCGDGANDCGALKAADVG 1198
            E Y+  +  L K+ I  R+SP +K  +V  ++   D ++   GDGAND   ++AA VG
Sbjct: 910  EDYLLAIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVG 967

>Scas_499.3
          Length = 346

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 77/148 (52%), Gaps = 18/148 (12%)

Query: 480 FGRNNINLKQKTSLEILFDEVLHPFYVFQIFSILLWLADNYYYYAA--CIFIISMLSIID 537
           +G N  ++   T +E+  +  + P +VFQ+F + LWL D ++YY+    + I+SM     
Sbjct: 177 YGENAFDIPVPTFMELFKEHAVAPLFVFQLFCVALWLLDEFWYYSLFNLMMIVSM----- 231

Query: 538 TLVETKKTSQRLAEVSHSHC------EVRVYRDGFWVQVSSSELVPGDVYEISDPS-LST 590
              E     QRL  +            + V R+  WV + ++EL+  DV  ++  +  S 
Sbjct: 232 ---EGAAVFQRLQSLKEFRTMGIKPFAINVLRNEHWVTLQTNELLTMDVVSLTTTTEESA 288

Query: 591 FPCDSLLLSGDCIVNESMLTGESVPVSK 618
            PCD +L+ G CIVNE+M +GES P+ K
Sbjct: 289 IPCDMILIDGACIVNEAM-SGESTPLLK 315

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 99/414 (23%), Positives = 173/414 (41%), Gaps = 96/414 (23%)

Query: 842  SRNFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNWSYAEDFQDFKFHSLNEERNNKSTL 901
            + NF+++L  CH++ V + +   + +DFK       +     +D  F  +   +N     
Sbjct: 812  NENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARDMGFSFVGRTKN----- 866

Query: 902  PENAGIAPAVVHPNAESTENKFTENDPHNLLGVIRSFEFVSELRRMSVIVK-----PYGE 956
                G+   +     E           + LL V+   EF S  +RMS I+K     P  E
Sbjct: 867  ----GVIVDIQGVQKE-----------YRLLNVL---EFNSTRKRMSCILKIPSENPNEE 908

Query: 957  NVFWGFTKGAPEVISEICNKSTLPANYEQI---LQQYTHNGYRVIACAGKTLPKRTWRFA 1013
                   KGA  +I    +K+      E+    L+QY   G R +  A + L   +W+  
Sbjct: 909  PRALLICKGADSIIYSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQREL---SWKEY 965

Query: 1014 QK------------VSREE--------VESNMEFLGFVVFENKLKPSTTPTLASLQDAGI 1053
            Q+            V RE+        +E  +  LG    E++L+     ++A+L +AGI
Sbjct: 966  QEWNEKHEIAAAALVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGI 1025

Query: 1054 RSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDL------ 1107
            +  + TGD V TAI++G    L          +N+ M   E L+I    DD D+      
Sbjct: 1026 KLWVLTGDKVETAINIGFSCNL----------LNNEM---ELLVIKASGDDVDIYGSKPA 1072

Query: 1108 -ILDGVTLE------PMNGS---------------SDYTIAVTGDVFRLLFKNNEVLPES 1145
             I+  + L+       M+GS                ++ + + GD  +L  +N++V  E 
Sbjct: 1073 EIVKNLILKYLQEKFQMSGSYEELEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREF 1132

Query: 1146 YINMVLLKSSIYARMSPDEKHELVGQLQG-LDYVVGFCGDGANDCGALKAADVG 1198
             +     K+ +  R+SP +K  +V  ++  LD +    GDG+ND   +++AD+G
Sbjct: 1133 LLLCKRCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIG 1186

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 113/466 (24%), Positives = 192/466 (41%), Gaps = 76/466 (16%)

Query: 772  PTRVNVS------GKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNF---RFGALITNV 822
            PT V  S      G+I+ +  DKTGTLT + ++   V +A     +     R   +   +
Sbjct: 543  PTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGI 602

Query: 823  RGLFNKY-SLND-CGSPIDFKSR---NFLVSLLTCHSL---RVVDGELLGDPLDFKMFQF 874
               F+ + SL D    P D ++     FL  L TCH++      DG +            
Sbjct: 603  EIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTI------------ 650

Query: 875  TNWSYAEDFQDFKFHSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLLGV 934
                        K+ + + +         + G    +  PN+ S    F+E   + LL +
Sbjct: 651  ------------KYQAASPDEGALVQGAADLGFRFDIRRPNSVSISTPFSEQLEYQLLNI 698

Query: 935  IRSFEFVSELRRMSVIVK-PYGENVFWGFTKGAPEVISEICNKSTLPANYEQI--LQQYT 991
                EF S  +RMS I + P G      F KGA  VI E  +    P     +  L+ Y 
Sbjct: 699  C---EFNSTRKRMSAIFRMPDGSIKL--FCKGADTVILERLDSEFNPYVQSTLRHLEDYA 753

Query: 992  HNGYRVIACAGKTLPKRTWRFAQKV-----------------SREEVESNMEFLGFVVFE 1034
              G R +  A +T+P++ +    K+                 + E +E ++ FLG    E
Sbjct: 754  AEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFLGATAIE 813

Query: 1035 NKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNE 1094
            +KL+     T+  LQ+AG++  + TGD   TAI++G    L++E    +     N +  E
Sbjct: 814  DKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIV---NEETKE 870

Query: 1095 DLIIWRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINM-VLLK 1153
            D        +    L+ +    ++     ++A+  D   L +   E L + ++ +  L K
Sbjct: 871  D-----TRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLEDQFLTIGKLCK 925

Query: 1154 SSIYARMSPDEKHELVGQLQ-GLDYVVGFCGDGANDCGALKAADVG 1198
            + I  R+SP +K  +V  ++     ++   GDGAND   ++AA VG
Sbjct: 926  AVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVG 971

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 47/100 (47%), Gaps = 7/100 (7%)

Query: 519 NYYYYAACIFIISMLSIIDTLVETKKTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVPG 578
           N Y     + ++ ++S +   VE  K S    E++HS C+V   R G +V+    ++  G
Sbjct: 250 NRYTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAVG 309

Query: 579 DVYEISDPSLSTFPCDSLLLS-----GDCIVNESMLTGES 613
           D+  +   S    P D ++LS     G C +  + L GE+
Sbjct: 310 DIIRVR--SEEAIPADLIILSSSEPEGLCYIETANLDGET 347

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 142/641 (22%), Positives = 249/641 (38%), Gaps = 159/641 (24%)

Query: 706  MTLIALAGFSISCINFIRLGLAYKVMILRALDIITIVVPPALPATLSIGASFAIARLKKK 765
            + L+A AGF             + V I+R L + + ++P +L   L +G S    +++  
Sbjct: 423  IVLVAFAGFG---------NKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHD 473

Query: 766  GIFCIAPTRVNVS------GKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGAL- 818
                I  T V  S      G+I+ +  DKTGTLT++ + +  +H+    G  ++    + 
Sbjct: 474  A--TIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHL----GTVSYTMDTMD 527

Query: 819  -ITN-VRGLFNKYSL-----NDCGSPIDFKSRNFLVSLLTCHSLRVV--DGELL---GDP 866
             +T+ V+ L +  +      +     +  + R+ +V+L  CH++     DGEL      P
Sbjct: 528  IVTDYVQELVSSSTTTPMPQSTAKKDLPNRVRDLVVTLAICHNVTPTFEDGELTYQAASP 587

Query: 867  LDFKMFQFTNWSYAEDFQDFKFHSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTEN 926
             +  + +FT        +         +R++ S   +++                    N
Sbjct: 588  DEIAIVKFT--------ESVGLSLFKRDRHSVSLFHQHSAT------------------N 621

Query: 927  DPHNLLGVIRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPEVISEICNKSTLPANYEQI 986
              +++L V   F F S+ +RM +IV    +   W   KGA  V++ I   +      ++ 
Sbjct: 622  FEYDILQV---FPFNSDTKRMGIIVYDKVKGEHWFMQKGADTVMARIVQSNDW---LDEE 675

Query: 987  LQQYTHNGYRVIACAGKTL-PKRTWRFAQK-----------------VSREEVESNMEFL 1028
            +      G R +    K L PK   +F ++                 V ++ +E N+E L
Sbjct: 676  VGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELL 735

Query: 1029 GFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQIND 1088
            G    E+KL+     ++  L++AG++  M TGD V TA  V   + LI+    +V  +  
Sbjct: 736  GLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQ-YVHTVTK 794

Query: 1089 NMDPNEDL----IIWRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPE 1144
               P   L     +  +   C L++DG +L                +F   +K      E
Sbjct: 795  LSRPEGALNALEYLKINKSSC-LLIDGESL---------------GMFLTYYKQ-----E 833

Query: 1145 SYINMVLLKSSIYARMSPDEKHE---LVGQLQGLDYVVGFCGDGANDCGALKAADVGXXX 1201
             +  +V L + I  R +P +K +   L+ ++ G    V   GDG ND   ++ ADVG   
Sbjct: 834  FFDIVVDLPAVIACRCTPQQKADVALLIREITGKR--VCCIGDGGNDVSMIQCADVGVGI 891

Query: 1202 XXXXXXXXXPFTSSVFEISCILDVIKEGR-ASLTTSFSCFQYMSLYSAI----------- 1249
                                   V KEG+ ASL   FS  Q+  L   +           
Sbjct: 892  -----------------------VGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRS 928

Query: 1250 ----QFVTVTMLYSRGINLGDFQFLYIDLFLIVPIAIFMSW 1286
                QFV       RG+ +   Q +Y       PIA++  W
Sbjct: 929  AKLAQFVI-----HRGLIISVCQAVYSVCSKFEPIALYQGW 964

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, hypothetical start
          Length = 1144

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 132/617 (21%), Positives = 236/617 (38%), Gaps = 143/617 (23%)

Query: 728  YKVMILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVS------GKI 781
            + V I+R L + + ++P +L   L +  S    +++      I  T V  S      G+I
Sbjct: 434  WYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDK--TIPETIVRTSTIPEDLGRI 491

Query: 782  DVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITNVRGLFNKYSLNDCGSPIDFK 841
            + +  DKTGTLT++ + +  VH+     +       +   ++G+    S ND  + +  +
Sbjct: 492  EYLLSDKTGTLTQNDMQLKKVHLGNV-SYTTETADIVSDYIQGMIE--SKNDSVTNLGPR 548

Query: 842  SR----------NFLVSLLTCHSLRVV--DGELL---GDPLDFKMFQFTNWSYAEDFQDF 886
            S           + + +L  CH++     D EL      P +  + +FT        +  
Sbjct: 549  STTRKDAATHVIDLITTLAICHNVTPTFEDDELTYQAASPDEIAIVKFT--------ESV 600

Query: 887  KFHSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLLGVIRSFEFVSELRR 946
                   +R++ S L E++G    +++ +                  V+  F F S+ +R
Sbjct: 601  GLSLFKRDRHSMSLLHEHSG---TILNYD------------------VLTMFPFNSDTKR 639

Query: 947  MSVIVKPYGENVFWGFTKGAPEVISEICNKSTLPANYEQILQQYTHNGYRVIACAGKTLP 1006
            M +IV    ++ +W   KGA  V++ I   +      E+        G R +    K L 
Sbjct: 640  MGIIVYDKQKDQYWFLQKGADTVMNRIVANNDW---LEEETGNMAREGLRTLVIGRKKLT 696

Query: 1007 KRTWRFAQK---------VSREE---------VESNMEFLGFVVFENKLKPSTTPTLASL 1048
            K+ +   +K          +RE+         +E ++E LG    E+KL+     ++  L
Sbjct: 697  KKIYEQFKKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELL 756

Query: 1049 QDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLI 1108
            ++AGI+  M TGD V TA  V   + LI+    +V  +     P                
Sbjct: 757  RNAGIKIWMLTGDKVETARCVSISAKLISRGQ-YVHVVTKLSKP---------------- 799

Query: 1109 LDGV--TLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKH 1166
             +G    LE +  + +  + + G+   +  K      E +  +V L + I  R +P +K 
Sbjct: 800  -EGAFNQLEYLKVNKNACLLIDGESLGMFLKYYR--QEFFDVVVHLPTVIACRCTPQQKA 856

