Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.91891726170183310.0
Sklu_2383.11720170656280.0
AFR566C1716170149230.0
Scas_594.41722173348700.0
CAGL0M04829g1706169644120.0
YMR229C (RRP5)1729134438840.0
KLLA0B08239g1729134338790.0
KLLA0F17996g6842371182e-05
CAGL0D02376g695881073e-04
YER013W (PRP22)1145731000.002
Scas_713.42699219980.004
Kwal_56.23875680155960.006
Kwal_55.21029110573960.008
AGL184W68355890.044
CAGL0F02915g83590880.063
KLLA0B11638g111175880.064
AAR020W111273820.26
YLR117C (CLF1)68792810.33
Scas_617.930272761.1
Scas_479.230272751.2
YJR007W (SUI2)30472751.4
Scas_570.1185885752.1
Sklu_2413.41122120733.1
KLLA0D14663g40868723.4
AGR320W30272723.5
Scas_594.165129723.6
KLLA0F03190g111779724.0
Kwal_33.1542230272714.4
Kwal_26.8439114670715.3
YDR416W (SYF1)85975715.4
CAGL0B03795g30362706.0
Sklu_2031.358260706.6
YOR290C (SNF2)1703176706.9
YJR109C (CPA2)111879707.4
Scas_691.191117120707.8
YBR112C (SSN6)96676708.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.9189
         (1701 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.9189                                                         3213   0.0  
Sklu_2383.1 YMR229C, Contig c2383 993-6155                           2172   0.0  
AFR566C [3758] [Homologous to ScYMR229C (RRP5) - SH] (1449324..1...  1900   0.0  
Scas_594.4                                                           1880   0.0  
CAGL0M04829g complement(524685..529805) similar to sp|Q05022 Sac...  1704   0.0  
YMR229C (RRP5) [4185] chr13 complement(725933..731122) Protein r...  1500   0.0  
KLLA0B08239g 729850..735039 similar to sp|Q05022 Saccharomyces c...  1498   0.0  
KLLA0F17996g 1645592..1647646 similar to sgd|S0004107 Saccharomy...    50   2e-05
CAGL0D02376g complement(244241..246328) similar to tr|Q12309 Sac...    46   3e-04
YER013W (PRP22) [1436] chr5 (178840..182277) Pre-mRNA splicing f...    43   0.002
Scas_713.42                                                            42   0.004
Kwal_56.23875                                                          42   0.006
Kwal_55.21029                                                          42   0.008
AGL184W [4128] [Homologous to ScYLR117C (CLF1) - SH] complement(...    39   0.044
CAGL0F02915g 281010..283517 similar to sp|Q04048 Saccharomyces c...    39   0.063
KLLA0B11638g complement(1020591..1023926) similar to sp|P24384 S...    39   0.064
AAR020W [206] [Homologous to ScYER013W (PRP22) - SH] complement(...    36   0.26 
YLR117C (CLF1) [3530] chr12 complement(382472..384535) Essential...    36   0.33 
Scas_617.9                                                             34   1.1  
Scas_479.2                                                             33   1.2  
YJR007W (SUI2) [2909] chr10 (450934..451848) Translation initiat...    33   1.4  
Scas_570.11                                                            33   2.1  
Sklu_2413.4 YJR109C, Contig c2413 10886-14254                          33   3.1  
KLLA0D14663g 1238190..1239416 similar to sp|Q06103 Saccharomyces...    32   3.4  
AGR320W [4631] [Homologous to ScYJR007W (SUI2) - SH] complement(...    32   3.5  
Scas_594.1                                                             32   3.6  
KLLA0F03190g complement(296883..300236) highly similar to sp|P03...    32   4.0  
Kwal_33.15422                                                          32   4.4  
Kwal_26.8439                                                           32   5.3  
YDR416W (SYF1) [1241] chr4 (1298420..1300999) Pre-mRNA splicing ...    32   5.4  
CAGL0B03795g 376266..377177 highly similar to sp|P20459 Saccharo...    32   6.0  
Sklu_2031.3 YBL054W, Contig c2031 3063-4811                            32   6.6  
YOR290C (SNF2) [5074] chr15 complement(855144..860255) Component...    32   6.9  
YJR109C (CPA2) [3001] chr10 complement(629500..632856) Carbamoyl...    32   7.4  
Scas_691.19                                                            32   7.8  
YBR112C (CYC8) [302] chr2 complement(462826..465726) General rep...    32   8.5  

>Kwal_26.9189
          Length = 1726

 Score = 3213 bits (8331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1591/1701 (93%), Positives = 1591/1701 (93%)

Query: 1    MSSGQKRKRVEESPLTRQDQTQQPSSSLLQNADEGSFPRGGASALTPLELKQVANEAAGD 60
            MSSGQKRKRVEESPLTRQDQTQQPSSSLLQNADEGSFPRGGASALTPLELKQVANEAAGD
Sbjct: 1    MSSGQKRKRVEESPLTRQDQTQQPSSSLLQNADEGSFPRGGASALTPLELKQVANEAAGD 60

Query: 61   VLFGAESAAPAPVSDSQRPXXXXXXXXXXXXXXXDEDSEDSSVTVIDHLNFRNLPVGTLL 120
            VLFGAESAAPAPVSDSQRP               DEDSEDSSVTVIDHLNFRNLPVGTLL
Sbjct: 61   VLFGAESAAPAPVSDSQRPKKKKKTHQKSATKAADEDSEDSSVTVIDHLNFRNLPVGTLL 120

Query: 121  LGQISQVNKHDLCVSLSDNLCGFVTLPSISEPFTKLLEDLDESMNSDGEEEVNGXXXXXX 180
            LGQISQVNKHDLCVSLSDNLCGFVTLPSISEPFTKLLEDLDESMNSDGEEEVNG      
Sbjct: 121  LGQISQVNKHDLCVSLSDNLCGFVTLPSISEPFTKLLEDLDESMNSDGEEEVNGSEAEYD 180

Query: 181  XXXXXXXXXRAQDTKGKELPDLQRFFSQGQWLRCSVQSNSALDKDNKKSKRIELSIEPSI 240
                     RAQDTKGKELPDLQRFFSQGQWLRCSVQSNSALDKDNKKSKRIELSIEPSI
Sbjct: 181  SDEESSKASRAQDTKGKELPDLQRFFSQGQWLRCSVQSNSALDKDNKKSKRIELSIEPSI 240

Query: 241  TNQLVEEDLVRNCTVQCAVKSIEDHGAILDLGIEGITGFISKKDYALLPNLLPGSVFLAN 300
            TNQLVEEDLVRNCTVQCAVKSIEDHGAILDLGIEGITGFISKKDYALLPNLLPGSVFLAN
Sbjct: 241  TNQLVEEDLVRNCTVQCAVKSIEDHGAILDLGIEGITGFISKKDYALLPNLLPGSVFLAN 300

Query: 301  VAKKSGRTATVNFDFKNKKSKVSHISSIDAIIPGQAVDFLCQKKTSNGVIGKVFGLVDGF 360
            VAKKSGRTATVNFDFKNKKSKVSHISSIDAIIPGQAVDFLCQKKTSNGVIGKVFGLVDGF
Sbjct: 301  VAKKSGRTATVNFDFKNKKSKVSHISSIDAIIPGQAVDFLCQKKTSNGVIGKVFGLVDGF 360

Query: 361  LNVSQQSAFYSSGKKNDEAYSVGSNTRVRILATLMNKAGEKFVVVSELPHILSFATEALE 420
            LNVSQQSAFYSSGKKNDEAYSVGSNTRVRILATLMNKAGEKFVVVSELPHILSFATEALE
Sbjct: 361  LNVSQQSAFYSSGKKNDEAYSVGSNTRVRILATLMNKAGEKFVVVSELPHILSFATEALE 420

Query: 421  RPALNAFPVGYIFEDCDLMGRDSQYFYLKINNDLVGQVHISKIGTEEPSGKVRARVLGYN 480
            RPALNAFPVGYIFEDCDLMGRDSQYFYLKINNDLVGQVHISKIGTEEPSGKVRARVLGYN
Sbjct: 421  RPALNAFPVGYIFEDCDLMGRDSQYFYLKINNDLVGQVHISKIGTEEPSGKVRARVLGYN 480

Query: 481  NLDGYYQLSTDPKTLSVKYLRTSDIPVGTIIPSCEITQVSDKGIQLSILGGQFKASVPPL 540
            NLDGYYQLSTDPKTLSVKYLRTSDIPVGTIIPSCEITQVSDKGIQLSILGGQFKASVPPL
Sbjct: 481  NLDGYYQLSTDPKTLSVKYLRTSDIPVGTIIPSCEITQVSDKGIQLSILGGQFKASVPPL 540

Query: 541  HISDIRLVYPERKFKIGSKVKAILISANNRGHLFVSLKKSLVNLDREEVQLASSFQDIDR 600
            HISDIRLVYPERKFKIGSKVKAILISANNRGHLFVSLKKSLVNLDREEVQLASSFQDIDR
Sbjct: 541  HISDIRLVYPERKFKIGSKVKAILISANNRGHLFVSLKKSLVNLDREEVQLASSFQDIDR 600

Query: 601  IATDGLKVAATVDIFKTNGCVVSFLGGLRGFLPNSEISEAFVKRPQDHLRLGQTVIVKVL 660
            IATDGLKVAATVDIFKTNGCVVSFLGGLRGFLPNSEISEAFVKRPQDHLRLGQTVIVKVL
Sbjct: 601  IATDGLKVAATVDIFKTNGCVVSFLGGLRGFLPNSEISEAFVKRPQDHLRLGQTVIVKVL 660

Query: 661  QHNAQQNRVIVTCKVSSEAASQQKEAIENMIVGRSIIKVAVVEKTKDSLVVEQXXXXXXX 720
            QHNAQQNRVIVTCKVSSEAASQQKEAIENMIVGRSIIKVAVVEKTKDSLVVEQ       
Sbjct: 661  QHNAQQNRVIVTCKVSSEAASQQKEAIENMIVGRSIIKVAVVEKTKDSLVVEQVGVGLRG 720

Query: 721  XXXXXHLSDSRIEQNRAQLKKIKIGNEFEGLVIDKDARTRVFNLSCKKSLIKDAEKSLLP 780
                 HLSDSRIEQNRAQLKKIKIGNEFEGLVIDKDARTRVFNLSCKKSLIKDAEKSLLP
Sbjct: 721  VVYVGHLSDSRIEQNRAQLKKIKIGNEFEGLVIDKDARTRVFNLSCKKSLIKDAEKSLLP 780