Query: 1167 ELVGQLQGLDYVVGFC-GDGANDCGALKAADVGXXXXXXXXXXXXPFTSSVFEISCILDV 1225
            ++   ++ L      C GDG ND   ++ ADVG                          V
Sbjct: 857  DVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGI-----------------------V 893

Query: 1226 IKEGR-ASLTTSFSCFQYMSLYSAI---------------QFVTVTMLYSRGINLGDFQF 1269
             KEG+ ASL   FS  Q+  L   +               QFV       RG+ +   Q 
Sbjct: 894  GKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVM-----HRGLIIAICQA 948

Query: 1270 LYIDLFLIVPIAIFMSW 1286
            ++       PIA++  W
Sbjct: 949  VFSVCSQFEPIALYQGW 965

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 109/457 (23%), Positives = 194/457 (42%), Gaps = 57/457 (12%)

Query: 772  PTRVNVS------GKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITNVRGL 825
            PT V  S      G+I+ +  DKTGTLT++ ++     +A     Q+             
Sbjct: 535  PTVVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPE---------- 584

Query: 826  FNKYSLNDCGSPIDFKSRNFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNWSYAEDFQD 885
             +K +  D G  + +++ + +  LL  H+    DG ++ + L       T     ++   
Sbjct: 585  -DKDAAFDEGIEVGYRTYDDMHELL--HTPGSGDGAIIDEFLTLLSICHTVIPEFQENGS 641

Query: 886  FKFHSLNEERNNKSTLPENAGIAPAVVHPNAEST-ENKFTENDPHNLLGVIRSFEFVSEL 944
             K+ + + +         + G    +  PN+ +      TE   + LL +    EF S  
Sbjct: 642  IKYQAASPDEGALVQGAADLGYKFIIRKPNSVTILREDITEEVVYELLNIC---EFNSTR 698

Query: 945  RRMSVIVKPYGENVFWGFTKGAPEVISEICNKSTLP--ANYEQILQQYTHNGYRVIACAG 1002
            +RMS I + + +N      KGA  VI E    ++ P  A   + L+ Y   G R +  A 
Sbjct: 699  KRMSAIFR-FPDNSIRLLCKGADTVILERLAATSNPYVAATLRHLEDYAAEGLRTLCIAS 757

Query: 1003 KTLPKRTWRFAQKV---------SREE--------VESNMEFLGFVVFENKLKPSTTPTL 1045
            +T+P+  +    K+         +R E        +E  +  LG    E+KL+     T+
Sbjct: 758  RTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETI 817

Query: 1046 ASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLII--WRDVD 1103
             +LQ AGI+  + TGD   TAI++G    L++E    +    D  +   + +I   R ++
Sbjct: 818  HTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAIN 877

Query: 1104 DCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINM-VLLKSSIYARMSP 1162
            D       ++ + MN     T+A+  D   L F     L E  + +  + ++ I  R+SP
Sbjct: 878  DHQ-----ISQQDMN-----TLALVIDGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSP 927

Query: 1163 DEKHELVGQLQ-GLDYVVGFCGDGANDCGALKAADVG 1198
             +K  +V  ++     ++   GDGAND   ++AA VG
Sbjct: 928  LQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVG 964

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 91/397 (22%), Positives = 164/397 (41%), Gaps = 65/397 (16%)

Query: 844  NFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNWSYAEDFQDFKFHSLNEERNNKSTLPE 903
            +F++SL  CHS+ V + +   + LD K       +  E  +D  F  +   +N       
Sbjct: 776  HFMLSLALCHSVVVEENKNNPEKLDIKAQSPDEAALVETARDMGFSFVGRTKNG------ 829

Query: 904  NAGIAPAVVHPNAESTENKFTENDPHNLLGVIRSFEFVSELRRMSVIVK-PYGEN----V 958
                    V    +  + +F          ++   EF S  +RMS IVK P  +      
Sbjct: 830  --------VIIEIQGVQKEFR---------ILNVLEFNSTRKRMSCIVKIPAADENSKPK 872

Query: 959  FWGFTKGAPEVISEICNKS-TLPANYEQI---LQQYTHNGYRVIACAGKTL--------- 1005
                 KGA  VI    ++S   P   E+    L+Q+   G R +  A + +         
Sbjct: 873  ALLLCKGADSVIYSRLDRSRNDPKLLERTALHLEQFATEGLRTLCVAQREIDWDEYLNWN 932

Query: 1006 PKRTWRFAQKVSREE--------VESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIM 1057
             +R    A   +REE        +E  +  LG    E++L+     +++ L DAGI+  +
Sbjct: 933  ERRELAAASLDNREEALERVADAIERQLVLLGGTAIEDRLQDGVPDSISILADAGIKLWV 992

Query: 1058 CTGDNVLTAISVGRESGLI-TESHVFVPQIN----DNMDPNEDLIIWRDVD---DCDLIL 1109
             TGD V TAI++G    L+ ++  + V + +    +++   +  ++   +D   +    +
Sbjct: 993  LTGDKVETAINIGFSCNLLGSDMELLVIKSSGEDVEHLGEKDSDVVLALIDKYLETHFNM 1052

Query: 1110 DGVTLEPMNGSSDYT-------IAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSP 1162
             G   E      D+T       + + GD  +L     ++  +  +     K+ +  R+SP
Sbjct: 1053 KGSPEELAAARKDHTPPQSAFGVVIDGDALKLALHGEDIRRKFLLLCKNCKAVLCCRVSP 1112

Query: 1163 DEKHELVGQL-QGLDYVVGFCGDGANDCGALKAADVG 1198
             +K  +V  + + LD V    GDG+ND   ++AADVG
Sbjct: 1113 SQKAAVVKLVKESLDVVTLAIGDGSNDVAMIQAADVG 1149

>Scas_704.38
          Length = 1161

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 106/506 (20%), Positives = 198/506 (39%), Gaps = 92/506 (18%)

Query: 732  ILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVS------GKIDVMC 785
            ++R L + + ++P +L   L +  S    +++      I  T V  S      G+I+ + 
Sbjct: 454  VMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDD--TIPETIVRTSTIPEDLGRIEYLL 511

Query: 786  FDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITNVRGLFNKY-SLNDCGSPIDFKSR- 843
             DKTGTLT++ + +  +H+     + +     +   V  L N   S N  G  +   SR 
Sbjct: 512  SDKTGTLTQNDMQLKKIHLGTV-SYTSETLDIVSDYVDALVNSSNSANPSGKSVPSTSRK 570

Query: 844  -------NFLVSLLTCHSLRVV--DGELL---GDPLDFKMFQFTNWSYAEDFQDFKFHSL 891
                   + +V+L  CH++     D EL      P +  + +FT        +       
Sbjct: 571  DLSARVRDMVVTLAICHNVTPTFEDDELTYQAASPDEIAIVKFT--------ESVGLSLF 622

Query: 892  NEERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLLGVIRSFEFVSELRRMSVIV 951
              +R++ S L  ++G                           +++ F F S+ +RM +IV
Sbjct: 623  KRDRHSISLLHGHSGSILT---------------------YEILQVFPFNSDSKRMGIIV 661

Query: 952  KPYGENVFWGFTKGAPEVISEICNKSTLPANYEQILQQYTHNGYRVIACAGKTLPKRTWR 1011
                ++ +W   KGA  V++ I   +      E+        G R +    K L +  + 
Sbjct: 662  HDEQKDEYWFMQKGADTVMARIVENNDW---LEEETGNMAREGLRTLVVGRKKLSRNIYD 718

Query: 1012 FAQK---------VSREE---------VESNMEFLGFVVFENKLKPSTTPTLASLQDAGI 1053
              +K         V+R++         +E ++E LG    E+KL+     ++  L++AGI
Sbjct: 719  QFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGI 778

Query: 1054 RSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLILDGVT 1113
            +  M TGD V TA  V   + LI+    +V  I     P   L                 
Sbjct: 779  KIWMLTGDKVETARCVSISAKLISRGQ-YVHIITKLTKPEGAL---------------NQ 822

Query: 1114 LEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQ 1173
            LE +  +    + + G+   +  +  +   E +  ++ L + +  R +P +K ++   ++
Sbjct: 823  LEYLKVNKGACLLIDGESLGMFLRYYK--REFFDVVICLPTVVACRCTPQQKADVALVIR 880

Query: 1174 GLDYVVGFC-GDGANDCGALKAADVG 1198
                    C GDG ND   ++ ADVG
Sbjct: 881  EFTGKRVCCIGDGGNDVSMIQCADVG 906

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score = 70.9 bits (172), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 79/312 (25%), Positives = 138/312 (44%), Gaps = 50/312 (16%)

Query: 934  VIRSFEFVSELRRMSVIVK-----PYGENVFWGFTKGAPEVI-SEICNKS-----TLPAN 982
            ++   EF S  +RMS I+K     P  E       KGA  VI S +  K+     TL   
Sbjct: 832  ILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGENDETLLEK 891

Query: 983  YEQILQQYTHNGYRVIACAGKTLPKRTW--------RF----AQKVSREE--------VE 1022
                L+QY   G R +  A + L   TW        R+    A   +REE        +E
Sbjct: 892  TALHLEQYATEGLRTLCLAQREL---TWSEYTEWNARYDIAAASLTNREEQLEIVSDSIE 948

Query: 1023 SNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESH-- 1080
             ++  LG    E++L+     ++A L +AGI+  + TGD V TAI++G    L+      
Sbjct: 949  RDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNNDMEL 1008

Query: 1081 VFVPQINDNM-----DPNE--DLIIWR------DVDDCDLILDGVTLEPMNGSSDYTIAV 1127
            + V    +++     DP+E  + +I +       +   ++ LD    +      D+ + +
Sbjct: 1009 LVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGDFAVVI 1068

Query: 1128 TGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQG-LDYVVGFCGDGA 1186
             GD  ++    +++  +  +     K+ +  R+SP +K  +V  ++  LD +    GDG+
Sbjct: 1069 DGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGS 1128

Query: 1187 NDCGALKAADVG 1198
            ND   +++ADVG
Sbjct: 1129 NDVAMIQSADVG 1140

>CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharomyces
            cerevisiae YGL167c PMR1, hypothetical start
          Length = 946

 Score = 70.5 bits (171), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 95/419 (22%), Positives = 164/419 (39%), Gaps = 73/419 (17%)

Query: 993  NGYRVIACAGKTLPKRTWRFAQKVSREEVESNMEFLGFVVFENKLKPSTTPTLASLQDAG 1052
            +G R IACA K         +  V  E+  + + F G     +  +P+   ++  L   G
Sbjct: 540  DGLRTIACAFKPTD------SDNVISEDDINGLTFTGLFGLADPPRPNVKASIEKLHRGG 593

Query: 1053 IRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLILDGV 1112
            +  IM TGD+V TA+S+  + GL  +                                  
Sbjct: 594  VHIIMITGDSVNTAVSIAEKIGLSVQDR-------------------------------- 621

Query: 1113 TLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQL 1172
                       +  +TGD      K +E L E  ++ V+ K +I+AR +P+ K  +V  L
Sbjct: 622  ----------ESSVMTGD------KVSE-LTEDELSKVIDKVNIFARATPENKLNIVKAL 664

Query: 1173 QGLDYVVGFCGDGANDCGALKAADVGXXXXXXXXXXXXPFTSSVF---EISCILDVIKEG 1229
            +    +V   GDG ND  ALK AD+G              +  +    + S IL  I+EG
Sbjct: 665  RKRGDIVAMTGDGVNDAPALKLADIGIAMGISGTDVAKEVSDMILTDDDFSSILTAIEEG 724

Query: 1230 RASLTT--SFSCFQYMSLYSAIQFVTVTMLYSRGINLGDFQFLYIDLFLIVPIAIFMSWS 1287
            +       +F  FQ     + +  + +T +      L   Q L+I++ +  P A  +   
Sbjct: 725  KGIFNNIRNFLTFQLSISVATLSLIAITTIAKLPAPLNPMQILWINIIMDGPPAQSLGVE 784

Query: 1288 KPYHKLVKKRPSANLVSPKILAPLVANIAIILVFQATPWLVVQAMRWYQAPVVGGDDAVQ 1347
                 ++ K P +     +IL     NI + L++ A   LV     + +    G D+  Q
Sbjct: 785  PVDSDVMDKPPRSR--EERILN---MNILLRLLYLAICILVGTFYIFLK----GMDENQQ 835