Query: 781  VNYQDVKERGTHSAMNGYVKSVSEKGVFVAFNGQFVGLVLPSYAVDSRDVDLASKFYSNQ 840
            VNYQDVKERGTHSAMNGYVKSVSEKGVFVAFNGQFVGLVLPSYAVDSRDVDLASKFYSNQ
Sbjct: 781  VNYQDVKERGTHSAMNGYVKSVSEKGVFVAFNGQFVGLVLPSYAVDSRDVDLASKFYSNQ 840

Query: 841  SVTVYLLRTDDANERFLLTMKEPKNEKSSKPIPEVRGAVNPVDSSIKDLSDFSVGKITKA 900
            SVTVYLLRTDDANERFLLTMKEPKNEKSSKPIPEVRGAVNPVDSSIKDLSDFSVGKITKA
Sbjct: 841  SVTVYLLRTDDANERFLLTMKEPKNEKSSKPIPEVRGAVNPVDSSIKDLSDFSVGKITKA 900

Query: 901  MVKAVKRNQLNVVLSDNLHGRIDISEVFDKIEDISDTKSPLATFKKGDLLDVKVIGYHDV 960
            MVKAVKRNQLNVVLSDNLHGRIDISEVFDKIEDISDTKSPLATFKKGDLLDVKVIGYHDV
Sbjct: 901  MVKAVKRNQLNVVLSDNLHGRIDISEVFDKIEDISDTKSPLATFKKGDLLDVKVIGYHDV 960

Query: 961  KTHKFLPVSHRSSKNVLLELTAKPSRLNGAGGVAIDNVKVGDSIVGFVNNISKDILWLTV 1020
            KTHKFLPVSHRSSKNVLLELTAKPSRLNGAGGVAIDNVKVGDSIVGFVNNISKDILWLTV
Sbjct: 961  KTHKFLPVSHRSSKNVLLELTAKPSRLNGAGGVAIDNVKVGDSIVGFVNNISKDILWLTV 1020

Query: 1021 SPVLKAKIDFFDLTDESSQHNANIEDAFPLGSALRATVVKIDQDRNTLSVSGRSHSVSDI 1080
            SPVLKAKIDFFDLTDESSQHNANIEDAFPLGSALRATVVKIDQDRNTLSVSGRSHSVSDI
Sbjct: 1021 SPVLKAKIDFFDLTDESSQHNANIEDAFPLGSALRATVVKIDQDRNTLSVSGRSHSVSDI 1080

Query: 1081 KDINVGDNLPARLLNVADSYLLLEVGKDVKGVAFVTDALDDYTKSLKDVYGNQKNNIFSA 1140
            KDINVGDNLPARLLNVADSYLLLEVGKDVKGVAFVTDALDDYTKSLKDVYGNQKNNIFSA
Sbjct: 1081 KDINVGDNLPARLLNVADSYLLLEVGKDVKGVAFVTDALDDYTKSLKDVYGNQKNNIFSA 1140

Query: 1141 KVISVDTKNGKLNLSLRSEDAQDGNVKTHKDLKRGQIVRGLVKKATDKGIFVYLSSSLQA 1200
            KVISVDTKNGKLNLSLRSEDAQDGNVKTHKDLKRGQIVRGLVKKATDKGIFVYLSSSLQA
Sbjct: 1141 KVISVDTKNGKLNLSLRSEDAQDGNVKTHKDLKRGQIVRGLVKKATDKGIFVYLSSSLQA 1200

Query: 1201 FVPVSKLTDSYIKEWKKFYRPMQSVVGKIVNCDDDSHILATLKESEVNGTLNILKNYADI 1260
            FVPVSKLTDSYIKEWKKFYRPMQSVVGKIVNCDDDSHILATLKESEVNGTLNILKNYADI
Sbjct: 1201 FVPVSKLTDSYIKEWKKFYRPMQSVVGKIVNCDDDSHILATLKESEVNGTLNILKNYADI 1260

Query: 1261 KVGEIFEGSVKNVTDFGLFVKLDNTMNVTGLAHKSEVADAPVNDLSTIFGAGDKVKAVVL 1320
            KVGEIFEGSVKNVTDFGLFVKLDNTMNVTGLAHKSEVADAPVNDLSTIFGAGDKVKAVVL
Sbjct: 1261 KVGEIFEGSVKNVTDFGLFVKLDNTMNVTGLAHKSEVADAPVNDLSTIFGAGDKVKAVVL 1320

Query: 1321 KVNAEKKQLSLGLKASYFKENKNTSPKLENXXXXXXXXXXXXXXXXXXXXXLVEEIGQXX 1380
            KVNAEKKQLSLGLKASYFKENKNTSPKLEN                     LVEEIGQ  
Sbjct: 1321 KVNAEKKQLSLGLKASYFKENKNTSPKLENSDVVSEDEVDDERDVDSASEDLVEEIGQES 1380

Query: 1381 XXXXXXXXXXXXNHNGGKALSTDGLSLSAGFDWTTSILDQAQXXXXXXXXXXXXXXXXXX 1440
                        NHNGGKALSTDGLSLSAGFDWTTSILDQAQ                  
Sbjct: 1381 EPEEMEDIAEDENHNGGKALSTDGLSLSAGFDWTTSILDQAQDEDSSDEEDFTETKKSKK 1440

Query: 1441 XXRSVGGVEDQTIDINTRAPESVGDFERMIMGNPNSSVVWMNFMAFQLQLGEIDKARDVA 1500
              RSVGGVEDQTIDINTRAPESVGDFERMIMGNPNSSVVWMNFMAFQLQLGEIDKARDVA
Sbjct: 1441 KKRSVGGVEDQTIDINTRAPESVGDFERMIMGNPNSSVVWMNFMAFQLQLGEIDKARDVA 1500

Query: 1501 ERALKTISFREEAEKMNIWIGMLNLENTFGNESSLNEVFSRACQYMDSYVIHTKLINIYQ 1560
            ERALKTISFREEAEKMNIWIGMLNLENTFGNESSLNEVFSRACQYMDSYVIHTKLINIYQ
Sbjct: 1501 ERALKTISFREEAEKMNIWIGMLNLENTFGNESSLNEVFSRACQYMDSYVIHTKLINIYQ 1560

Query: 1561 MSHNIDXXXXXXXXXXXXXGSEKVPIWVSWGEFLIDQGQADEAHQVLASALKSLPRRHHI 1620
            MSHNID             GSEKVPIWVSWGEFLIDQGQADEAHQVLASALKSLPRRHHI
Sbjct: 1561 MSHNIDKAAALFKATAKKFGSEKVPIWVSWGEFLIDQGQADEAHQVLASALKSLPRRHHI 1620

Query: 1621 EVVRKFAQLEFAKGDQEQGRSLFEGLLADTPKRIDLWNVYVDQEIKAGDKKKVEDLFERI 1680
            EVVRKFAQLEFAKGDQEQGRSLFEGLLADTPKRIDLWNVYVDQEIKAGDKKKVEDLFERI
Sbjct: 1621 EVVRKFAQLEFAKGDQEQGRSLFEGLLADTPKRIDLWNVYVDQEIKAGDKKKVEDLFERI 1680

Query: 1681 VNRKLTRKQAKFFFGKWLEFE 1701
            VNRKLTRKQAKFFFGKWLEFE
Sbjct: 1681 VNRKLTRKQAKFFFGKWLEFE 1701

>Sklu_2383.1 YMR229C, Contig c2383 993-6155
          Length = 1720

 Score = 2172 bits (5628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1062/1706 (62%), Positives = 1311/1706 (76%), Gaps = 26/1706 (1%)

Query: 3    SGQKRKRVEESPLTRQDQTQQP-SSSLLQNADEGSFPRGGASALTPLELKQVANEAAGDV 61
            S  KRKR +ESPLTRQD T QP  SSLLQ+++E SFPRGGAS LTPLELKQVANEAA DV
Sbjct: 4    SNNKRKRDDESPLTRQDNTSQPVKSSLLQSSEETSFPRGGASVLTPLELKQVANEAASDV 63

Query: 62   LF--GAESAAPAPVSDSQRPXXXXXXXXXXXXXXXDEDSEDSSVTVIDHLNFRNLPVGTL 119
            LF  G  SA    V   +RP               + D E+S+ T+++H++F+NL  G+ 
Sbjct: 64   LFDNGTSSAVKPEV---ERPKKKKKTSKSTTGTKNETDEEEST-TIVEHISFKNLTPGSQ 119

Query: 120  LLGQISQVNKHDLCVSLSDNLCGFVTLPSISEPFTKLLEDLDESMNSDGEEEVNGXXXXX 179
            LLGQIS VNKHDLC+SLSDNLCG+VTL +ISE FT LLE+LDE+M               
Sbjct: 120  LLGQISAVNKHDLCISLSDNLCGYVTLANISEQFTNLLEELDENMEK-----DQDSEDDD 174

Query: 180  XXXXXXXXXXRAQDTKGKELPDLQRFFSQGQWLRCSVQSNSALDKDNKKSKRIELSIEPS 239
                       +++ K KELPDL+++F  GQWLRC+VQSN+AL+   KK KRIEL+IEPS
Sbjct: 175  SDYDSSDEDEHSKNKKNKELPDLKKYFKPGQWLRCTVQSNTALEA-KKKQKRIELTIEPS 233

Query: 240  ITNQLVEEDLVRNCTVQCAVKSIEDHGAILDLGIEGITGFISKKDYALLPNLLPGSVFLA 299
             TNQL +EDL RNCTVQC+VKSIEDHGAILDLGI+GITGFISKKDY  +  LLPG+VFL 
Sbjct: 234  ATNQLADEDLSRNCTVQCSVKSIEDHGAILDLGIKGITGFISKKDYPGVEELLPGTVFLG 293

Query: 300  NVAKKSGRTATVNFDFKNKKSKVSHISSIDAIIPGQAVDFLCQKKTSNGVIGKVFGLVDG 359
            NVAK+S RT  VNFDF +K +KVSHISSIDA+IPGQ+VDFLCQK +SNG+ GK FGLV G
Sbjct: 294  NVAKRSDRTVNVNFDFTSKNNKVSHISSIDAVIPGQSVDFLCQKISSNGIFGKTFGLVSG 353