Query: 1348 SSDNTVLFFFSNFQYVLTAIVLSVGPPYREPMSKNLGFITDVV--ISIILNVVLMMVPV 1404
            ++   +   F+ F  V  AI  +V   +       +G  ++ +  I+I+L+V   M  V
Sbjct: 836  TTSKDITMTFTGF--VFFAIFNAVACRHTTKSIFQIGLFSNRIFNIAILLSVCGQMCAV 892

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 67/298 (22%), Positives = 133/298 (44%), Gaps = 30/298 (10%)

Query: 509 IFSILLWLADNYYYYAACIFIISMLSIIDTLVETKKTSQRLAEVSHSHCEVRVYRDGFWV 568
           + S  +   D+    +  I I+  +  I     ++K+ + L ++  + C   + R G   
Sbjct: 116 VLSFAIGQIDDAVSISLAILIVVTVGFIQEY-RSEKSLEALNKLVPTKC--HLIRYGRES 172

Query: 569 QVSSSELVPGDV--YEISDPSLSTFPCDSLLLSG-DCIVNESMLTGESVPVSKIPASDET 625
              +SELVPGD+  ++I D      P D  ++   D  ++ES LTGE+ P+ K     +T
Sbjct: 173 NTLASELVPGDLVRFKIGD----RIPADVRIIEAVDLSIDESNLTGETEPLHK---DAQT 225

Query: 626 IYQLLEDFQKTQISNFLAKSFLFNGTKIIRVRIGGEQSTALAMVVRTGFSTTKGS---LL 682
           I    E++    +         + GT +       ++     +V+ TG +T+ G+   ++
Sbjct: 226 IDP--EEYDNRNVPVSERSCIAYMGTLV-------KEGHGKGIVIGTGTNTSYGAIFEMV 276

Query: 683 RSMIFPKPSGFKFYEDSFKYIGF-MTLIALAGFSISCINFIRLGLAYKVMILRALDIITI 741
            S+  PK       +++   +G  ++ I+    +I  I  I  G +  +M   ++ +   
Sbjct: 277 NSIEKPKTP----LQETMDRLGTELSYISFFIIAIISIVGIIRGNSLLMMFQVSVSLAVA 332

Query: 742 VVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFDKTGTLTEDGLDV 799
            +P  LP  +++  +  + R+ K+         V   G ++V+C DKTGTLT + + V
Sbjct: 333 AIPEGLPIIVTVTLALGVLRMTKQNAIVRRLPSVETLGSVNVICTDKTGTLTTNHMTV 390

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 90/187 (48%), Gaps = 28/187 (14%)

Query: 1021 VESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITE-S 1079
            +E+++E LG    E+KL+      +  ++ AGI+  M TGD   TAI++G    LI + S
Sbjct: 995  IETDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYACKLIYDYS 1054

Query: 1080 HVFVPQINDNMDPNEDLIIWRDVD-----DCDLILDGVTLEPMNGSSDYTIAVTGDVFRL 1134
             V + + ND+   ++   +  ++D      C L++DG +L                    
Sbjct: 1055 TVVILKKNDDNLISKMTALGEELDTGKIAHCVLVIDGASLA------------------- 1095

Query: 1135 LFKNNEVLPESYINMVLLKSS-IYARMSPDEKHELVG--QLQGLDYVVGFCGDGANDCGA 1191
            +F+NN  +   +I +     S I  R SP +K  +V   +L+  D V    GDGAND   
Sbjct: 1096 VFENNPTMMSVFIELCTKTDSVICCRASPSQKALIVTNIRLKNKDLVTLAIGDGANDIAM 1155

Query: 1192 LKAADVG 1198
            +++AD+G
Sbjct: 1156 IQSADIG 1162

>Scas_576.8
          Length = 1591

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 79/312 (25%), Positives = 135/312 (43%), Gaps = 50/312 (16%)

Query: 934  VIRSFEFVSELRRMSVIVK-----PYGENVFWGFTKGAPEVI-SEICNKSTLPANYEQIL 987
            ++ + EF S  +RMS IVK     P  E       KGA  +I S +  K+   AN E +L
Sbjct: 852  ILNTLEFNSTRKRMSCIVKIPGANPDDEPRALLICKGADSIIYSRLGTKNG--ANSENLL 909

Query: 988  Q-------QYTHNGYRVIACAGKTLP--------KRTWRFAQKVSR---------EEVES 1023
            +       QY   G R +  A + L         KR    A  V+          +E+E 
Sbjct: 910  EKTALHLEQYATEGLRTLCIAQRELSWPEYLEWNKRYDIAAASVTNREEQLEAVSDEIER 969

Query: 1024 NMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLI-TESHVF 1082
             +  LG    E++L+     +++ L  AGI+  + TGD V TAI++G    L+  +  + 
Sbjct: 970  ELTLLGGTAIEDRLQDGVPESISILAQAGIKLWVLTGDKVETAINIGFSCNLLNNDMELL 1029

Query: 1083 VPQINDN------MDPNE--DLIIWRDVDDCDLILDGVTLEPMNGS-------SDYTIAV 1127
            V + N +       DP E  + +I + + +    L G  +E  +          D+ + +
Sbjct: 1030 VVKTNGDDVQEFGNDPAEIAESLITKYLRE-KFGLTGSEMELADAKKNHDFPRGDFAVVI 1088

Query: 1128 TGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQ-LQGLDYVVGFCGDGA 1186
             G+  +L      +  +  +     K+ +  R+SP +K  +V   +  LD +    GDG+
Sbjct: 1089 DGEALKLALNGESIRRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVMTSLDVMTLAIGDGS 1148

Query: 1187 NDCGALKAADVG 1198
            ND   +++ADVG
Sbjct: 1149 NDVAMIQSADVG 1160

>CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharomyces
            cerevisiae YAL026c DRS2, start by similarity
          Length = 1328

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 81/325 (24%), Positives = 141/325 (43%), Gaps = 65/325 (20%)

Query: 911  VVHPNAESTENKFTENDPHNLLGVIRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPEVI 970
            +  PN+ +      E   + LL +    EF S  +RMS I + + ++      KGA  VI
Sbjct: 653  IRKPNSVTILINEEEEREYQLLNIC---EFNSTRKRMSAIFR-FPDDSIKLLCKGADSVI 708

Query: 971  SEICNKSTLPANY-----EQILQQYTHNGYRVIACAGKTLPKRTWRF------------- 1012
             E  +++    N+      + L+ Y   G R +  A K +P+  +               
Sbjct: 709  LERLSET---GNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLD 765

Query: 1013 --AQKVSR--EEVESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAIS 1068
              A+K+    EE+ES +  +G    E+KL+     T+ +LQ+AGI+  + TGD   TAI+
Sbjct: 766  HRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAIN 825

Query: 1069 VGRESGLITE-------SHVFVPQINDNMDP-----NEDLIIWRDVDDCDLILDGVTLEP 1116
            +G    L++E       S         NM+      +E  +   D++   L++DG +L  
Sbjct: 826  IGMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSL-- 883

Query: 1117 MNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMV--LLKSSIYARMSPDEKHELVGQLQ- 1173
                   + A+  D+            E Y   +  + K+ I  R+SP +K  +V  ++ 
Sbjct: 884  -------SFALEADL------------EDYFLAIGKMCKAVICCRVSPLQKALVVKMVKR 924

Query: 1174 GLDYVVGFCGDGANDCGALKAADVG 1198
              + ++   GDGAND   ++AA VG
Sbjct: 925  KTNSLLLAIGDGANDVSMIQAAHVG 949

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 76/310 (24%), Positives = 134/310 (43%), Gaps = 47/310 (15%)

Query: 934  VIRSFEFVSELRRMSVIVKPYGENVFWG-----FTKGAPEVISEICNKSTLPANYEQILQ 988
            ++   EF S  +RMS IVK  G++           KGA  VI    +K+ L  N E +L+
Sbjct: 843  ILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLDKTGL--NEESLLE 900

Query: 989  -------QYTHNGYRVIACAGKTLPKRTW-RFAQK--------VSREE--------VESN 1024
                   QY   G R +  A + L    + R+ +K        V REE        +E +
Sbjct: 901  KTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIERH 960

Query: 1025 MEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFV- 1083
            +  LG    E++L+     ++A L +AGI+  + TGD V TAI++G    L+      + 
Sbjct: 961  LILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLV 1020

Query: 1084 -----PQIND-NMDPNE--DLIIWRDVDD------CDLILDGVTLEPMNGSSDYTIAVTG 1129
                 P + D    P +  D +I + + D       +  L     E      ++ + + G
Sbjct: 1021 IKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIPRGEFAVIIDG 1080

Query: 1130 DVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQG-LDYVVGFCGDGAND 1188
            +  +      ++  +  +     KS +  R+SP +K  +V  ++  LD +    GDG+ND
Sbjct: 1081 EALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSND 1140

Query: 1189 CGALKAADVG 1198
               +++A++G
Sbjct: 1141 VAMIQSANIG 1150

>Scas_297.1
          Length = 800

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 98/246 (39%), Gaps = 53/246 (21%)

Query: 1060 GDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLILDGVTLEPMNG 1119
            GDN+LTA ++ R   +++E    +P+                   C              
Sbjct: 1    GDNILTARAIARNCNILSEETYLIPE-------------------C-------------- 27

Query: 1120 SSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQGLDYVV 1179
                  A+ G  FR L K   +        +L    + AR SP++K  LV  L+G+  VV
Sbjct: 28   ------AIEGPKFRTLTKQERI-------KMLPNLRVMARSSPEDKRLLVETLKGMGDVV 74

Query: 1180 GFCGDGANDCGALKAADVGXXXXXXXXXXXXPFTSSVF---EISCILDVIKEGRASLTT- 1235
               GDG ND  ALK ADVG              +  +    + + I+D IK GR    + 
Sbjct: 75   AVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFAAIVDAIKWGRCVSISI 134

Query: 1236 -SFSCFQYMSLYSAIQFVTVTMLYSRGIN--LGDFQFLYIDLFLIVPIAIFMSWSKPYHK 1292
              F  FQ +   +A+    V+ + S      L   Q L+I+L +    A+ ++  KP   
Sbjct: 135  KKFIQFQLIVNITAVILAFVSSIASEDETSVLTAVQLLWINLIMDTLAALALATDKPDPN 194

Query: 1293 LVKKRP 1298
            ++ ++P
Sbjct: 195  IMDRKP 200

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 2/62 (3%)

Query: 558 EVRVYRDGFWVQVSSSELVPGDVYEISDPSLSTFPCDSLLLSGDCIVNESMLTGESVPVS 617
           ++ V R+   +  S   L+ GD+  I+  +    P D +L+ G C V+ES +TGES  + 
Sbjct: 599 KIIVIRNSQELLTSIHNLLVGDI--ITLQTGDVIPADGVLVEGQCEVDESSITGESDTIK 656

Query: 618 KI 619
           K+
Sbjct: 657 KV 658

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 76/314 (24%), Positives = 133/314 (42%), Gaps = 54/314 (17%)

Query: 934  VIRSFEFVSELRRMSVIVK-----PYGENVFWGFTKGAPEVISEICNKSTLPANYEQILQ 988
            ++   EF S  +RMS IVK     P  E       KGA  +I    ++ +  +N E IL+
Sbjct: 836  ILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQS-GSNSEAILE 894

Query: 989  -------QYTHNGYRVIACAGKTLPKRTWRFAQK------------VSREE--------V 1021
                   QY   G R +  A + L   +W   +K             +RE+        +
Sbjct: 895  KTALHLEQYATEGLRTLCIAQREL---SWSEYEKWNEKYDIAAASLANREDELEVVADSI 951

Query: 1022 ESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESH- 1080
            E  +  LG    E++L+      +  L +AGI+  + TGD V TAI++G    L+     
Sbjct: 952  ERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEME 1011

Query: 1081 -VFVPQINDNM-----DPNE--DLIIWRDVDDCDLILDGVTLEPMNGSSD-------YTI 1125
             + +    D++     +P+E  D ++ + + +    L G   E      D       Y I
Sbjct: 1012 LLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEY-FNLTGSEEEIFEAKKDHEFPKGNYAI 1070