Query: 360  FLNVSQQSAFYSSGKKNDEAYSVGSNTRVRILATLMNKAGEKFVVVSELPHILSFATEAL 419
            FL  S    F  S  K    Y++GSN R RI+ATL NK GEK ++VS LPHILS  T+ L
Sbjct: 354  FLGASHLRTF--SADKIKHNYAIGSNIRARIVATLTNKKGEKIILVSTLPHILSLETKIL 411

Query: 420  ERPALNAFPVGYIFEDCDLMGRDSQYFYLKINNDLVGQVHISKIGTEEPSGKVRARVLGY 479
            E  AL+AFPVGYI E C + GRDSQYFYL ++ D +GQVHIS++G E+P+G+V+ARV+GY
Sbjct: 412  EADALDAFPVGYILESCTVKGRDSQYFYLSMDQDRIGQVHISRVGDEDPAGEVKARVMGY 471

Query: 480  NNLDGYYQLSTDPKTLSVKYLRTSDIPVGTIIPSCEITQVSDKGIQLSILGGQFKASVPP 539
            N +DGYYQLSTDPK L +KYLRT DIP+G +I  CEI  VSDKGIQL++ G QFKA VPP
Sbjct: 472  NVVDGYYQLSTDPKVLELKYLRTKDIPLGEVISGCEIVTVSDKGIQLTLFGSQFKAFVPP 531

Query: 540  LHISDIRLVYPERKFKIGSKVKAILISANNRGHLFVSLKKSLVNLDREEVQLASSFQDID 599
            LHISD++LVYPERKFKIGSKVK  +++ +NRG + V+LKKSLVNLD +E++L S+F+ I+
Sbjct: 532  LHISDVKLVYPERKFKIGSKVKGRVLNVDNRGRVTVTLKKSLVNLDEDEIKLVSNFKQIE 591

Query: 600  RIATDGLKVAATVDIFKTNGCVVSFLGGLRGFLPNSEISEAFVKRPQDHLRLGQTVIVKV 659
            ++A +  K +ATV+ FKTNGCVVSFLG L+GFLPN EISEAFVKRPQDHLRLGQTV+VKV
Sbjct: 592  KLADNDEKTSATVEFFKTNGCVVSFLGNLKGFLPNGEISEAFVKRPQDHLRLGQTVMVKV 651

Query: 660  LQHNAQQNRVIVTCKVSSEAASQQKEAIENMIVGRSIIKVAVVEKTKDSLVVEQXXXXXX 719
            LQH+ ++NRVI+TCKVSS+AA+QQK+AIENM++GRSI+ V VV KTKDS V+E       
Sbjct: 652  LQHDEEKNRVIITCKVSSDAAAQQKDAIENMVIGRSIVTVTVVGKTKDSAVIELVDVGLR 711

Query: 720  XXXXXXHLSDSRIEQNRAQLKKIKIGNEFEGLVIDKDARTRVFNLSCKKSLIKDAEKSLL 779
                  HLSDSRIEQNRAQLKK+++G E EGLVIDKD RTRVFNLSCKKSLIKDA+  LL
Sbjct: 712  GVIYVGHLSDSRIEQNRAQLKKLRVGTELEGLVIDKDIRTRVFNLSCKKSLIKDAQNGLL 771

Query: 780  PVNYQDVKERGTHSAMNGYVKSVSEKGVFVAFNGQFVGLVLPSYAVDSRDVDLASKFYSN 839
            P++Y +VK +G    M+GYVKS S+KG+FVAF+G+FVGLVLPSYAV+SRDVD+  KF+ N
Sbjct: 772  PLSYDEVKAKGNSFPMHGYVKSFSDKGIFVAFSGRFVGLVLPSYAVESRDVDILKKFHIN 831

Query: 840  QSVTVYLLRTDDANERFLLTMKEPKNEKSSKPIPEVRGAVNPVDSSIKDLSDFSVGKITK 899
            QS+T YLLRTDD NERFLLT+KEPK  +  +    V  AVNP+D S+K+LS++ VGK+TK
Sbjct: 832  QSITAYLLRTDDENERFLLTLKEPKVAEKRQDNGSV-NAVNPIDESVKELSEYVVGKVTK 890

Query: 900  AMVKAVKRNQLNVVLSDNLHGRIDISEVFDKIEDISDTKSPLATFKKGDLLDVKVIGYHD 959
            A +KAVK+NQLNV+L+DNLHGR+D+SE+FDK E+I DTK+PL+ +KKGD+++VKVIGYHD
Sbjct: 891  AKIKAVKKNQLNVLLADNLHGRVDVSEIFDKFENIKDTKAPLSCYKKGDVIEVKVIGYHD 950

Query: 960  VKTHKFLPVSHRSSKNVLLELTAKPSRLN--GAGGVAIDNVKVGDSIVGFVNNISKDILW 1017
            +KTH+FLP+SHR+SKN +LELTAKPS+L       + I NVK  D +VGFVNN SK  LW
Sbjct: 951  IKTHRFLPISHRASKNTILELTAKPSKLTEENESSLTIKNVKENDELVGFVNNFSKGFLW 1010

Query: 1018 LTVSPVLKAKIDFFDLTDESSQHNANIEDAFPLGSALRATVVKIDQDRNTLSVSGRSHSV 1077
            LT+SPVLKAKI   +L+D+ S   ++I ++FPLGSAL+   V ID + N +SV+GR HS+
Sbjct: 1011 LTLSPVLKAKISNINLSDDGSTFASDIPESFPLGSALKVKAVDIDTEHNVVSVTGRFHSI 1070

Query: 1078 SDIKDINVGDNLPARLLNVADSYLLLEVGKDVKGVAFVTDALDDYTKSLKDVYGNQKNNI 1137
             DI D+ VGD LPAR++ +ADSYLLL++G D+KG++FVT+ALDDY+ SLK  + N+KN+I
Sbjct: 1071 KDITDVKVGDKLPARIIMIADSYLLLDLGNDLKGISFVTEALDDYSVSLKTAFENRKNSI 1130

Query: 1138 FSAKVISVDTKNGKLNLSLRSEDAQDGNVKTHKDLKRGQIVRGLVKKATDKGIFVYLSSS 1197
              A VISVD K+ K+ LSLRS   +D  +K++KDL RG +VRG +K  +DKGIFVYLS+S
Sbjct: 1131 VPATVISVDLKDKKVKLSLRSTKPKDREIKSYKDLSRGDVVRGFIKAVSDKGIFVYLSTS 1190

Query: 1198 LQAFVPVSKLTDSYIKEWKKFYRPMQSVVGKIVNCDDDSHILATLKESEVNGTLNILKNY 1257
            +QAFVPVSKLTDS+IK+WKKFY+PMQ V GK+VNC+++S IL TLKESEVNG LNILK Y
Sbjct: 1191 VQAFVPVSKLTDSFIKDWKKFYKPMQPVTGKVVNCEEESRILLTLKESEVNGDLNILKGY 1250

Query: 1258 ADIKVGEIFEGSVKNVTDFGLFVKLDNTMNVTGLAHKSEVADAPVNDLSTIFGAGDKVKA 1317
            ++I+ GEIFEG + NVTDFG+FVKL+NT+NVTGLAH+S++AD+ V+DLS +FG GDKVKA
Sbjct: 1251 SNIQAGEIFEGYITNVTDFGVFVKLNNTLNVTGLAHRSQIADSQVDDLSALFGEGDKVKA 1310

Query: 1318 VVLKVNAEKKQLSLGLKASYFKENKNTSPKLENXXXXXXXXXXXXXXXXXXXXXLVEEIG 1377
            +VLK N EKKQ+SLGLKASYFK+    + ++E+                     ++    
Sbjct: 1311 IVLKTNPEKKQVSLGLKASYFKKEVEKNQEVED------VEMEDVAENESEEDEIIAVDY 1364

Query: 1378 QXXXXXXXXXXXXXXNHNGGKALSTDGLSLSAGFDWTTSILDQAQXXXXXXXXXXXXXXX 1437
            +              + +    ++ DGLSLS GFDWT SILDQAQ               
Sbjct: 1365 ENESELEAEPEKEATSQSSKVPVTNDGLSLSTGFDWTASILDQAQEDEESSEDEDFANTK 1424

Query: 1438 XXXXXRS--VGGVEDQTIDINTRAPESVGDFERMIMGNPNSSVVWMNFMAFQLQLGEIDK 1495
                 +      VED+TIDINTRAPESV DFER+IMGNPNSSVVWMN+MAFQLQL E+DK
Sbjct: 1425 KSRNRKKGRTNAVEDKTIDINTRAPESVSDFERLIMGNPNSSVVWMNYMAFQLQLSEVDK 1484

Query: 1496 ARDVAERALKTISFREEAEKMNIWIGMLNLENTFGNESSLNEVFSRACQYMDSYVIHTKL 1555
            AR++AERALKTISFR+E EK+NIWI MLNLENTFG E +L++ F R+CQYMDS+ +H KL
Sbjct: 1485 AREIAERALKTISFRDELEKLNIWIAMLNLENTFGTEETLDDAFKRSCQYMDSFTMHNKL 1544

Query: 1556 INIYQMSHNIDXXXXXXXXXXXXXGSEKVPIWVSWGEFLIDQGQADEAHQVLASALKSLP 1615
            I+IYQ+S   +             GS+KV IWVSWGEFLI + Q DEAH VL +ALK+LP
Sbjct: 1545 ISIYQLSEKFERAAELYRATAKKFGSQKVSIWVSWGEFLISRNQNDEAHAVLGNALKALP 1604

Query: 1616 RRHHIEVVRKFAQLEFAKGDQEQGRSLFEGLLADTPKRIDLWNVYVDQEIKAGDKKKVED 1675
            +R HIEVVRKFAQLEF+KGD EQGRSLFEGLLAD PKRIDLWNVY+DQE KAG+KKKVED
Sbjct: 1605 KRDHIEVVRKFAQLEFSKGDAEQGRSLFEGLLADAPKRIDLWNVYIDQETKAGEKKKVED 1664

Query: 1676 LFERIVNRKLTRKQAKFFFGKWLEFE 1701
            LFERI+++K+TRKQAKFFF KWL+FE
Sbjct: 1665 LFERIISKKITRKQAKFFFNKWLQFE 1690

>AFR566C [3758] [Homologous to ScYMR229C (RRP5) - SH]
            (1449324..1454474) [5151 bp, 1716 aa]
          Length = 1716

 Score = 1900 bits (4923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 949/1701 (55%), Positives = 1220/1701 (71%), Gaps = 23/1701 (1%)