Query: 1126 AVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQ-GLDYVVGFCGD 1184
             + GD  +L     ++  +  +     ++ +  R+SP +K  +V  ++  LD +    GD
Sbjct: 1071 VIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTLAIGD 1130

Query: 1185 GANDCGALKAADVG 1198
            G+ND   +++ADVG
Sbjct: 1131 GSNDVAMIQSADVG 1144

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 111/246 (45%), Gaps = 44/246 (17%)

Query: 561 VYRDGFWVQVSSSELVPGDVYEISDPSLSTFPCDSLLLSGDCI--VNESMLTGESVPVSK 618
           V RDG  V++ ++E+VPGD+ ++ D ++   P D  +++ DC   +++S +TGES+ V K
Sbjct: 182 VIRDGQLVEIPANEVVPGDILQLEDGTV--IPTDGRIVTEDCFLQIDQSAITGESLAVDK 239

Query: 619 IPASDETIYQLLEDFQKTQISNFLAKSFLFNGTKIIRVRIGGEQSTALAMVVRTGFSTTK 678
               D+T                      F+ + + R    GE      +V  TG +T  
Sbjct: 240 -HYGDQT----------------------FSSSTVKR----GE---GFMVVTATGDNTFV 269

Query: 679 GSLLRSMIFPKPSGFKFYEDSFKYIGFMTLIALAGFSISCINFIRLGLAYK----VMILR 734
           G    +++     G   + +    IG + L+      I+ +  +     Y+    V ILR
Sbjct: 270 GR-AAALVNKAAGGQGHFTEVLNGIGIILLV----LVIATLLLVWTACFYRTNGIVRILR 324

Query: 735 -ALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFDKTGTLT 793
             L I  I VP  LPA ++   +   A L KK       + +     ++++C DKTGTLT
Sbjct: 325 YTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLT 384

Query: 794 EDGLDV 799
           ++ L +
Sbjct: 385 KNKLSL 390

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 94/386 (24%), Positives = 137/386 (35%), Gaps = 105/386 (27%)

Query: 913  HPNAESTENKFTENDPHNLLGVIRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPE-VIS 971
            +P A+    K+   + H        F+ VS+ +  +V+  P GE +     KGAP  V+ 
Sbjct: 433  YPKAKDALTKYKVLEFH-------PFDPVSK-KVTAVVESPEGERIV--CVKGAPLFVLK 482

Query: 972  EICNKSTLPA----NYEQILQQYTHNGYRVIACAGKTLPKRTWRFAQKVSREEVESNMEF 1027
             +     +P     NYE  + +    G+R +                 V+R+  E + E 
Sbjct: 483  TVEEDHPIPEDVHENYENKVAELASRGFRALG----------------VARKRGEGHWEI 526

Query: 1028 LGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQIN 1087
            LG +   +  +  T  T++  +  G+R  M TGD V  A    R+ GL T          
Sbjct: 527  LGVMPCMDPPRDDTAQTVSEARHLGLRVKMLTGDAVGIAKETCRQLGLGT---------- 576

Query: 1088 DNMDPNEDLIIWRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYI 1147
             N+   E L +    D             M GS         D F       EV P+   
Sbjct: 577  -NIYNAERLGLGGGGD-------------MPGSELADFVENADGFA------EVFPQ--- 613

Query: 1148 NMVLLKSSIYARMSPDEKHELVGQLQGLDYVVGFCGDGANDCGALKAADVGXXXXXXXXX 1207
                             K+ +V  LQ   Y+V   GDG ND  +LK AD G         
Sbjct: 614  ----------------HKYRVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAVEGATDA 657

Query: 1208 XXXPFTSSVF---EISCILDVIKEGRASLTTSFSCFQYMSLYSAIQFVTVTMLYSRGINL 1264
                    VF    +S I+D +K       TS   F  M  Y       V    +  ++L
Sbjct: 658  ARSA-ADIVFLAPGLSAIIDALK-------TSRQIFHRMYSY-------VVYRIALSLHL 702

Query: 1265 GDFQFLYI-------DLFLIVPIAIF 1283
              F  L+I       D+ LIV IAIF
Sbjct: 703  EIFLGLWIAILDNSLDIDLIVFIAIF 728

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 68/260 (26%), Positives = 117/260 (45%), Gaps = 48/260 (18%)

Query: 965  GAPEVISEICNKSTLPANYEQILQQYTHNGYRVIACAGKTLPKR---TW--RF----AQK 1015
            G+P++I+   N+  +     Q +  +T  G R +  + K +  +   TW  R+    A  
Sbjct: 926  GSPDLIT---NEEYVIERTLQDMDAFTTEGLRTLLYSFKWIGNQEYETWNSRYSAAKAAL 982

Query: 1016 VSREE--------VESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAI 1067
            V+R E        +E ++  LG +  E+KL+      +  L+ AGI+  M TGD   TAI
Sbjct: 983  VNRREQMDTVGEIIERDLTLLGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAI 1042

Query: 1068 SVGRESGLITE-SHVFVPQINDNMDPNEDLIIWRDVD-----DCDLILDGVTLEPMNGSS 1121
            ++G    LI + S V +   ND    ++   I ++++      C +++DG TL       
Sbjct: 1043 NIGYSCRLIHDYSTVIILAPNDENMASKITTITQEIEAGNVAHCVVVIDGATL------- 1095

Query: 1122 DYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSS-IYARMSPDEKHELVGQLQGLD--YV 1178
                         +F+ N  L   +I +     S I  R SP +K  +V +++  D   V
Sbjct: 1096 ------------TIFEGNLTLMTLFIELCTKTDSVICCRSSPSQKALMVTKIRKTDKKLV 1143

Query: 1179 VGFCGDGANDCGALKAADVG 1198
                GDGAND   +++AD+G
Sbjct: 1144 TLAIGDGANDIAMIQSADIG 1163

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 84/187 (44%), Gaps = 26/187 (13%)

Query: 1020 EVESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITE- 1078
            E+E  +  LG    E+KL+   +  +  ++ AGI+  M TGD   TAI++G    LI + 
Sbjct: 1075 EIEDGLNLLGVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCMLIKDY 1134

Query: 1079 SHVFVPQINDNMDPNEDLIIWRDVDD-----CDLILDGVTLEPMNGSSDYTIAVTGDVFR 1133
            S V +    D    ++   + ++VD      C +++DG T+    G+  Y       VF 
Sbjct: 1135 STVVILTTTDENIISKMNAVSQEVDSGNIAHCVVVIDGATMAMFEGNPTYM-----SVFV 1189

Query: 1134 LLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQGLD--YVVGFCGDGANDCGA 1191
             L    +             S I  R SP +K  +V  ++  D   V    GDGAND   
Sbjct: 1190 ELCTKTD-------------SVICCRASPSQKALMVSNIRNTDPNLVTLAIGDGANDIAM 1236

Query: 1192 LKAADVG 1198
            +++AD+G
Sbjct: 1237 IQSADIG 1243

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score = 63.9 bits (154), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 77/315 (24%), Positives = 126/315 (40%), Gaps = 58/315 (18%)

Query: 934  VIRSFEFVSELRRMSVIVK-----PYGENVFWGFTKGAPEVI----SEICNKSTLPANYE 984
            V+   EF S  +RMS I+K     P  E       KGA  VI        N +TL     
Sbjct: 881  VLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLEKTA 940

Query: 985  QILQQYTHNGYRVIACAGKTLPKRTWR------------FAQKVSREE--------VESN 1024
              L++Y   G R +  A + L   TW              A   +REE        +E  
Sbjct: 941  LHLEEYATEGLRTLCLAQREL---TWSEYERWVKTYDVAAASVTNREEELDKVTDVIERE 997

Query: 1025 MEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVP 1084
            +  LG    E++L+     ++A L +AGI+  + TGD V TAI++G    ++      + 
Sbjct: 998  LILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNNDMELLV 1057

Query: 1085 QINDNMDPNEDLIIWRDVDDCDLILDGVTLE-----PMNGSSD---------------YT 1124
                  D  E        D   ++ + VT        M+GS +               + 
Sbjct: 1058 VKASGEDVEE-----FGSDPIQVVNNLVTKYLREKFGMSGSEEELKEAKREHGLPQGNFA 1112

Query: 1125 IAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQG-LDYVVGFCG 1183
            + + GD  ++     E+  +  +     K+ +  R+SP +K  +V  ++  LD +    G
Sbjct: 1113 VIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKKTLDVMTLAIG 1172

Query: 1184 DGANDCGALKAADVG 1198
            DG+ND   +++ADVG
Sbjct: 1173 DGSNDVAMIQSADVG 1187

>Kwal_23.3556
          Length = 1597

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 99/240 (41%), Gaps = 45/240 (18%)

Query: 985  QILQQYTHNGYRVIACAGKTLPKRTWR------FAQKVSREE-----------VESNMEF 1027
            Q ++ ++ +G R +  + K +P   +        A K S E            VE+++  
Sbjct: 962  QAIEDFSTSGLRTLLYSYKWIPSEDYEKWSKKYHAAKTSLENRKEKMHSVGELVETSLHL 1021

Query: 1028 LGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFV---- 1083
            LG    E+KL+      +  ++ AGI+  M TGD   TAI++G    LI +    V    
Sbjct: 1022 LGATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIGYSCNLIHDYSTVVILSA 1081

Query: 1084 --PQINDNMDPNEDLIIWRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEV 1141
                I+  +      I   ++  C +++DG TL                     F++N  
Sbjct: 1082 KDENISSKLTAVSQEIERGNIAHCVVVIDGSTLTT-------------------FESNPT 1122

Query: 1142 LPESYINMVLLKSS-IYARMSPDEKHELVGQLQGLD--YVVGFCGDGANDCGALKAADVG 1198
            L   ++ +     S I  R SP +K  +V  ++  D   V    GDGAND   +++AD+G
Sbjct: 1123 LMSVFVELCTKTDSVICCRASPSQKALMVTHIRNTDKKLVTLAIGDGANDIAMIQSADIG 1182

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 73/171 (42%), Gaps = 29/171 (16%)

Query: 845  FLVSLLTCH-----SLRVVDGELLGDPLDFKMFQFTNWSYAEDFQDFKFHSLNEERNNKS 899
            F++SL  CH     S   V+GE   D ++++       +     +D  +  +N       
Sbjct: 668  FILSLALCHACLPKSSSGVEGE---DCVEYQASSPDELALVTAARDMGYAVMNR------ 718

Query: 900  TLPENAGIAPAVVHPNAESTENKFTENDPH-NLLGVIRSFEFVSELRRMSVIVK-PYGEN 957
                N+ +     +PN    E       PH +   ++ + EF S  +RMSV+V+ P+ EN
Sbjct: 719  ----NSDVLTIKTYPNGFDAE-------PHLDKYEILNNIEFSSHRKRMSVLVRLPHEEN 767

Query: 958  VFWGFTKGAPEVISEICNKSTLPANYEQILQQYTHNGYRVIACAGKTLPKR 1008
                  KGA  VI E  + S L AN ++I++       R  A A   L +R
Sbjct: 768  RILLICKGADNVILERLHNSDL-AN-QKIVELQETTSERKAAEADLVLKQR 816

>Scas_669.3
          Length = 1638

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 82/187 (43%), Gaps = 28/187 (14%)

Query: 1019 EEVESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITE 1078
            EE+E +++ LG    E+KL+   +  +  ++ AGI+  M TGD   TAI++G    LI +
Sbjct: 1048 EEIEQDLQLLGATAIEDKLQEGVSEAIEKIRRAGIKIWMLTGDKRETAINIGYSCKLIYD 1107

Query: 1079 SHVFV------PQINDNMDPNEDLIIWRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVF 1132
                V        I   M+     +   +V  C +I+DG TL                  
Sbjct: 1108 YSTVVILAKGDENIISKMNAISQEVDSGNVAHCVIIIDGSTLA----------------- 1150

Query: 1133 RLLFKNNEVLPESYINMVLLKSS-IYARMSPDEKHELVGQLQ--GLDYVVGFCGDGANDC 1189
              +F+ N  L   +I +     S I  R SP +K  +V  ++    + V    GDGAND 
Sbjct: 1151 --MFEGNPTLMSVFIELCTKTDSVICCRASPSQKSLMVTNIRNSNKNLVTLAIGDGANDI 1208

Query: 1190 GALKAAD 1196
              +++AD
Sbjct: 1209 AMIQSAD 1215

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 86/188 (45%), Gaps = 28/188 (14%)

Query: 1020 EVESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITE- 1078
            ++E  +  LG    E+KL+   +  +  ++ AGI+  M TGD   TAI++G    LI + 
Sbjct: 1015 QIEDELYLLGATAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCKLIHDY 1074

Query: 1079 SHVFVPQINDNMDPNEDLIIWRDVDD-----CDLILDGVTLEPMNGSSDYTIAVTGDVFR 1133
            S V +   +D    ++   I ++VD      C +++DG TL                   
Sbjct: 1075 STVVILTTSDENIISKMNAISQEVDSGNVAHCVIVIDGATLA------------------ 1116

Query: 1134 LLFKNNEVLPESYINMVLLKSSIY-ARMSPDEKHELVGQLQGLD--YVVGFCGDGANDCG 1190
             +F++N  L   +  +     S+   R SP +K  +V  ++  D   V    GDGAND  
Sbjct: 1117 -MFEDNPTLMSVFTELCTKTDSVVCCRASPAQKALMVSNIRNTDKSIVTLAIGDGANDIA 1175

Query: 1191 ALKAADVG 1198
             +++AD+G
Sbjct: 1176 MIQSADIG 1183

>Scas_636.16
          Length = 1554

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 87/334 (26%), Positives = 134/334 (40%), Gaps = 94/334 (28%)

Query: 934  VIRSFEFVSELRRMSVIVK-----PYGENVFWGFTKGAPEVI-SEIC-----NKSTLPAN 982
            ++   EF S  +RMS IVK        E       KGA  VI S +      N  TL   
Sbjct: 815  ILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETLLEK 874

Query: 983  YEQILQQYTHNGYRVIACAGKTLPKRTWRFAQK------------VSREE--------VE 1022
                L+QY   G R + C G+   + +W   Q+              REE        +E
Sbjct: 875  TALHLEQYATEGLRTL-CVGQR--EISWSEYQEWNEKYNIAAASLAGREEELDHVADLIE 931

Query: 1023 SNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLI-TESHV 1081
             ++  LG    E++L+     ++A L +AGI+  + TGD V TAI++G    L+ T+  +
Sbjct: 932  RDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMEL 991

Query: 1082 FVPQIND--------------------------NMDPNEDLIIWRDVD------DCDLIL 1109
             V +                             NM  +E+ +     D      +  +I+
Sbjct: 992  LVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQGEFAIII 1051

Query: 1110 DGVTLEPMNGSSDYTIAVTGDV----FRLLFKNNEVLPESYINMVLLKSSIYARMSPDEK 1165
            DG  L+         IA+TGD     F LL KN              K+ +  R+SP +K
Sbjct: 1052 DGEALK---------IALTGDTMKRKFLLLCKN-------------CKAVLCCRVSPAQK 1089

Query: 1166 HELVGQLQG-LDYVVGFCGDGANDCGALKAADVG 1198
              +V  ++  LD +    GDG+ND   +++ADVG
Sbjct: 1090 AAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVG 1123

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
            Ca-ATPase (P-type) required for ribosome assembly and
            involved in late Golgi function, member of the cation
            transporting (E1-E2) P-type ATPase superfamily [4068 bp,
            1355 aa]
          Length = 1355

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 111/482 (23%), Positives = 181/482 (37%), Gaps = 107/482 (22%)

Query: 772  PTRVNVS------GKIDVMCFDKTGTLTEDGLDVLGVHVAE-------PQGHQNFRFGAL 818
            PT V  S      G+I+ +  DKTGTLT + ++     +A        P+         +
Sbjct: 539  PTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGI 598

Query: 819  ITNVRGLFN-KYSLNDCGSPIDFKS---RNFLVSLLTCHSLRVVDGELLGD-PLDFKMFQ 873
                R   + K  LND   P D  S    +FL  L TCH+   V  E   D  + ++   
Sbjct: 599  EVGYRKFDDLKKKLND---PSDEDSPIINDFLTLLATCHT---VIPEFQSDGSIKYQAAS 652

Query: 874  FTNWSYAEDFQDFKFHSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLLG 933
                +  +   D  +  +  + N+ + L E  G                  E   + LL 
Sbjct: 653  PDEGALVQGGADLGYKFIIRKGNSVTVLLEETG------------------EEKEYQLLN 694

Query: 934  VIRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPEVISEICNKST---LPANYEQILQQY 990
            +    EF S  +RMS I + + +     F KGA  VI E  +      + A     L+ Y
Sbjct: 695  IC---EFNSTRKRMSAIFR-FPDGSIKLFCKGADTVILERLDDEANQYVEATMRH-LEDY 749

Query: 991  THNGYRVIACAGKTLPKRTWRFAQKVSREE-----------------VESNMEFLGFVVF 1033
               G R +  A + + +  +     +  E                  +E N+  +G    
Sbjct: 750  ASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIGATAI 809

Query: 1034 ENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESH---VFVPQINDNM 1090
            E+KL+     T+ +LQ+AGI+  + TGD   TAI++G    L++E     +   +  D+ 
Sbjct: 810  EDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIINEETRDDT 869

Query: 1091 DP---------NEDLIIWRDVDDCDLILDGVT----LEPMNGSSDYTIAVTGDVFRLLFK 1137
            +          NE  +   D+    L++DG +    LEP     DY + V          
Sbjct: 870  ERNLLEKINALNEHQLSTHDMKSLALVIDGKSLGFALEP--ELEDYLLTVAK-------- 919

Query: 1138 NNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQGLDYVVGFC-GDGANDCGALKAAD 1196
                         L K+ I  R+SP +K  +V  ++     +      GAND   ++AA 
Sbjct: 920  -------------LCKAVICCRVSPLQKALVVKMVKRKSSSLLLAIASGANDVSMIQAAH 966

Query: 1197 VG 1198
            VG
Sbjct: 967  VG 968

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 59/247 (23%), Positives = 111/247 (44%), Gaps = 46/247 (18%)

Query: 561 VYRDGFWVQVSSSELVPGDVYEISDPSLSTFPCDSLLLSGDCI--VNESMLTGESVPVSK 618
           V RDG  +++ ++E+VPG++ ++   +++  P D  +++ DC   +++S +TGES+   K
Sbjct: 211 VIRDGQLIEIPANEVVPGEILQLESGTIA--PADGRIVTEDCFLQIDQSAITGESLAAEK 268

Query: 619 IPASDETIYQLLEDFQKTQISNFLAKSFLFNGTKIIRVRIGGEQSTALAMVVRTGFSTTK 678
               DE                      +F+ + +       +   A  +V  TG +T  
Sbjct: 269 -HYGDE----------------------VFSSSTV-------KTGEAFMVVTATGDNTFV 298

Query: 679 GSLLRSMIFPKPSGFK-FYEDSFKYIGFMTLIALAGFSISCINFIRLGLAYK----VMIL 733
           G    + +  + SG +  + +    IG + L+      I+ +  +     Y+    V IL
Sbjct: 299 GR--AAALVGQASGVEGHFTEVLNGIGIILLV----LVIATLLLVWTACFYRTVGIVSIL 352

Query: 734 R-ALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFDKTGTL 792
           R  L I  I VP  LPA ++   +   A L KK       + +     ++++C DKTGTL
Sbjct: 353 RYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTL 412

Query: 793 TEDGLDV 799
           T++ L +
Sbjct: 413 TKNKLSL 419

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 94/386 (24%), Positives = 137/386 (35%), Gaps = 105/386 (27%)

Query: 913  HPNAESTENKFTENDPHNLLGVIRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPE-VIS 971
            +P A+    K+   + H        F+ VS+ +  +V+  P GE +     KGAP  V+ 
Sbjct: 462  YPKAKDALTKYKVLEFH-------PFDPVSK-KVTAVVESPEGERIV--CVKGAPLFVLK 511

Query: 972  EICNKSTLPA----NYEQILQQYTHNGYRVIACAGKTLPKRTWRFAQKVSREEVESNMEF 1027
             +     +P     NYE  + +    G+R +                 V+R+  E + E 
Sbjct: 512  TVEEDHPIPEDVHENYENKVAELASRGFRALG----------------VARKRGEGHWEI 555

Query: 1028 LGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQIN 1087
            LG +   +  +  T  T+   ++ G+R  M TGD V  A    R+ GL T          
Sbjct: 556  LGVMPCMDPPRDDTAQTINEARNLGLRIKMLTGDAVGIAKETCRQLGLGT---------- 605

Query: 1088 DNMDPNEDLIIWRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYI 1147
             N+   E L +    D             M GS         D F       EV P+   
Sbjct: 606  -NIYNAERLGLGGGGD-------------MPGSELADFVENADGFA------EVFPQ--- 642

Query: 1148 NMVLLKSSIYARMSPDEKHELVGQLQGLDYVVGFCGDGANDCGALKAADVGXXXXXXXXX 1207
                             K+ +V  LQ   Y+V   GDG ND  +LK AD G         
Sbjct: 643  ----------------HKYRVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAVEGATDA 686

Query: 1208 XXXPFTSSVF---EISCILDVIKEGRASLTTSFSCFQYMSLYSAIQFVTVTMLYSRGINL 1264
                    VF    +S I+D +K       TS   F  M  Y       V    +  ++L
Sbjct: 687  ARSA-ADIVFLAPGLSAIIDALK-------TSRQIFHRMYSY-------VVYRIALSLHL 731

Query: 1265 GDFQFLYI-------DLFLIVPIAIF 1283
              F  L+I       D+ LIV IAIF
Sbjct: 732  EIFLGLWIAILNNSLDINLIVFIAIF 757

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 106/244 (43%), Gaps = 40/244 (16%)

Query: 561 VYRDGFWVQVSSSELVPGDVYEISDPSLSTFPCDSLLLSGDCI--VNESMLTGESVPVSK 618
           V RDG  V+V S+E+VPGD+ ++ D  +   P D  L++ DC   +++S +TGES+ V K
Sbjct: 163 VIRDGNLVEVPSNEVVPGDILQLEDGVV--IPADGRLVTEDCFIQIDQSAITGESLAVDK 220

Query: 619 IPASDETIYQLLEDFQKTQISNFLAKSFLFNGTKIIRVRIGGEQSTALAMVVRTGFSTTK 678
                         F  +  S+   K                 +  A  +V  TG ST  
Sbjct: 221 -------------RFGDSTFSSSTVK-----------------RGEAFMIVTATGDSTFV 250

Query: 679 GSLLRSMIFPKPSGFKFYEDSFKYIGFMTLIALAGFSIS--CINFIRLGLAYKVMILRAL 736
           G     +     +G   + +    IG + LI +    +     +F R     ++  LR  
Sbjct: 251 GRAAALVNK-AAAGSGHFTEVLNGIGTILLILVIVTLLLVWVASFYRTNKIVRI--LRYT 307

Query: 737 DIITIV-VPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFDKTGTLTED 795
             ITIV VP  LPA ++   +   A L KK       + +     ++++C DKTGTLT++
Sbjct: 308 LAITIVGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKN 367

Query: 796 GLDV 799
            L +
Sbjct: 368 KLSL 371

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 89/384 (23%), Positives = 138/384 (35%), Gaps = 97/384 (25%)

Query: 911  VVHPNAESTENKFTENDPHNLLGVIRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPE-V 969
            + +P A++   K+   + H        F+ VS+ +  +++  P GE +     KGAP  V
Sbjct: 412  ISYPRAKAALTKYKLLEFH-------PFDPVSK-KVTAIVESPEGERII--CVKGAPLFV 461

Query: 970  ISEICNKSTLPA----NYEQILQQYTHNGYRVIACAGKTLPKRTWRFAQKVSREEVESNM 1025
            +  +  +  +P     NYE  + +    G+R +                 V+R+  E + 
Sbjct: 462  LKTVEEEHPIPEDVRENYENKVAELASRGFRALG----------------VARKRGEGHW 505

Query: 1026 EFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQ 1085
            E LG +   +  +  T  T+   +  G+R  M TGD V  A    R+ GL T        
Sbjct: 506  EILGVMPCMDPPRDDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLGLGT-------- 557

Query: 1086 INDNMDPNEDLIIWRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPES 1145
               N+   E L +    D             M GS         D F       EV P+ 
Sbjct: 558  ---NIYNAERLGLGGGGD-------------MPGSELADFVENADGF------AEVFPQ- 594

Query: 1146 YINMVLLKSSIYARMSPDEKHELVGQLQGLDYVVGFCGDGANDCGALKAADVGXXXXXXX 1205
                               K+ +V  LQ   Y+V   GDG ND  +LK AD G       
Sbjct: 595  ------------------HKYNVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIAVEGAT 636

Query: 1206 XXXXXPFTSSVF---EISCILDVIKEGRASLTTSFSCFQY---MSLYSAIQFVTVTMLYS 1259
                      VF    +S I+D +K  R      +S   Y   +SL+  I       + +
Sbjct: 637  DAARSA-ADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIFLGLWIAILN 695

Query: 1260 RGINLGDFQFLYIDLFLIVPIAIF 1283
            R +N+           L+V IAIF
Sbjct: 696  RSLNID----------LVVFIAIF 709

>Scas_710.41
          Length = 904

 Score = 57.8 bits (138), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 64/267 (23%), Positives = 112/267 (41%), Gaps = 36/267 (13%)

Query: 560 RVYRDGFWVQVSSSELVPGDVYEISDPSLSTFPCDSLLLSGDCI--VNESMLTGESVPVS 617
           RV RDG   ++ ++E+VPGD+ E+ + ++   P D  L++ +    V++S +TGES+ V 
Sbjct: 168 RVIRDGTLQEIPANEIVPGDILELDEGTI--IPADGRLVTENRFLQVDQSAITGESLAVD 225

Query: 618 KIPASDETIYQLLEDFQKTQISNFLAKSFLFNGTKIIRVRIGGEQSTALAMVVRTGFSTT 677
           K             ++     S+   K+                  T++ +V  TG +T 
Sbjct: 226 K-------------NYGDVTFSSSTVKT-----------------GTSVMVVTATGDNTF 255

Query: 678 KGSLLRSMIFPKPSGFKFYEDSFKYIGFMTLIALAGFSISCINFIRLGLAYKVMILR-AL 736
            G    +++     G   + D    IG + L+ +    +             VMILR  L
Sbjct: 256 VGRA-AALVGEASGGQGHFTDILNDIGTILLVLVIITLLLVWTACFYRTDGIVMILRFTL 314

Query: 737 DIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFDKTGTLTEDG 796
            I  I VP  LPA ++   +   A L KK       + +     ++++C DKTGTLT++ 
Sbjct: 315 GITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNK 374

Query: 797 LDVLGVHVAEPQGHQNFRFGALITNVR 823
           L +   +  E     +    A +   R
Sbjct: 375 LSLHEPYTVEGVSADDLMLTACLAATR 401

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 63/148 (42%), Gaps = 17/148 (11%)

Query: 1142 LPESYINMVLLKSSIYARMSPDEKHELVGQLQGLDYVVGFCGDGANDCGALKAADVGXXX 1201
            +P S +   +  +  +A + P  K+++V  LQ   Y+V   GDG ND  +LK AD G   
Sbjct: 579  MPGSELADFVENADGFAEVFPQHKYKVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAV 638

Query: 1202 XXXXXXXXXPFTSSVF---EISCILDVIKEGRASLTTSFSCFQY---MSLYSAIQFVTVT 1255
                          VF    +S I+D +K  R      +S   Y   +SL+  I F    
Sbjct: 639  EGATDAARSA-ADIVFLAPGLSAIIDGLKTSRQIFHRMYSYVVYRIALSLHLEIFFGLWI 697

Query: 1256 MLYSRGINLGDFQFLYIDLFLIVPIAIF 1283
             + +R +N+           LIV IAIF
Sbjct: 698  AILNRSLNIE----------LIVFIAIF 715

 Score = 37.7 bits (86), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 58/137 (42%), Gaps = 24/137 (17%)

Query: 945  RRMSVIVK-PYGENVFWGFTKGAPE-VISEICNKSTLPA----NYEQILQQYTHNGYRVI 998
            ++++ +VK P GE +     KGAP  V+  +     +P     NYE  + +    G+R +
Sbjct: 443  KKVTAVVKSPEGETIT--CVKGAPLFVLKTVEEDHPVPEDVHENYENKVAELASRGFRSL 500

Query: 999  ACAGKTLPKRTWRFAQKVSREEVESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMC 1058
                             V+R+  E   E LG +   +  +  T  T+A  +  G+R  M 
Sbjct: 501  G----------------VARKRGEGYWEILGVMPCMDPPRDDTARTIAEARTLGLRVKML 544

Query: 1059 TGDNVLTAISVGRESGL 1075
            TGD V  A    R+ GL
Sbjct: 545  TGDAVGIAKETSRQLGL 561

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 108/251 (43%), Gaps = 54/251 (21%)

Query: 561 VYRDGFWVQVSSSELVPGDVYEISDPSLSTFPCDSLLLSGDCIV--NESMLTGESVPVSK 618
           V RDG  V++ ++E+VPGD+ ++ D  +   P D  +++  C V  ++S +TGES+ V K
Sbjct: 163 VIRDGSLVEIPANEVVPGDILQLEDGVI--IPADGRIVTEGCFVQIDQSAITGESLAVDK 220

Query: 619 IPASDETIYQLLEDFQKTQISNFLAKSFLFNGTKIIRVRIGGEQSTALAMVVRTGFSTTK 678
               D T                      F+ + + R    GE      +V  TG ST  
Sbjct: 221 -RYGDAT----------------------FSSSTVKR----GE---GFMIVTATGDSTFV 250

Query: 679 GSLLRSMIFPKPSGFKFYEDSFKYIGFMTLIALAGFSISCINFIRLGLAYKVMILRALDI 738
           G    +++    +G   + +    IG + LI +    +           Y     R++DI
Sbjct: 251 GR-AAALVNKASAGSGHFTEVLNGIGTILLILVILTLLV---------VYVACFYRSIDI 300

Query: 739 ITIV----------VPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFDK 788
           +TI+          VP  LPA ++   +   A L KK       + +     ++++C DK
Sbjct: 301 VTILRYTLAITVVGVPVGLPAVVTTTMAVGAAYLAKKKAIVQKLSAIESLAGVEILCSDK 360

Query: 789 TGTLTEDGLDV 799
           TGTLT++ L +
Sbjct: 361 TGTLTKNKLSL 371

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 69/291 (23%), Positives = 105/291 (36%), Gaps = 80/291 (27%)

Query: 913  HPNAESTENKFTENDPHNLLGVIRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPEVISE 972
            +P A++   K+   + H        F+ VS+ +  +++  P GE +     KGAP  + +
Sbjct: 414  YPRAKAALTKYKVLEFH-------PFDPVSK-KVTAIVESPEGERIV--CVKGAPLFVLK 463

Query: 973  ICNKSTL-----PANYEQILQQYTHNGYRVIACAGKTLPKRTWRFAQKVSREEVESNMEF 1027
               ++ L       NYE  + +    GYR +                 V+R+  E + E 
Sbjct: 464  TVEENHLIPEDVKENYENKVAELASRGYRALG----------------VARKRGEGHWEI 507

Query: 1028 LGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQIN 1087
            LG +   +  +  T  T+   +  G+R  M TGD V  A    R+ GL T          
Sbjct: 508  LGVMPCMDPPRDDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLGLGT---------- 557

Query: 1088 DNMDPNEDLIIWRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYI 1147
             N+   E L +    D             M GS         D F       EV P+   
Sbjct: 558  -NIYNAERLGLGGGGD-------------MPGSELADFVENADGF------AEVFPQ--- 594

Query: 1148 NMVLLKSSIYARMSPDEKHELVGQLQGLDYVVGFCGDGANDCGALKAADVG 1198
                             K+ +V  LQ   Y+V   GDG ND  +LK AD G
Sbjct: 595  ----------------HKYNVVEILQQRGYLVAMTGDGVNDAPSLKKADTG 629

>Scas_688.1
          Length = 913

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 83/351 (23%), Positives = 123/351 (35%), Gaps = 97/351 (27%)

Query: 948  SVIVKPYGENVFWGFTKGAPE-VISEICNKSTLPA----NYEQILQQYTHNGYRVIACAG 1002
            +V+  P GE +     KGAP  V+  +     +P     NYE  + +    G+R +    
Sbjct: 455  AVVESPEGERII--CVKGAPLFVLKTVEEDHPIPEDIHENYENKVAELASRGFRALG--- 509

Query: 1003 KTLPKRTWRFAQKVSREEVESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDN 1062
                         V+R+  E + E LG +   +  +  T  T+A  +  G+R  M TGD 
Sbjct: 510  -------------VARKRGEGHWEILGVMPCMDPPRDDTGETVAEARRLGLRVKMLTGDA 556

Query: 1063 VLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLILDGVTLEPMNGSSD 1122
            V  A    R+ GL T  +                                          
Sbjct: 557  VGIAKETCRQLGLGTNVY------------------------------------------ 574

Query: 1123 YTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQGLDYVVGFC 1182
                   +  RL       +P S +   +  +  +A + P +K+ +V  LQ   Y+V   
Sbjct: 575  -------NAERLGLSGGGDMPGSELADFVENADGFAEVFPQDKYRVVEILQTRGYLVAMT 627

Query: 1183 GDGANDCGALKAADVGXXXXXXXXXXXXPFTSSVF---EISCILDVIKEGRASLTTSFSC 1239
            GDG ND  +LK AD G                 VF    +S I+D +K       TS   
Sbjct: 628  GDGVNDAPSLKKADTGIAVEGATDAARSA-ADIVFLAPGLSAIIDALK-------TSRQI 679

Query: 1240 FQYMSLYSAIQFVTVTMLYSRGINLGDFQFLYI-------DLFLIVPIAIF 1283
            F  M  Y       V    +  I+L  F  L+I       D+ LIV IAIF
Sbjct: 680  FHRMYSY-------VVYRIALSIHLEIFLGLWIAILNNSLDINLIVFIAIF 723

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 38/60 (63%), Gaps = 4/60 (6%)

Query: 561 VYRDGFWVQVSSSELVPGDVYEISDPSLSTFPCDSLLLSGDCIV--NESMLTGESVPVSK 618
           V RDG  V+V ++E+VPGD+ ++ D  +   P D  +++ DC V  ++S +TGES+   K
Sbjct: 177 VIRDGQLVEVPANEVVPGDILQLEDGVI--IPADGRIVTEDCFVQIDQSAITGESLAADK 234

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 730 VMILRALDIITIV-VPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFDK 788
           V ILR    ITIV VP  LPA ++   +   A L KK       + +     ++++C DK
Sbjct: 315 VRILRYTLGITIVGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDK 374

Query: 789 TGTLTEDGLDV 799
           TGTLT++ L +
Sbjct: 375 TGTLTKNKLSL 385

>Scas_89.1
          Length = 271

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 67/278 (24%), Positives = 114/278 (41%), Gaps = 51/278 (18%)

Query: 1016 VSREEVESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGL 1075
            V ++ +E N+E LG    E+KL+     ++  L++AG++  M TGD V TA  V   + L
Sbjct: 26   VIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKL 85

Query: 1076 ITESHVFVPQINDNMDPNEDLIIWRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLL 1135
            I+    +V  +     P             +  L+ +    +N SS   + + G+   + 
Sbjct: 86   ISRGQ-YVHTVTKLSRP-------------EGALNALEYLKINKSS--CLLIDGESLGMF 129

Query: 1136 FKNNEVLPESYINMVL-LKSSIYARMSPDEKHE---LVGQLQGLDYVVGFCGDGANDCGA 1191
                    + + ++V+ L + I  R +P +K +   L+ ++ G    V   GDG ND   
Sbjct: 130  LT---YYKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITG--KRVCCIGDGGNDVSM 184

Query: 1192 LKAADVGXXXXXXXXXXXXPFTSSVFEISCILDVIKEGR-ASLTTSFSCFQYMSLYSAIQ 1250
            ++ ADVG                          V KEG+ ASL   FS  Q+  L   + 
Sbjct: 185  IQCADVGVGI-----------------------VGKEGKQASLAADFSVTQFCHLTKLLL 221