Query: 3    SGQKRKRVEESPLTRQDQTQQPSSSLLQNADEGSFPRGGASALTPLELKQVANEAAGDVL 62
            S  KRK   E         Q  S S+L +  + +FPRGGASALTPLELKQVANEAA DVL
Sbjct: 5    SVNKRKLNNEQRPEEAAGRQMASKSVLASGGDVAFPRGGASALTPLELKQVANEAASDVL 64

Query: 63   FGAESAAPAPVSDSQRPXXXXXXXXXXXXXXXDEDSEDSSVTVIDHLNFRNLPVGTLLLG 122
            FG +   PA   +  R                 ED  D    +++HL+F+ L  GT+LLG
Sbjct: 65   FGRDDGKPA--EERPRKKKKTSKASKEDAVAGKEDRTD----IVEHLSFKGLTSGTVLLG 118

Query: 123  QISQVNKHDLCVSLSDNLCGFVTLPSISEPFTKLLEDLDESMNSDGEEEVNGXXXXXXXX 182
            Q+  VN+ DLC++L+D L G+V L +IS PFT LLE LD+SM+S                
Sbjct: 119  QLCGVNRTDLCIALTDGLRGYVPLTNISAPFTSLLEQLDQSMDS----------GSEDED 168

Query: 183  XXXXXXXRAQDTKGKELPDLQRFFSQGQWLRCSVQSNSALDKDNKKSKRIELSIEPSITN 242
                   R +     ELP+L ++F+ GQWLRC V  NSALD   KK+ RIELSIEPS  N
Sbjct: 169  DDSDDEQRDKPHTITELPELSKYFTLGQWLRCVVVKNSALDSQKKKNSRIELSIEPSKVN 228

Query: 243  QLVEEDLVRNCTVQCAVKSIEDHGAILDLGIEGITGFISKKDYALLPNLLPGSVFLANVA 302
                EDL ++ TVQCAVKSIEDHGA+LDLG++ +TGFIS KD + + +++PGSVFLAN+ 
Sbjct: 229  LFETEDLAKHTTVQCAVKSIEDHGALLDLGVQDVTGFISNKDLSKMGDVMPGSVFLANIT 288

Query: 303  KKSGRTATVNFDFKNKKSKVSHISSIDAIIPGQAVDFLCQKKTSNGVIGKVFGLVDGFLN 362
            K+  RTATVNF+F  K SKVS ISS+DA+IPG  +DFLC+K T++G+IGK FG++DGFL+
Sbjct: 289  KRGDRTATVNFEFTAKNSKVSQISSVDAVIPGHTIDFLCEKITNHGIIGKAFGVLDGFLS 348

Query: 363  VSQQSAFYSSGKKNDEAYSVGSNTRVRILATLMNKAGEKFVVVSELPHILSFATEALERP 422
             SQ   F  +  K+   Y++GSN +VRI+ATL  K G K ++VS LPHILS     LE  
Sbjct: 349  ESQARVFSVTDMKH--KYAIGSNIKVRIIATLRTKQGNKVILVSALPHILSLERNLLETE 406

Query: 423  ALNAFPVGYIFEDCDLMGRDSQYFYLKINNDLVGQVHISKIGTEEPSGKVRARVLGYNNL 482
            A++AFPVGY+F++C L+GRDSQY Y+ ++++ +GQ+HISK G       V+ARV GYN +
Sbjct: 407  AMHAFPVGYVFDNCKLLGRDSQYLYVSLSDERIGQIHISKAGDAITQEAVKARVTGYNTV 466

Query: 483  DGYYQLSTDPKTLSVKYLRTSDIPVGTIIPSCEITQVSDKGIQLSILGGQFKASVPPLHI 542
            DGYYQL++DPK L+  YLR++DIPVGTI+  CEIT VS  GI+LS+  GQFKA V PLHI
Sbjct: 467  DGYYQLTSDPKLLAKPYLRSADIPVGTILSGCEITAVSGNGIELSLFDGQFKAFVAPLHI 526

Query: 543  SDIRLVYPERKFKIGSKVKAILISANNRGHLFVSLKKSLVNLDREEVQLASSFQDIDRIA 602
            SDIRLVYPERKFKIGSKVK  ++  +N+G ++V+LKKSLV+ +  ++ L S F+ I ++A
Sbjct: 527  SDIRLVYPERKFKIGSKVKGRVLHVDNKGRVYVTLKKSLVSANDSDIPLVSDFEQIAKLA 586

Query: 603  TDGLKVAATVDIFKTNGCVVSFLGGLRGFLPNSEISEAFVKRPQDHLRLGQTVIVKVLQH 662
             +  K  ATV+ FK +GCVV+FLG L+ FLPN EISEAFV+R QDHLRLGQTV+VKVL+H
Sbjct: 587  EEDGKTLATVESFKPSGCVVTFLGNLKAFLPNKEISEAFVQRAQDHLRLGQTVVVKVLEH 646

Query: 663  NAQQNRVIVTCKVSSEAASQQKEAIENMIVGRSIIKVAVVEKTKDSLVVEQXXXXXXXXX 722
             A+Q++VIVT KVSSE + +QK AI +++VGRSI+ V VVEKTKDS+VVE          
Sbjct: 647  VAKQSKVIVTRKVSSEDSEKQKAAINDLVVGRSIVDVTVVEKTKDSVVVELNDVGLRGVI 706

Query: 723  XXXHLSDSRIEQNRAQLKKIKIGNEFEGLVIDKDARTRVFNLSCKKSLIKDAEKSLLPVN 782
               HLSDS++EQNRA LKK++IG+  +G+V+DKD +TRVFN+SCKKSLIKDA K +LP+ 
Sbjct: 707  YVGHLSDSKLEQNRALLKKLRIGSSLQGVVMDKDVKTRVFNMSCKKSLIKDASKDILPLT 766

Query: 783  YQDVKERGTHSAMNGYVKSVSEKGVFVAFNGQFVGLVLPSYAVDSRDVDLASKFYSNQSV 842
            + D+K++  ++ M+GYVKS+S++G+FVAF G+FVGLVLPSYA +SRDVD+  KFY NQSV
Sbjct: 767  FVDIKDKDPNTPMHGYVKSISDRGIFVAFTGKFVGLVLPSYATESRDVDIFKKFYINQSV 826

Query: 843  TVYLLRTDDANERFLLTMKEPKNEKSSKPIPEVRGAVNPVDSSIKDLSDFSVGKITKAMV 902
            TVYLLRTD+ NERFLLTM  P+     +       AVNPVD+S+K +S +SVG +TKA V
Sbjct: 827  TVYLLRTDEENERFLLTMSPPQTSNKKEDSNHDVAAVNPVDASVKIISQYSVGTVTKARV 886

Query: 903  KAVKRNQLNVVLSDNLHGRIDISEVFDKIEDISDTKSPLATFKKGDLLDVKVIGYHDVKT 962
            K+VK+ QLNVVL+DNLHGR+D SE++D  E+I + K PLA FK GD++DVKVIG+HD KT
Sbjct: 887  KSVKKTQLNVVLADNLHGRVDASEIYDTFEEIENPKEPLAKFKSGDVIDVKVIGFHDSKT 946

Query: 963  HKFLPVSHRSSKNVLLELTAKPSRLNGA-GGVAIDNVKVGDSIVGFVNNISKDILWLTVS 1021
            HKFLP+SHR+  N +LEL+AK S L GA   +    +K GD ++GFVNN +K  +WLT+S
Sbjct: 947  HKFLPISHRTGVNTVLELSAKKSALKGAYQPIEFSGMKNGDELIGFVNNFAKGFIWLTLS 1006

Query: 1022 PVLKAKIDFFDLTDESSQHNANIEDAFPLGSALRATVVKIDQDRNTLSVSGRSHSVSDIK 1081
            P LKAKI  F+L+D+ S    N++++FPLG AL+  V ++D     +SVS R H+++DIK
Sbjct: 1007 PALKAKIPDFELSDDGSVFTGNLDESFPLGCALKVKVKELDPAHKIVSVSARKHAITDIK 1066

Query: 1082 DINVGDNLPARLLNVADSYLLLEVGKDVKGVAFVTDALDDYTKSLKDVYGNQKNNIFSAK 1141
            DI V D LPAR++ VADSYLLL++G  + GVAFVTDAL++++ SL+ VY ++  ++  A 
Sbjct: 1067 DIKVADKLPARIVKVADSYLLLDLGNRLTGVAFVTDALNEFSLSLRSVYEDKIGSMILAS 1126

Query: 1142 VISVDTKNGKLNLSLRSEDAQDGNVKTHKDLKRGQIVRGLVKKATDKGIFVYLSSSLQAF 1201
            V+ VD +N K+NLSLR+EDA D  + +HKDLK+G +VRG +K  TDKGIFVYLS +LQAF
Sbjct: 1127 VVGVDVENKKINLSLRTEDATDRYILSHKDLKQGDVVRGFIKSVTDKGIFVYLSRTLQAF 1186

Query: 1202 VPVSKLTDSYIKEWKKFYRPMQSVVGKIVNCDDDSHILATLKESEVNGTLNILKNYADIK 1261
            VPVSKLTD+YIKEWKKFY+ MQ + GK+VNC+ DS IL T+KESEVNG L ILK+YAD+K
Sbjct: 1187 VPVSKLTDAYIKEWKKFYKTMQPITGKVVNCESDSRILLTMKESEVNGELKILKSYADLK 1246

Query: 1262 VGEIFEGSVKNVTDFGLFVKLDNTMNVTGLAHKSEVADAPVNDLSTIFGAGDKVKAVVLK 1321
             G+IF+GSVKNVTDFG+FVKL NT+NVTGLAHKSE++D+ ++DLS +FG GDKVKA++LK
Sbjct: 1247 SGDIFDGSVKNVTDFGVFVKLHNTLNVTGLAHKSEISDSKIDDLSLLFGEGDKVKAIILK 1306

Query: 1322 VNAEKKQLSLGLKASYFKENKNTSPKLENXXXXXXXXXXXXXXXXXXXXXLVEEIGQXXX 1381
             N EK Q+SLGLKASYF++  +   + E                       +E+I +   
Sbjct: 1307 TNPEKNQVSLGLKASYFQKAHDDEDEAEPAESIEEANGEEINGEASDEDEAMEDI-EYEH 1365