Query: 1251 FVTVTMLYSRGINLGDFQFLYIDLFLIVPIAIFMSWSK 1288
            +      Y R   L  F  ++  L + V  A++   SK
Sbjct: 222  WHGRNS-YKRSAKLAQF-VIHRGLIISVCQAVYSVCSK 257

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 53/96 (55%), Gaps = 13/96 (13%)

Query: 525 ACIFIISMLSIIDTLVETKKTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVPGDVYEIS 584
           AC+  I        + E KKT   LA V+       V RDG  V+V ++E+VPGD+ ++ 
Sbjct: 139 ACVGFIQEFQAGSIVDELKKT---LANVA------VVIRDGQLVEVPANEVVPGDILQLE 189

Query: 585 DPSLSTFPCDSLLLSGDCI--VNESMLTGESVPVSK 618
           D ++   P D  L++ +C   V++S +TGES+ V K
Sbjct: 190 DGTI--IPADGRLVTENCFLQVDQSAITGESLAVDK 223

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 70/291 (24%), Positives = 105/291 (36%), Gaps = 80/291 (27%)

Query: 913  HPNAESTENKFTENDPHNLLGVIRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPE-VIS 971
            +P A+    K+   + H        F+ VS+ +  +V+  P GE +     KGAP  V+ 
Sbjct: 417  YPKAKDALTKYKVIEFH-------PFDPVSK-KVTAVVESPEGERIV--CVKGAPLFVLK 466

Query: 972  EICNKSTLPA----NYEQILQQYTHNGYRVIACAGKTLPKRTWRFAQKVSREEVESNMEF 1027
             +     +P     NYE  + +    G+R +                 V+R+  E + E 
Sbjct: 467  TVEEDHPIPEDVHENYENKVAELASRGFRALG----------------VARKRGEGHWEI 510

Query: 1028 LGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQIN 1087
            LG +   +  +  T  T+   +  G+R  M TGD V  A    R+ GL T          
Sbjct: 511  LGVMPCMDPPRDDTAETVNEARRLGLRVKMLTGDAVGIAKETCRQLGLGT---------- 560

Query: 1088 DNMDPNEDLIIWRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYI 1147
             N+   E L +    D             M GS         D F       EV P+   
Sbjct: 561  -NIYNAERLGLGGGGD-------------MPGSELADFVENADGFA------EVFPQ--- 597

Query: 1148 NMVLLKSSIYARMSPDEKHELVGQLQGLDYVVGFCGDGANDCGALKAADVG 1198
                             K+++V  LQ   Y+V   GDG ND  +LK AD G
Sbjct: 598  ----------------HKYKVVEILQNRGYLVAMTGDGVNDAPSLKKADTG 632

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 730 VMILR-ALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFDK 788
           V ILR  L I  I VP  LPA ++   +   A L KK       + +     ++++C DK
Sbjct: 304 VKILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDK 363

Query: 789 TGTLTEDGLDV 799
           TGTLT++ L +
Sbjct: 364 TGTLTKNKLSL 374

>KLLA0D04092g complement(344666..348124) some similarities with
           sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
           copper-transporting ATPase P16.2.f2.1, hypothetical
           start
          Length = 1152

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 77/303 (25%), Positives = 127/303 (41%), Gaps = 69/303 (22%)

Query: 522 YYAACIFIISMLSI---IDTLVETKKTSQRLAEVSHSHCEVRV--------YRDGFWVQV 570
           Y+ + +F+   L I   +++L +TK T+  ++ +S    E           Y++   VQ+
Sbjct: 511 YFDSVVFLTFFLLIGRLLESLAKTK-TASAISNLSSFKQETATLMQKVGDQYQEVETVQI 569

Query: 571 SSSELVPGDVYEISDPSLSTFPCDSLLLSGDCIVNESMLTGESVPVSKIPASDETIYQLL 630
              EL  GD  +IS P  S  P DS++L G+   +ES LTGES+P+ ++        Q+ 
Sbjct: 570 QYLEL--GDYIKIS-PGQSP-PLDSIILEGETEFDESALTGESIPMVRLRGD-----QIF 620

Query: 631 EDFQKTQISNFLAKSFLFNGTKIIRVRIGGEQSTALAMVVRTGFSTTKGSLLRSMIFPKP 690
                   S+ +AK   F+G  +            L  +V T      G L R+ I    
Sbjct: 621 AGTVNVGSSSVIAKVSSFDGESL------------LDQIVNT---VRDGQLNRAPIERLA 665

Query: 691 SGFKFYEDSFKYIGFMTLIALAGFSISCINFIRLGLAYKV---------------MILRA 735
                Y     ++  +  +A+    ++ + ++ LGL+ K+                +  A
Sbjct: 666 DILTGY-----FVPIIIFLAI----LTWVVWLSLGLSGKLPEHYLDTDIGGWPVWSLEFA 716

Query: 736 LDIITIVVPP----ALPATLSIGASFAIARLKKKGIFCIAPTRVNVSG-KIDVMCFDKTG 790
           + +  I  P     A P  L +G+  A     K GI C         G KI ++CFDKTG
Sbjct: 717 ISVFVIACPCGIGLAAPTALFVGSGMA----AKFGILCRGGGAAFQEGCKIAIVCFDKTG 772

Query: 791 TLT 793
           TLT
Sbjct: 773 TLT 775

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 26/51 (50%), Gaps = 7/51 (13%)

Query: 1155 SIYARMSPDEKHELVGQLQ-------GLDYVVGFCGDGANDCGALKAADVG 1198
            ++ A + P+EK   V  +Q       G   VV   GDG ND  AL AADVG
Sbjct: 971  NVIAEVLPEEKAAKVKWIQHNNIGANGHHKVVAMVGDGINDAPALAAADVG 1021

>Kwal_47.17522
          Length = 899

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 91/384 (23%), Positives = 137/384 (35%), Gaps = 97/384 (25%)

Query: 911  VVHPNAESTENKFTENDPHNLLGVIRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPE-V 969
            + +P A++   K+   D H        F+ VS+ +  +V+  P GE +     KGAP  V
Sbjct: 412  IQYPRAKNALTKYKVLDFH-------PFDPVSK-KVTAVVESPEGERII--CVKGAPLFV 461

Query: 970  ISEICNKSTLPA----NYEQILQQYTHNGYRVIACAGKTLPKRTWRFAQKVSREEVESNM 1025
            +  +     +P     NYE  + +    G+R +                 V+R+  E + 
Sbjct: 462  LKTVEEDHPIPEDVHENYENKVAELASRGFRALG----------------VARKRGEGHW 505

Query: 1026 EFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQ 1085
            E LG +   +  +  T  T+   +  G+R  M TGD V  A    R+ GL T        
Sbjct: 506  EILGVMPCMDPPRDDTAQTVHEARRLGLRVKMLTGDAVGIAKETCRQLGLGT-------- 557

Query: 1086 INDNMDPNEDLIIWRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPES 1145
               N+   E L +    D             M GS         D F       EV P+ 
Sbjct: 558  ---NIYNAERLGLGGGGD-------------MPGSELADFVENADGFA------EVFPQ- 594

Query: 1146 YINMVLLKSSIYARMSPDEKHELVGQLQGLDYVVGFCGDGANDCGALKAADVGXXXXXXX 1205
                               K+ +V  LQ   Y+V   GDG ND  +LK AD G       
Sbjct: 595  ------------------HKYSVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIAVEGAT 636

Query: 1206 XXXXXPFTSSVF---EISCILDVIKEGRASLTTSFSCFQY---MSLYSAIQFVTVTMLYS 1259
                      VF    +S I+D +K  R      +S   Y   +SL+  I       + +
Sbjct: 637  DAARSA-ADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIFLGLWIAILN 695

Query: 1260 RGINLGDFQFLYIDLFLIVPIAIF 1283
            + +N+           LIV IAIF
Sbjct: 696  QSLNID----------LIVFIAIF 709

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 38/60 (63%), Gaps = 4/60 (6%)

Query: 561 VYRDGFWVQVSSSELVPGDVYEISDPSLSTFPCDSLLLSGDCI--VNESMLTGESVPVSK 618
           V RDG  V++ ++E+VPGD+ ++ D  +     D  L++ +C   +++S +TGES+ V K
Sbjct: 163 VVRDGNLVEIPANEVVPGDIMQLEDGVV--ICADGRLVTEECFLQIDQSAITGESLAVDK 220

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 1/69 (1%)

Query: 730 VMILR-ALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFDK 788
           V ILR  L I  I VP  LPA ++   +   A L KK       + +     ++++C DK
Sbjct: 301 VRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDK 360

Query: 789 TGTLTEDGL 797
           TGTLT++ L
Sbjct: 361 TGTLTKNKL 369

>Scas_569.0d
          Length = 468

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 51/119 (42%), Gaps = 10/119 (8%)

Query: 1115 EPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQG 1174
            + M  +S   + +TG  F      +E+ PE   N+ +L   I AR SP  K  ++  L  
Sbjct: 70   DDMKSNSTENMVMTGSQF------DELTPEQIDNLPVLPLVI-ARCSPQTKVRMIEALHR 122

Query: 1175 LDYVVGFCGDGANDCGALKAADVGXXXXXXXXXXXXPFTSSVF---EISCILDVIKEGR 1230
             D      GDG ND  +LK A+VG              +  V      + IL+ I+EGR
Sbjct: 123  RDKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAIEEGR 181

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 3/82 (3%)

Query: 541 ETKKTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVPGDVYEISDPSLSTFPCDSLLLSG 600
           ET     +L  ++ S C + V  DG   ++S   L P D+ E+  P +   P D +++  
Sbjct: 393 ETSTAMSKLISLTPSSCSI-VLPDGSTREISVELLQPNDIVEVV-PGMK-IPADGVVIRN 449

Query: 601 DCIVNESMLTGESVPVSKIPAS 622
           +  V+ES++TGES+ V KI  S
Sbjct: 450 ETEVDESLITGESMLVEKIVGS 471

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 10/74 (13%)

Query: 1127 VTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQ--GLDYVVGFCGD 1184
            VTGD  +   K  + L  S        + +++ ++P++K ++V QLQ  G + V  F GD
Sbjct: 772  VTGDAHQSALKVAQQLGIS-------ANDVFSEVTPEQKRDIVIQLQNNGTERV-AFVGD 823

Query: 1185 GANDCGALKAADVG 1198
            G ND  AL  AD+G
Sbjct: 824  GINDSPALVEADLG 837

>ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH]
           (511968..514400) [2433 bp, 810 aa]
          Length = 810

 Score = 38.5 bits (88), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 59/128 (46%), Gaps = 14/128 (10%)

Query: 505 YVFQIFSIL--LWL--ADNYYYYAACIFIISMLSIIDTLVETKKTSQ------RLAEVSH 554
           Y+F + +I   +WL  AD    +     ++     +  L+E++  ++      R+   + 
Sbjct: 192 YLFSVATICRGVWLGSADPPSTFLDTTVMLVAFICVGKLLESRARARAADSLARMVSSAP 251

Query: 555 SHCEVRVYRDGFWVQVSSSELVPGDVYEISDPSLSTFPCDSLLLSGDCIVNESMLTGESV 614
           S C +R    G   +V    L  GDV  +  P  +  P D  +L G+  V+ES++TGES 
Sbjct: 252 SMCTIR--ESGSDREVEVELLQAGDVV-VMRPG-TKLPADGTVLEGEAEVDESLMTGEST 307

Query: 615 PVSKIPAS 622
            V K P S
Sbjct: 308 LVPKYPGS 315

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
            Saccharomyces cerevisiae YDR270w CCC2, start by
            similarity
          Length = 1012

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 38/72 (52%), Gaps = 7/72 (9%)

Query: 1127 VTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQGLDYVVGFCGDGA 1186
            VTGD  +   K  E++        +  +++Y+ ++PD K + V  L+    V+ F GDG 
Sbjct: 786  VTGDTHKSAMKVAEMVD-------IPPNNVYSEVTPDGKSQTVEYLREEGRVIAFIGDGI 838

Query: 1187 NDCGALKAADVG 1198
            ND  AL  +D+G
Sbjct: 839  NDSLALVTSDLG 850

>Kwal_55.21575
          Length = 989

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 8/73 (10%)