Query: 1382 XXXXXXXXXXXNHNGGKALSTDGLSLSAGFDWTTSILDQAQXXXXXXXXXXXXXXXXXXX 1441
                       +    +A+ T GLSLSAGFDWT SILD  Q                   
Sbjct: 1366 TPADAPSHETSSKAHKEAVPT-GLSLSAGFDWTGSILDPEQGKTMRMSSEDDDFTFKKAK 1424

Query: 1442 XRSVGGVEDQTIDI--NTRAPESVGDFERMIMGNPNSSVVWMNFMAFQLQLGEIDKARDV 1499
              +     +   D   +T+APESVGDFER+IMGNPNSSV+WMN+MAFQLQL E++KAR++
Sbjct: 1425 KNNKASRCNDRQDCRHHTKAPESVGDFERLIMGNPNSSVIWMNYMAFQLQLSEVEKAREL 1484

Query: 1500 AERALKTISFREEAEKMNIWIGMLNLENTFGNESSLNEVFSRACQYMDSYVIHTKLINIY 1559
            AERALKTISFREE EK+NIWI MLNLENTFG + +L +VF RACQYMD+Y IH KLI+IY
Sbjct: 1485 AERALKTISFREEHEKLNIWIAMLNLENTFGTDETLEDVFRRACQYMDAYTIHMKLISIY 1544

Query: 1560 QMSHNIDXXXXXXXXXXXXXGSEKVPIWVSWGEFLIDQGQADEAHQVLASALKSLPRRHH 1619
             MS   D             GSE V +WVSWGEFL+   Q DEA  VLA ALKSLPRR H
Sbjct: 1545 AMSSKDDKAVELYKAAAKKFGSENVSLWVSWGEFLLTHEQPDEARAVLAQALKSLPRRSH 1604

Query: 1620 IEVVRKFAQLEFAKGDQEQGRSLFEGLLADTPKRIDLWNVYVDQEIKAGDKKKVEDLFER 1679
            I+VVRKFAQLEFAKGD EQGR+LFEGLLAD PKRID+WNVY+DQEIK+ ++ + + LFER
Sbjct: 1605 IDVVRKFAQLEFAKGDPEQGRALFEGLLADAPKRIDIWNVYLDQEIKSSNRARADALFER 1664

Query: 1680 IVNRKLTRKQAKFFFGKWLEF 1700
            ++  KL+RKQAKFFF KWL+ 
Sbjct: 1665 VLVAKLSRKQAKFFFNKWLQL 1685

>Scas_594.4
          Length = 1722

 Score = 1880 bits (4870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 936/1733 (54%), Positives = 1226/1733 (70%), Gaps = 73/1733 (4%)

Query: 1    MSSGQKRKRVEESPLTRQDQTQQPS-SSLLQNADEGSFPRGGASALTPLELKQVANEAAG 59
            M    KRKR EE PL R+D TQQP+ SSL++N +E SFPRGG+SALTPLELKQVANEAA 
Sbjct: 1    MVPPTKRKRDEEFPLAREDATQQPTASSLMRNTEEVSFPRGGSSALTPLELKQVANEAAN 60

Query: 60   DVLFGAESAAPAPVSDSQRPXXXXXXXXXXXXXXXDEDSEDSS--VTVIDHLNFRNLPVG 117
            DVLFG E++     S + RP               ++  E+    ++V+ H+NF+ L +G
Sbjct: 61   DVLFGKETSTDVAES-TTRPKKKKKTGKKSKKDTEEKTEEEDEETLSVVQHVNFKTLKIG 119

Query: 118  TLLLGQISQVNKHDLCVSLSDNLCGFVTLPSISEPFTKLL---------------EDLDE 162
            +L+LGQIS+++K D+C+S +D L G+V L  IS PF  +L               +  DE
Sbjct: 120  SLVLGQISEISKTDMCISFTDGLSGYVNLTHISAPFMTILEELDDDMDDDDELEKKKTDE 179

Query: 163  SMNSDGEEEVNGXXXXXXXXXXXXXXXRAQDTKGKELPDLQRFFSQGQWLRCSVQSNSAL 222
              +S  +EE                    +D+ G  LP L+ +F  GQWLRCSV SN+AL
Sbjct: 180  EYDSSDDEE--------------EKEKATKDSIG--LPSLENYFKVGQWLRCSVISNTAL 223

Query: 223  --DKDNKKSKRIELSIEPSITNQLVEEDLVRNCTVQCAVKSIEDHGAILDLGIEGITGFI 280
                   K K+IELSIEPS+ N L EED+VR+ +VQCAVKSIEDHGA+LD+GI+G TGFI
Sbjct: 224  LPKDKKNKKKKIELSIEPSVVNTLTEEDIVRSASVQCAVKSIEDHGAMLDIGIDGFTGFI 283

Query: 281  SKKDYALLPNLLPGSVFLANVAKKSGRTATVNFDFKNKKSKVSHISSIDAIIPGQAVDFL 340
            SKKDY     LLPG+VFL NV KKS RT T+N DF +KK+K++HISS+DA++PGQ VD L
Sbjct: 284  SKKDYPEFEKLLPGAVFLGNVTKKSDRTVTINLDFSDKKAKITHISSVDAVVPGQVVDLL 343

Query: 341  CQKKTSNGVIGKVFGLVDGFLNVSQQSAFYSSGKKNDEAYSVGSNTRVRILATLMNKAGE 400
            CQ  T+NG++GK FGLV  F++ +    F     K++  ++VGSN   RI+A L+ K  +
Sbjct: 344  CQTITNNGIVGKTFGLVPSFISTAHLRVFKEEELKHN--FAVGSNIPCRIIAVLITKEND 401

Query: 401  KFVVVSELPHILSFATEALERPALNAFPVGYIFEDCDLMGRDSQYFYLKINNDLVGQVHI 460
            K +++S LPHI S      E   L AFP+G++ + C + GRDS Y YL +++D VG+VH 
Sbjct: 402  KTLLLSTLPHIKSLKNVLGEVENLTAFPIGHLIDSCTVKGRDSDYLYLAMDDDRVGEVHS 461

Query: 461  SKIGTEEPSGKVRARVLGYNNLDGYYQLSTDPKTLSVKYLRTSDIPVGTIIPSCEITQVS 520
            S+IG  E   K++ARVLG+N++D  Y+LSTDP+ L +KYLR+ DIP+G ++P+CEIT VS
Sbjct: 462  SRIGELEKFDKLKARVLGFNSIDNLYELSTDPEILKLKYLRSKDIPIGEVLPNCEITAVS 521

Query: 521  DKGIQLSILGGQFKASVPPLHISDIRLVYPERKFKIGSKVKAILISANNRGHLFVSLKKS 580
             KGI+L I  GQFKA VPP+HISD RLVYPERKFKIGSKVK  +++ NNRG ++V+LKK+
Sbjct: 522  SKGIELKIFNGQFKAIVPPMHISDTRLVYPERKFKIGSKVKGRVLNINNRGLIYVTLKKT 581

Query: 581  LVNLDREEVQLASSFQDIDRIATDGLKVAATVDIFKTNGCVVSFLGGLRGFLPNSEISEA 640
            LVN++ +++QL S+F     I     K  ATV  F+ +GC+V+F GG+  FLPN+EISE 
Sbjct: 582  LVNIEDDDIQLLSNFAIAKEIQEKNQKTVATVTAFRPSGCIVAFFGGMTAFLPNAEISEV 641

Query: 641  FVKRPQDHLRLGQTVIVKVLQHNAQQNRVIVTCKVSSEAASQQKEAIENMIVGRSIIKVA 700
            FV++P++HLRLGQT++VK+L+ + +  R++VTCK+S++ A ++KE IE +I GRS++KV 
Sbjct: 642  FVRKPEEHLRLGQTIVVKLLKIDQENARMLVTCKISNDQAEKKKETIEKLIPGRSMVKVN 701

Query: 701  VVEKTKDSLVVEQXXXXXXXXXXXXHLSDSRIEQNRAQLKKIKIGNEFEGLVIDKDARTR 760
            VVEKTKDS++VE             HLSD+RIEQNRA +KKI IG+E +GLVIDKDART+
Sbjct: 702  VVEKTKDSVIVELPETSLRGVIYVGHLSDARIEQNRAAIKKIAIGSELKGLVIDKDARTQ 761

Query: 761  VFNLSCKKSLIKDAEKSLLPVNYQDVKERGTHSAMNGYVKSVSEKGVFVAFNGQFVGLVL 820
            VFNLS K+SLIKDA+  + P+ Y D+K +   + ++GY+KS+S KG+FVAFNG+FVGLVL
Sbjct: 762  VFNLSLKQSLIKDAKNEVSPLTYADIKSKSKTTPLHGYIKSISNKGLFVAFNGKFVGLVL 821

Query: 821  PSYAVDSRDVDLASKFYSNQSVTVYLLRTDDANERFLLTMKEPKNEKSSKPIPEVRGAVN 880
            PSYAV+SRDVD++  FY NQSVT YLLR+DD NERFLLT++ P  +  S  +      + 
Sbjct: 822  PSYAVESRDVDISKTFYINQSVTAYLLRSDDDNERFLLTLRTPSTKDDSSKVTGTE-TLK 880

Query: 881  PVDSSIKDLSDFSVGKITKAMVKAVKRNQLNVVLSDNLHGRIDISEVFDKIEDISDTKSP 940
            P+D ++KDL DF+ GK+ K  +K +K+NQLNVVL+DNLHGRIDI+EVFD   DI +   P
Sbjct: 881  PIDPAMKDLKDFTTGKVVKVQIKGIKKNQLNVVLADNLHGRIDIAEVFDSFSDIKNATHP 940

Query: 941  LATFKKGDLLDVKVIGYHDVKTHKFLPVSHRSSKNVLLELTAKPSRLNGAG--GVAIDNV 998
            L  FKKG+++D K+IG HD+K+H+FLP+SH + K  +LEL+ KPS++       ++I +V
Sbjct: 941  LIDFKKGNIIDAKIIGTHDIKSHRFLPISHHAVKGSVLELSLKPSQMRSKDIKTLSISDV 1000

Query: 999  KVGDSIVGFVNNISKDILWLTVSPVLKAKIDFFDLTDESSQHNANIEDAFPLGSALRATV 1058
             VGD + GFVNN   + LWLTVSP LKAKI  FDL ++  + +  +ED FPLG AL   V
Sbjct: 1001 AVGDELTGFVNNYGSNTLWLTVSPTLKAKISLFDLAEDGLKSSEKVEDNFPLGCALPVKV 1060