Query: 1127 VTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQ-GLDYVVGFCGDG 1185
            VTGD       N++   +  + + +  +++Y+ ++P +K++LV  LQ G    V F GDG
Sbjct: 770  VTGD-------NHKSAMKVALELGIEANNVYSELTPADKNQLVQDLQDGGRKNVAFIGDG 822

Query: 1186 ANDCGALKAADVG 1198
             ND  AL  +D+G
Sbjct: 823  INDSPALVTSDLG 835

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 60/124 (48%), Gaps = 14/124 (11%)

Query: 505 YVFQIFSILLWLADNYYYYAACIFIISMLSI----IDTLVETKKTSQ------RLAEVSH 554
           + F ++SI + +A         IF  S++ I    +  L+E K  S+      +L  ++ 
Sbjct: 349 FAFSLYSIAMNVAKKSERMPNVIFDASVMLIGFISVGKLLENKAKSKTNNSLSKLMSLAP 408

Query: 555 SHCEVRVYRDGFWVQVSSSELVPGDVYEISDPSLSTFPCDSLLLSGDCIVNESMLTGESV 614
           S C   +  +G   ++    L  GD  EI  P  +  P D +++ G+  V+ES++TGES+
Sbjct: 409 STC--TIIENGKAREIPVEFLQVGDTVEIK-PG-AKIPTDGVIIEGESEVDESLITGESL 464

Query: 615 PVSK 618
            V +
Sbjct: 465 MVPR 468

>YBR295W (PCA1) [472] chr2 (792805..796455) P-type
           copper-transporting ATPase, involved in resistance to
           cadmium [3651 bp, 1216 aa]
          Length = 1216

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 58/251 (23%), Positives = 105/251 (41%), Gaps = 41/251 (16%)

Query: 559 VRVYRDGFWVQVSSSELVPGDVYEISDPSLSTFPCDSLLLSGDCIVNESMLTGESVPVSK 618
           + V + G   +++   L  GD++++   S    P D  ++SG   V+E+++TGES+PV K
Sbjct: 698 ILVDKTGKETEINIRLLQYGDIFKVLPDS--RIPTDGTVISGSSEVDEALITGESMPVPK 755

Query: 619 IPASDETIYQLLEDFQKTQISNFLAKSFLFNGTKIIRVRIGGEQSTALAMVVRTGFSTTK 678
                           K Q S  +A S   NGT  + V+        L+ +      +T 
Sbjct: 756 ----------------KCQ-SIVVAGS--VNGTGTLFVK--------LSKLPGNNTISTI 788

Query: 679 GSLLRSMIFPKPSGFKFYEDSFKYIGFMTLIALAGFSISCINFIRLGL---------AYK 729
            +++      KP   +   D        T+I +   +  C+ +I +G+         A  
Sbjct: 789 ATMVDEAKLTKPK-IQNIADKIASYFVPTIIGITVVTF-CV-WIAVGIRVEKQSRSDAVI 845

Query: 730 VMILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFDKT 789
             I+ A+ ++ +  P  +   + I    A     K+G+   +   + V+     + FDKT
Sbjct: 846 QAIIYAITVLIVSCPCVIGLAVPIVFVIASGVAAKRGVIFKSAESIEVAHNTSHVVFDKT 905

Query: 790 GTLTEDGLDVL 800
           GTLTE  L V+
Sbjct: 906 GTLTEGKLTVV 916

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129)
           [3702 bp, 1233 aa]
          Length = 1233

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 81/210 (38%), Gaps = 31/210 (14%)

Query: 594 DSLLLSGDCIVNESMLTGESVPVSKIPASDETIYQLLEDFQKTQISNFLAKSFLFNGTKI 653
           D+L++ G+   +ES LTGES P++  P       Q+            +AK     G  +
Sbjct: 681 DALIVQGETEFDESSLTGESRPITHFPGD-----QIFAGTVNVGQCAVIAKVSTAPGNSL 735

Query: 654 I-----RVRIGGEQSTALAMV--VRTGFSTTKGSLLRSMIFPKPSGFKFYEDSFKYIGFM 706
           +      VR G  +   +  +  V TG+      LL  + +            +  +GF 
Sbjct: 736 LDHVISAVRDGQLRGAPIERIADVLTGYFVPFIVLLAILTWA----------IWLILGFA 785

Query: 707 TLIALAGF--SISCINFIRLGLAYKVMILRALDIITIVVPPALPATLSIGASFAIARLKK 764
            +++      S+    F  L  A  V ++     I +  P AL    +I A + I     
Sbjct: 786 GVLSQEKLDGSVGGWPFWSLEFAIAVFVIACPCGIGLAAPTALFVGANIAAKYGILARGG 845

Query: 765 KGIFCIAPTRVNVSGKIDVMCFDKTGTLTE 794
              F        +  K+  +CFDKTGTLT+
Sbjct: 846 SAAF-------QMGSKVTTVCFDKTGTLTK 868

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 25/46 (54%)

Query: 1030 FVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGL 1075
            F+   ++L+P     + +L + GI   M +GDN L A +V  E G+
Sbjct: 1013 FLAVRDELRPEAKEVVQALHERGIECWMISGDNSLAANAVALEVGI 1058

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 19/35 (54%)

Query: 1164 EKHELVGQLQGLDYVVGFCGDGANDCGALKAADVG 1198
            EK + + +  G    +   GDG ND  A+ AADVG
Sbjct: 1072 EKIQWIRETSGQGVAIAMVGDGMNDAPAIAAADVG 1106

>Scas_615.9
          Length = 942

 Score = 34.7 bits (78), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 66/137 (48%), Gaps = 22/137 (16%)

Query: 505 YVFQIFSILLWLADNY----------YYYAACIFIISMLSIIDTLVETKKTSQ------R 548
           Y+F IFSI+  +  +             +   + +I+ +S    L+E K  +Q      +
Sbjct: 291 YLFSIFSIIHTMVLSRGNEESPMLPNVVFDTSVMLIAFISF-GKLLENKAKAQTSSSLSK 349

Query: 549 LAEVSHSHCEVRVYRDGFW---VQVSSSELVPGDVYEISDPSLSTFPCDSLLLSGDCIVN 605
           L +++ S C +   ++      +++ ++ L   D+ EI  P +   P D +++ G+  ++
Sbjct: 350 LIQLTPSKCIILQDKNNIQSSHIEIETNLLQRNDIIEIK-PGMK-IPADGIIIQGESEID 407

Query: 606 ESMLTGESVPVSKIPAS 622
           ES++TGES+ V K   S
Sbjct: 408 ESLMTGESILVHKQKGS 424

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 3/47 (6%)

Query: 1154 SSIYARMSPDEKHELVGQLQGLDYV--VGFCGDGANDCGALKAADVG 1198
            +++Y+ ++P  K E+V  LQ  D V  V F GDG ND   L  +D+G
Sbjct: 745  NNVYSGVTPSGKCEIVESLQA-DSVGGVAFVGDGINDSPVLVTSDIG 790

>Sklu_2442.10 YCL014W, Contig c2442 14442-19337
          Length = 1631

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 7/84 (8%)

Query: 1318 ILVFQATPWLVVQAMRWYQAPVVGGDDAVQSSDNT---VLFFFSNFQYVLTAIVLSVGPP 1374
            IL   A  W V    +W +  VVG  DAV ++DNT   ++  FS++   L  I    G  
Sbjct: 500  ILTELANGWPVELQYKWLKRRVVGVFDAVDANDNTKRDIIVIFSDYVVFLNVI---DGDL 556

Query: 1375 YREPMSKNLGFITDVVISIILNVV 1398
            Y    S N   I+D++++ ++N V
Sbjct: 557  YYTKDS-NRPLISDILMNSLINEV 579

>CAGL0K07964g 790076..791167 highly similar to sp|P29055 Saccharomyces
            cerevisiae YPR086w SUA7 Transcription initiation factor
            IIB, hypothetical start
          Length = 363

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 28/40 (70%), Gaps = 3/40 (7%)

Query: 1386 ITDVVISIILNVVLMMVPVDST-LGKVFQLTD--ISSGFK 1422
            IT  V+SI LN++L  +PV +  +G++ Q+T+  I SG+K
Sbjct: 276  ITIAVVSIYLNILLFKIPVSAARVGQILQVTEGTIKSGYK 315

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
            P-type ATPase, member of the heavy-metal transporting
            P-type ATPases in the superfamily of P-type ATPases [3015
            bp, 1004 aa]
          Length = 1004

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 47/110 (42%), Gaps = 30/110 (27%)

Query: 1119 GSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLK------------------------- 1153
            G++   ++V G VF L   N+EV  +SY  +  L+                         
Sbjct: 743  GNTVSYVSVNGHVFGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVG 802

Query: 1154 ---SSIYARMSPDEKHELVGQLQGLD--YVVGFCGDGANDCGALKAADVG 1198
                ++Y+ +SP  K +LV ++Q  +    V   GDG ND  AL  +D+G
Sbjct: 803  ISFENVYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLG 852

>Scas_516.2
          Length = 370

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 28/40 (70%), Gaps = 3/40 (7%)

Query: 1386 ITDVVISIILNVVLMMVPVDST-LGKVFQLTD--ISSGFK 1422
            IT  V+SI LN++L  +PV +  +G++ Q+T+  I SG+K
Sbjct: 290  ITIAVVSIYLNILLFKIPVTAAKVGQILQVTEGTIKSGYK 329

>Kwal_0.237
          Length = 1547

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 42/84 (50%), Gaps = 6/84 (7%)

Query: 1318 ILVFQATPWLVVQAMRWYQAPVVGGDDAVQSSDNT---VLFFFSNFQYVLTAIVLSVGPP 1374
            I+   A  W      +W +  VVG  D + S+D+T   +L  F++F  VL  +      P
Sbjct: 459  IMTELAKGWPPELQYKWLKRKVVGVFDVLDSNDDTRRNLLVIFNDFVVVLEIL---NDAP 515

Query: 1375 YREPMSKNLGFITDVVISIILNVV 1398
            Y    + N+  +++V+++ ++N V
Sbjct: 516  YYHSKAGNMPLLSNVLMNSLINEV 539

>Kwal_26.7720
          Length = 538

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 43/103 (41%), Gaps = 14/103 (13%)

Query: 760 ARLKKKGIFCIAPTRVNVSGKIDVM----CFDKTGTLTEDGLDVLGVHVAEPQGHQNFRF 815
           A L KK    I+PT V      +V        K  T T    ++  + +      +NF+ 
Sbjct: 139 AALMKKRASAISPTNVTTPAPANVATSSPALPKKPTKTALKKEIQQLKL------ENFKL 192

Query: 816 ----GALITNVRGLFNKYSLNDCGSPIDFKSRNFLVSLLTCHS 854
               G L  N++ L ++YSL D    +  K R+FL SL    S
Sbjct: 193 KQELGQLTGNLQDLKHRYSLCDVSVQLHAKKRSFLDSLADADS 235

>YPR086W (SUA7) [5512] chr16 (710097..711134) RNA polymerase II
            transcription initiation factor TFIIB (factor e),
            functions in selection of site for transcriptional
            initiation [1038 bp, 345 aa]
          Length = 345

 Score = 30.8 bits (68), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 27/40 (67%), Gaps = 3/40 (7%)

Query: 1386 ITDVVISIILNVVLMMVPVDST-LGKVFQLTD--ISSGFK 1422
            IT  V+SI LN++L  +P+ +  +G+  Q+T+  I SG+K
Sbjct: 275  ITIAVVSIYLNILLFQIPITAAKVGQTLQVTEGTIKSGYK 314

>Scas_227.0d
          Length = 307

 Score = 30.4 bits (67), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query: 778 SGKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITNV 822
           +G    +CFDKTGTLTE+ + V+   V +   + N    AL+T+V
Sbjct: 2   NGSATAVCFDKTGTLTENVMSVVRGFVGD--SYFNDSDNALLTSV 44

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.136    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 45,372,877
Number of extensions: 1975353
Number of successful extensions: 6517
Number of sequences better than 10.0: 111
Number of HSP's gapped: 6508
Number of HSP's successfully gapped: 216
Length of query: 1447
Length of database: 16,596,109
Length adjustment: 114
Effective length of query: 1333
Effective length of database: 12,649,657
Effective search space: 16861992781
Effective search space used: 16861992781
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 68 (30.8 bits)