Query: 1059 VKIDQDRNTLSVSGRSHSVSDIKDINVGDNLPARLLNVADSYLLLEVGKDVKGVAFVTDA 1118
              ID +   ++V+GRSH+    + + VGDN+P+R++ +ADSY+LL++G  + G+AF+TDA
Sbjct: 1061 TSIDTEHGVVNVTGRSHTEISFESLKVGDNVPSRIIKIADSYVLLDLGNKIHGIAFITDA 1120

Query: 1119 LDDYTKSLKDVYGNQKNNIFSAKVISVDTKNGKLNLSLRSEDAQDGNVKTHKDLKRGQIV 1178
            LDD++  LK+ Y   +N+I SAK++S+D +N K+NLSLR+E A+  ++ +H D+ +G +V
Sbjct: 1121 LDDFSVPLKEAYKGMENDIVSAKIVSIDAENKKVNLSLRTESAKTPSISSHTDISQGDVV 1180

Query: 1179 RGLVKKATDKGIFVYLSSSLQAFVPVSKLTDSYIKEWKKFYRPMQSVVGKIVNCDDDSHI 1238
             GLVK  +DKGIFVYLS S+ AFVPVSKL+D+Y+K+WKKF++PMQ V+GK+VN ++DS I
Sbjct: 1181 HGLVKSISDKGIFVYLSRSINAFVPVSKLSDTYLKDWKKFFKPMQYVIGKVVNAEEDSRI 1240

Query: 1239 LATLKESEVNGTLNILKNYADIKVGEIFEGSVKNVTDFGLFVKLDNTMNVTGLAHKSEVA 1298
            L TL+ESEVNG L ILKNY DIKV EI+ GSVKNVTDFG+FVKLDNT+NVTGLAH SE+A
Sbjct: 1241 LLTLRESEVNGDLKILKNYDDIKVNEIYNGSVKNVTDFGVFVKLDNTVNVTGLAHNSEIA 1300

Query: 1299 DAPVNDLSTIFGAGDKVKAVVLKVNAEKKQLSLGLKASYFKENKNTSPKLENXXXXXXXX 1358
            D    DL+++FG GD+VKA VLKVN EKKQLSL LKAS F  N N S K+E         
Sbjct: 1301 DQKPEDLASLFGVGDRVKAYVLKVNPEKKQLSLSLKASRFG-NTNES-KVEEKET----- 1353

Query: 1359 XXXXXXXXXXXXXLVEEIGQXXXXXXXXXXXXXXNHN---------GGKALSTDGLSLSA 1409
                          V+  G               N N             +STDGLSLS 
Sbjct: 1354 --------------VDADGDEIMEAVDYNNAPSDNENETEEILETVSKPKISTDGLSLST 1399

Query: 1410 GFDWTTSILDQAQXXXXXXXXXX-XXXXXXXXXXRSVGGVEDQTIDINTRAPESVGDFER 1468
            GFDWT SILDQAQ                     R    VED+TIDINTRAPESV DFER
Sbjct: 1400 GFDWTASILDQAQAEESSEEDEDFTETKRNRHKKRKQTIVEDKTIDINTRAPESVADFER 1459

Query: 1469 MIMGNPNSSVVWMNFMAFQLQLGEIDKARDVAERALKTISFREEAEKMNIWIGMLNLENT 1528
            +I+GNPNSSV+WMN+MAFQLQL EI+KAR++AERALKTI+FREE+EK NIW+ MLNLENT
Sbjct: 1460 LIIGNPNSSVIWMNYMAFQLQLSEIEKARELAERALKTINFREESEKQNIWMAMLNLENT 1519

Query: 1529 FGNESSLNEVFSRACQYMDSYVIHTKLINIYQMSHNIDXXXXXXXXXXXXXGSEKVPIWV 1588
            FG++ +L +VF RACQYMDS+ +H +L++IYQMS  ID             GSE V IWV
Sbjct: 1520 FGSDETLEDVFKRACQYMDSFTMHNRLLSIYQMSGKIDKAAELFKITAKKFGSENVSIWV 1579

Query: 1589 SWGEFLIDQGQADEAHQVLASALKSLPRRHHIEVVRKFAQLEFAKGDQEQGRSLFEGLLA 1648
            SWG+FL   G+A EA  +L++ALK+LP+R HIEVVRKFAQLEFAKGD E GRSLFEGL+A
Sbjct: 1580 SWGDFLTSHGKAQEARGILSNALKALPKRDHIEVVRKFAQLEFAKGDPEGGRSLFEGLIA 1639

Query: 1649 DTPKRIDLWNVYVDQEIKAGDKKKVEDLFERIVNRKLTRKQAKFFFGKWLEFE 1701
            D PKRID+WNVY+DQEIKA +KKKVEDLFER+V+RK+TRKQAKFFF KWLEFE
Sbjct: 1640 DAPKRIDIWNVYLDQEIKANEKKKVEDLFERVVSRKITRKQAKFFFNKWLEFE 1692

>CAGL0M04829g complement(524685..529805) similar to sp|Q05022
            Saccharomyces cerevisiae YMR229c RRP5, hypothetical start
          Length = 1706

 Score = 1704 bits (4412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 855/1696 (50%), Positives = 1156/1696 (68%), Gaps = 34/1696 (2%)

Query: 14   PLTRQDQTQQPS-SSLLQNADEGSFPRGGASALTPLELKQVANEAAGDVLFGAESAAPAP 72
            PL+++D T+QP  S+L++  +E SFPRGG+SALTPLELK VANEAA DVLFG E   P  
Sbjct: 8    PLSKEDGTRQPEKSTLVRTTEEISFPRGGSSALTPLELKHVANEAAHDVLFGNEKR-PLT 66

Query: 73   VSDSQRPXXXXXXXXXXXXXXXDEDSEDSSVTVIDHLNFRNLPVGTLLLGQISQVNKHDL 132
              D+ +P                +D+ +    +I+HLNF N+  GT+LLGQI  + K+DL
Sbjct: 67   EDDAGKPKKKKKRSSKKDTETVTDDTTEQRSAIIEHLNFNNVKEGTILLGQIDSITKNDL 126

Query: 133  CVSLSDNLCGFVTLPSISEPFTKLLEDLDESMNSDGEEEVNGXXXXXXXXXXXXXXXRAQ 192
             ++ +D L GFV L  ISE  T LLED+DE M+SD +E+                     
Sbjct: 127  RITFTDGLSGFVDLTHISEQLTSLLEDIDEDMDSDSKED------------DAEYESSDD 174

Query: 193  DTKGKELPDLQRFFSQGQWLRCSVQSNSALD-KDNKKSKRIELSIEPSITNQLVEEDLVR 251
            +++ K LP+L+ +F  GQWLRC+V  N+AL  K+ K+ KRIEL+IEPS+ N    ED+ +
Sbjct: 175  ESEQKSLPNLRHYFKVGQWLRCAVTKNTALKPKNAKQKKRIELTIEPSVVNNFDVEDINK 234

Query: 252  NCTVQCAVKSIEDHGAILDLGIEGITGFISKKDYALLPNLLPGSVFLANVAKKSGRTATV 311
            N  +QC+V+SIEDHGA LDLG+  +TGFI+KKD      L PGSVF++ + KK+ R+  V
Sbjct: 235  NTIIQCSVESIEDHGATLDLGVPSLTGFIAKKDCTNFDELKPGSVFISCITKKTDRSIVV 294

Query: 312  NFDFKNKKSKVSHISSIDAIIPGQAVDFLCQKKTSNGVIGKVFGLVDGFLNVSQQSAFYS 371
            + DF  KK+K++ ISSID+++PGQ VD LC++ T +G++GKVFG +  F+       F  
Sbjct: 295  SQDFSVKKNKMTSISSIDSVLPGQVVDLLCEEITDSGIVGKVFGSISAFIGKPHLQTFSE 354

Query: 372  SGKKNDEAYSVGSNTRVRILATLMNKAGEKFVVVSELPHILSFATEALERPALNAFPVGY 431
               K+   +S+GSN   RILA+++NK+G++ +++S LPH++S         +L AFP+G+
Sbjct: 355  EDIKH--KFSLGSNIPCRILASVINKSGDRVLILSTLPHVISLNNTLGSIESLEAFPIGF 412

Query: 432  IFEDCDLMGRDSQYFYLKINNDLVGQVHISKIGTEEPSGKVRARVLGYNNLDGYYQLSTD 491
            I ++  + GRDS Y YL I++  +G+VH S +G      K+++RV+GY+  D  ++L+TD
Sbjct: 413  IIDESVVKGRDSSYLYLAISDKFIGRVHQSNLGEIIKQDKLKSRVIGYDVADCIFELTTD 472

Query: 492  PKTLSVKYLRTSDIPVGTIIPSCEITQVSDKGIQLSILGGQFKASVPPLHISDIRLVYPE 551
            P+ L +KY+R+ DIPVG +  +CEI + S  G++L +LGGQF A VPPLHISDIRL+YPE
Sbjct: 473  PEKLKLKYIRSKDIPVGEVFNNCEILKASSSGVELKLLGGQFTAFVPPLHISDIRLIYPE 532

Query: 552  RKFKIGSKVKAILISANNRGHLFVSLKKSLVNLDREEVQLASSFQDIDRIATDGLKVAAT 611
            RKFKI SK K  +++ +N GH+  ++KKSLVN +  E  +  SF+    I     K   T
Sbjct: 533  RKFKIASKTKCRILNVDNHGHIIATMKKSLVNDEELEKPVIESFETAKSIKNKNEKTVGT 592

Query: 612  VDIFKTNGCVVSFLGGLRGFLPNSEISEAFVKRPQDHLRLGQTVIVKVLQHNAQQNRVIV 671
            V  F  +GCV+ F GG+ GFLP SE+SE FVKR +DHLRLGQTV VKVL+ + ++ R+IV
Sbjct: 593  VQSFNGHGCVIMFFGGVTGFLPKSEVSEVFVKRAEDHLRLGQTVQVKVLEVDEERRRIIV 652

Query: 672  TCKVSSEAASQQKEAIENMIVGRSIIKVAVVEKTKDSLVVEQXXXXXXXXXXXXHLSDSR 731
            TCKVS+E A QQK  IE++ +G+SII+  VVEKTKDS++VE             H+SD R
Sbjct: 653  TCKVSNEEAQQQKSIIESLKIGQSIIETVVVEKTKDSVIVEIPDVGIRGVIYVGHISDER 712

Query: 732  IEQNRAQLKKIKIGNEFEGLVIDKDARTRVFNLSCKKSLIKDAEKSLLPVNYQDVKERGT 791
            IEQ RA++KKI+IG++  GLVIDKD+RT++FNLS KKSL+KDA+   LP  + ++ +   
Sbjct: 713  IEQCRAEIKKIRIGSKLTGLVIDKDSRTQIFNLSLKKSLMKDAQNKRLPTTFAEITKFKK 772

Query: 792  HSAMNGYVKSVSEKGVFVAFNGQFVGLVLPSYAVDSRDVDLASKFYSNQSVTVYLLRTDD 851
               ++GYVKS+S  GVFVAF G+FVGLVLPSYAV+SR VD+   FYSNQSVT YLLRTDD
Sbjct: 773  TDPLHGYVKSISSTGVFVAFTGKFVGLVLPSYAVESRQVDIEKAFYSNQSVTAYLLRTDD 832

Query: 852  ANERFLLTMKEPKNEKSSKPIPEVRGAVNPVDSSIKDLSDFSVGKITKAMVKAVKRNQLN 911
             NERFLLT+K PK EK+++ I     A N +D+SIK + D  +GKI  A +K VK+NQLN
Sbjct: 833  DNERFLLTLKAPKVEKAAETI----SAENIIDTSIKSVKDIKLGKILDAKIKGVKKNQLN 888

Query: 912  VVLSDNLHGRIDISEVFDKIEDISDTKSPLATFKKGDLLDVKVIGYHDVKTHKFLPVSHR 971
            ++L+DN+HGR+DISEVFD   DI D K PL+ +K  D + VK+IG+HD+K+HK LP++H 
Sbjct: 889  IILADNVHGRVDISEVFDNYNDIKDKKHPLSHYKANDKVRVKIIGHHDLKSHKSLPITHN 948

Query: 972  SSKNVLLELTAKPSRLNGAGGVAID--NVKVGDSIVGFVNNISKDILWLTVSPVLKAKID 1029
              K  + ELT KPS+L       +D  ++ VGD I+ FVNN     LWLTV+P +KAK+ 
Sbjct: 949  FVKGTVFELTMKPSQLKSKDVKELDIRDITVGDEIIAFVNNYQNSTLWLTVTPTIKAKLS 1008

Query: 1030 FFDLTDESSQHNANIEDAFPLGSALRATVVKIDQDRNTLSVSGRSHSVSDIKDINVGDNL 1089
             FDL++E+  +  N+ED FPLGS L+  V   DQ+++ L V+ R+  ++ I D+ VG + 
Sbjct: 1009 IFDLSEETLMNIKNVEDDFPLGSVLKVNVTGKDQNKSILQVTQRNGKINSIDDLKVGGHT 1068

Query: 1090 PARLLNVADSYLLLEVGKDVKGVAFVTDALDDYTKSLKDVYGNQKNNIFSAKVISVDTKN 1149
              +++ V   YLL+E+   + G++   +AL+D+T+ L  V+  ++N    AK+ SV    
Sbjct: 1069 IGKIVKVTPKYLLIELENKITGISTALEALNDFTEPLDQVFAGKENEFVKAKITSVIADE 1128

Query: 1150 GKLNLSLRSEDAQDGNVKTHKDLKRGQIVRGLVKKATDKGIFVYLSSSLQAFVPVSKLTD 1209
             K+ L L  +++    + +H DLK G++V GLVK  TDKG+FV+L  S++AFVPVSKL+D
Sbjct: 1129 KKVQLQLAEDESTVQKITSHSDLKVGEVVNGLVKTVTDKGLFVFLGKSVEAFVPVSKLSD 1188

Query: 1210 SYIKEWKKFYRPMQSVVGKIVNCDDDSHILATLKESEVNGTLNILKNYADIKVGEIFEGS 1269
            SY+KEWKKFY+PMQ VVGKIV+C++D  IL TL+E+EVNG L +LKNY+DIK G+IF G+
Sbjct: 1189 SYLKEWKKFYKPMQPVVGKIVSCNEDDRILLTLRETEVNGDLKVLKNYSDIKPGDIFNGT 1248

Query: 1270 VKNVTDFGLFVKLDNTMNVTGLAHKSEVADAPVNDLSTIFGAGDKVKAVVLKVNAEKKQL 1329
            V+NVTDFG+FVKLDNT NVTGLAH +E+AD    D+ +IFG GD+VKA VLK N EKKQL
Sbjct: 1249 VRNVTDFGVFVKLDNTANVTGLAHITEIADEVPEDIQSIFGVGDRVKAYVLKSNPEKKQL 1308

Query: 1330 SLGLKASYFKENKNTSPKLENXXXXXXXXXXXXXXXXXXXXXLVEEIGQXXXXXXXXXXX 1389
            SL LKAS+F  N+  + K E+                       E               
Sbjct: 1309 SLSLKASHFNTNETITEKAESQPQPRKIDEDQDELMDDEVVYNSESEASDDEEAHSSKST 1368

Query: 1390 XXXNHNGGKALSTDGLSLSAGFDWTTSILDQAQXXXXXXXXXXXXXXXXXXXXRSVGG-- 1447
               +++G       GLSLSAGFDWTTSILDQA                     +      
Sbjct: 1369 TVISNDG-------GLSLSAGFDWTTSILDQANASSDSESDEEDFMESKRSKNKKKKSKN 1421

Query: 1448 -VEDQTIDINTRAPESVGDFERMIMGNPNSSVVWMNFMAFQLQLGEIDKARDVAERALKT 1506
             VED+TIDINTRAPESV DFER+I+GNPNSSV+WMN+MAFQLQL EIDKAR++AERALKT
Sbjct: 1422 LVEDKTIDINTRAPESVADFERLIIGNPNSSVIWMNYMAFQLQLSEIDKARELAERALKT 1481

Query: 1507 ISFREEAEKMNIWIGMLNLENTFGNESSLNEVFSRACQYMDSYVIHTKLINIYQMSHNID 1566
            I++REEAEK+NIWI MLNLENTFG+E +L +VF+R+CQYMDS+ +H+KLI IYQ+S   D
Sbjct: 1482 INYREEAEKLNIWIAMLNLENTFGSEETLEDVFTRSCQYMDSFTMHSKLIGIYQLSEKFD 1541

Query: 1567 XXXXXXXXXXXXXGSEKVPIWVSWGEFLIDQGQADEAHQVLASALKSLPRRHHIEVVRKF 1626
                         GSEK  IWVSW  F++ Q + D+   +L+SALKSLP+R+HIEVVRKF
Sbjct: 1542 KASELFKITTKKFGSEKTSIWVSWASFVLSQNEPDQVGTILSSALKSLPKRNHIEVVRKF 1601

Query: 1627 AQLEFAKGDQEQGRSLFEGLLADTPKRIDLWNVYVDQEIKAGD-KKKVEDLFERIVNRKL 1685
            AQLEF++G+ E+GRSLFEGLLAD PKRID+WNVY+DQEIK  D K +VE+LFER++  K+
Sbjct: 1602 AQLEFSEGNPERGRSLFEGLLADAPKRIDIWNVYLDQEIKQKDNKSRVEELFERVIKMKI 1661

Query: 1686 TRKQAKFFFGKWLEFE 1701
            TRKQAKFFF KWL+FE
Sbjct: 1662 TRKQAKFFFNKWLQFE 1677

>YMR229C (RRP5) [4185] chr13 complement(725933..731122) Protein
            required for processing of pre-rRNA to 18S and 5.8S rRNA,
            component of U3 snoRNP (also called small subunit
            processome), which is required for 18S rRNA biogenesis
            [5190 bp, 1729 aa]
          Length = 1729

 Score = 1500 bits (3884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 741/1344 (55%), Positives = 974/1344 (72%), Gaps = 10/1344 (0%)

Query: 1    MSSGQKRKRVEESPLTRQDQTQQPS-SSLLQNADEGSFPRGGASALTPLELKQVANEAAG 59
            M +  KRKR E+ PL+R+D T+QPS SSL++N +E SFPRGGASALTPLELKQVANEAA 
Sbjct: 1    MVASTKRKRDEDFPLSREDSTKQPSTSSLVRNTEEVSFPRGGASALTPLELKQVANEAAS 60

Query: 60   DVLFGAESA-APAPVSDSQRPXXXXXXXXXXXXXXXDEDSEDSSVTVIDHLNFRNLPVGT 118
            DVLFG ES  A  P S   +                  +S+++   +I+H+NF+ L  G+
Sbjct: 61   DVLFGNESVKASEPASRPLKKKKTTKKSTSKDSEASSANSDEARAGLIEHVNFKTLKNGS 120

Query: 119  LLLGQISQVNKHDLCVSLSDNLCGFVTLPSISEPFTKLLEDLDESMNSDGEEEVNGXXXX 178
             LLGQIS + K DLC++ +D + G+V L  ISE FT +LEDLDE M+SD +         
Sbjct: 121  SLLGQISAITKQDLCITFTDGISGYVNLTHISEEFTSILEDLDEDMDSDTDAADEKKSKV 180

Query: 179  XXXXXXXXXXXRAQDTKGKELPDLQRFFSQGQWLRCSVQSNSALDKDNKKSK--RIELSI 236
                         +  K  ELP+L+R+F  GQWLRCSV  N++L+   KKSK  RIEL+I
Sbjct: 181  EDAEYESSDDEDEKLDKSNELPNLRRYFHIGQWLRCSVIKNTSLEPSTKKSKKKRIELTI 240

Query: 237  EPSITNQLVEEDLVRNCTVQCAVKSIEDHGAILDLGIEGITGFISKKDYALLPNLLPGSV 296
            EPS  N   +EDLV++ ++QCAVKSIEDHGA LD+G+ G TGFI+KKD+     LLPG+V
Sbjct: 241  EPSSVNIYADEDLVKSTSIQCAVKSIEDHGATLDVGLPGFTGFIAKKDFGNFEKLLPGAV 300

Query: 297  FLANVAKKSGRTATVNFDFKNKKSKVSHISSIDAIIPGQAVDFLCQKKTSNGVIGKVFGL 356
            FL N+ KKS R+  VN DF +KK+K++ ISSIDAIIPGQ VD LC+  T NG+ GKVFGL
Sbjct: 301  FLGNITKKSDRSIVVNTDFSDKKNKITQISSIDAIIPGQIVDLLCESITKNGIAGKVFGL 360

Query: 357  VDGFLNVSQQSAFYSSGKKNDEAYSVGSNTRVRILATLMNKAGEKFVVVSELPHILSFAT 416
            V G +NVS    F     K+   + +GS+ R RI+A L NK+G+K +++S LPHIL    
Sbjct: 361  VSGVVNVSHLRTFSEEDLKH--KFVIGSSIRCRIIACLENKSGDKVLILSNLPHILKLED 418

Query: 417  EALERPALNAFPVGYIFEDCDLMGRDSQYFYLKINNDLVGQVHISKIGTEEPSGKVRARV 476
                   L+AFP+GY FE C + GRDS+Y YL +++D +G+VH S++G  E S  + +RV
Sbjct: 419  ALRSTEGLDAFPIGYTFESCSIKGRDSEYLYLALDDDRLGKVHSSRVGEIENSENLSSRV 478

Query: 477  LGYNNLDGYYQLSTDPKTLSVKYLRTSDIPVGTIIPSCEITQVSDKGIQLSILGGQFKAS 536
            LGY+ +D  YQLSTDPK L +KYLRT+DIP+G ++PSCEIT VS  GI+L I  GQFKAS
Sbjct: 479  LGYSPVDDIYQLSTDPKYLKLKYLRTNDIPIGELLPSCEITSVSSSGIELKIFNGQFKAS 538

Query: 537  VPPLHISDIRLVYPERKFKIGSKVKAILISANNRGHLFVSLKKSLVNLDREEVQLASSFQ 596
            VPPLHISD RLVYPERKFKIGSKVK  +IS N+RG++ V+LKKSLVN++  E+ L S+++
Sbjct: 539  VPPLHISDTRLVYPERKFKIGSKVKGRVISVNSRGNVHVTLKKSLVNIEDNELPLVSTYE 598

Query: 597  DIDRIATDGLKVAATVDIFKTNGCVVSFLGGLRGFLPNSEISEAFVKRPQDHLRLGQTVI 656
            +   I     K  AT+ +FK NGC++SF GGL GFLPNSEISE FVKRP++HLRLGQTVI
Sbjct: 599  NAKNIKEKNEKTLATIQVFKPNGCIISFFGGLSGFLPNSEISEVFVKRPEEHLRLGQTVI 658

Query: 657  VKVLQHNAQQNRVIVTCKVSSEAASQQKEAIENMIVGRSIIKVAVVEKTKDSLVVEQXXX 716
            VK+L  +A + R+I TCKVS+E A+QQK+ IEN++ GR+II V V+EKTKDS++VE    
Sbjct: 659  VKLLDVDADRRRIIATCKVSNEQAAQQKDTIENIVPGRTIITVHVIEKTKDSVIVEIPDV 718

Query: 717  XXXXXXXXXHLSDSRIEQNRAQLKKIKIGNEFEGLVIDKDARTRVFNLSCKKSLIKDAEK 776
                     HLSDSRIEQNRAQLKK++IG E  GLVIDKD RTRVFN+S K SLIKDA+K
Sbjct: 719  GLRGVIYVGHLSDSRIEQNRAQLKKLRIGTELTGLVIDKDTRTRVFNMSLKSSLIKDAKK 778

Query: 777  SLLPVNYQDVKERGTHSAMNGYVKSVSEKGVFVAFNGQFVGLVLPSYAVDSRDVDLASKF 836
              LP+ Y DVK+      M+ Y+KS+S+KG+FVAFNG+F+GLVLPSYAVDSRD+D++  F
Sbjct: 779  ETLPLTYDDVKDLNKDVPMHAYIKSISDKGLFVAFNGKFIGLVLPSYAVDSRDIDISKAF 838

Query: 837  YSNQSVTVYLLRTDDANERFLLTMKEPKNEKSSKPIPEVRGAVNPVDSSIKDLSDFSVGK 896
            Y NQSVTVYLLRTDD N++FLL++K PK ++  K         +PVDSSIK   D S+G 
Sbjct: 839  YINQSVTVYLLRTDDKNQKFLLSLKAPKVKEEKK--KVESNIEDPVDSSIKSWDDLSIGS 896

Query: 897  ITKAMVKAVKRNQLNVVLSDNLHGRIDISEVFDKIEDISDTKSPLATFKKGDLLDVKVIG 956
            I KA +K+VK+NQLNV+L+ NLHGR+DI+EVFD  E+I+D K PL+ +KK D++ VK+IG
Sbjct: 897  IVKAKIKSVKKNQLNVILAANLHGRVDIAEVFDTYEEITDKKQPLSNYKKDDVIKVKIIG 956

Query: 957  YHDVKTHKFLPVSHRSSKNVLLELTAKPSRLNG--AGGVAIDNVKVGDSIVGFVNNISKD 1014
             HDVK+HKFLP++H+ SK  +LEL+ KPS L        +++ + +G  + GFVNN S +
Sbjct: 957  NHDVKSHKFLPITHKISKASVLELSMKPSELKSKEVHTKSLEEINIGQELTGFVNNSSGN 1016

Query: 1015 ILWLTVSPVLKAKIDFFDLTDESSQHNANIEDAFPLGSALRATVVKIDQDRNTLSVSGRS 1074
             LWLT+SPVLKA+I   DL D  S  + NIE  FPLGSAL+  V  ID++   ++  G+S
Sbjct: 1017 HLWLTISPVLKARISLLDLADNDSNFSENIESVFPLGSALQVKVASIDREHGFVNAIGKS 1076

Query: 1075 HSVSDIKDINVGDNLPARLLNVADSYLLLEVGKDVKGVAFVTDALDDYTKSLKDVYGNQK 1134
            H   ++  I VGD LP R+L +A+ Y+LL++G  V G++F+TDAL+D++ +LK+ + ++ 
Sbjct: 1077 HVDINMSTIKVGDELPGRVLKIAEKYVLLDLGNKVTGISFITDALNDFSLTLKEAFEDKI 1136

Query: 1135 NNIFSAKVISVDTKNGKLNLSLRSEDAQDGNVKTHKDLKRGQIVRGLVKKATDKGIFVYL 1194
            NN+    V+SVD +N K+ LSLR   A+  ++K+H+DLK+G+IV G+VK   DKGIFVYL
Sbjct: 1137 NNVIPTTVLSVDEQNKKIELSLRPATAKTRSIKSHEDLKQGEIVDGIVKNVNDKGIFVYL 1196

Query: 1195 SSSLQAFVPVSKLTDSYIKEWKKFYRPMQSVVGKIVNCDDDSHILATLKESEVNGTLNIL 1254
            S  ++AFVPVSKL+DSY+KEWKKFY+PMQ V+GK+V CD+DS I  TL+ESE+NG L +L
Sbjct: 1197 SRKVEAFVPVSKLSDSYLKEWKKFYKPMQYVLGKVVTCDEDSRISLTLRESEINGDLKVL 1256

Query: 1255 KNYADIKVGEIFEGSVKNVTDFGLFVKLDNTMNVTGLAHKSEVADAPVNDLSTIFGAGDK 1314
            K Y+DIK G++FEG++K+VTDFG+FVKLDNT+NVTGLAH +E+AD    DLS +FG GD+
Sbjct: 1257 KTYSDIKAGDVFEGTIKSVTDFGVFVKLDNTVNVTGLAHITEIADKKPEDLSALFGVGDR 1316

Query: 1315 VKAVVLKVNAEKKQLSLGLKASYF 1338
            VKA+VLK N EKKQ+SL LKAS+F
Sbjct: 1317 VKAIVLKTNPEKKQISLSLKASHF 1340

 Score =  437 bits (1124), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 206/303 (67%), Positives = 237/303 (78%), Gaps = 2/303 (0%)

Query: 1401 STDGLSLSAGFDWTTSILDQAQXXXXXXXXXXXXXXXXXXXXRSVGG--VEDQTIDINTR 1458
            S+DGLSLSAGFDWT SILDQAQ                    +      V+D+TIDINTR
Sbjct: 1397 SSDGLSLSAGFDWTASILDQAQEEEESDQDQEDFTENKKHKHKRRKENVVQDKTIDINTR 1456

Query: 1459 APESVGDFERMIMGNPNSSVVWMNFMAFQLQLGEIDKARDVAERALKTISFREEAEKMNI 1518
            APESV DFER+++GNPNSSVVWMN+MAFQLQL EI+KAR++AERALKTI+FREEAEK+NI
Sbjct: 1457 APESVADFERLLIGNPNSSVVWMNYMAFQLQLSEIEKARELAERALKTINFREEAEKLNI 1516

Query: 1519 WIGMLNLENTFGNESSLNEVFSRACQYMDSYVIHTKLINIYQMSHNIDXXXXXXXXXXXX 1578
            WI MLNLENTFG E +L EVFSRACQYMDSY IHTKL+ IY++S   D            
Sbjct: 1517 WIAMLNLENTFGTEETLEEVFSRACQYMDSYTIHTKLLGIYEISEKFDKAAELFKATAKK 1576

Query: 1579 XGSEKVPIWVSWGEFLIDQGQADEAHQVLASALKSLPRRHHIEVVRKFAQLEFAKGDQEQ 1638
             G EKV IWVSWG+FLI   +  EA  +L +ALK+LP+R+HIEVVRKFAQLEFAKGD E+
Sbjct: 1577 FGGEKVSIWVSWGDFLISHNEEQEARTILGNALKALPKRNHIEVVRKFAQLEFAKGDPER 1636

Query: 1639 GRSLFEGLLADTPKRIDLWNVYVDQEIKAGDKKKVEDLFERIVNRKLTRKQAKFFFGKWL 1698
            GRSLFEGL+AD PKRIDLWNVYVDQE+KA DKKKVEDLFERI+ +K+TRKQAKFFF KWL
Sbjct: 1637 GRSLFEGLVADAPKRIDLWNVYVDQEVKAKDKKKVEDLFERIITKKITRKQAKFFFNKWL 1696

Query: 1699 EFE 1701
            +FE
Sbjct: 1697 QFE 1699

>KLLA0B08239g 729850..735039 similar to sp|Q05022 Saccharomyces
            cerevisiae YMR229c RRP5 processing of pre-ribosomal RNA,
            start by similarity
          Length = 1729

 Score = 1498 bits (3879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 742/1343 (55%), Positives = 979/1343 (72%), Gaps = 28/1343 (2%)

Query: 6    KRKRVEESPLTRQDQTQQPSSSLLQNADEGSFPRGGASALTPLELKQVANEAAGDVLFGA 65
            KRKR +ESPL RQD T+ P+ S L  ++E SFPRGG+SAL+PLE+KQV NE   DVLFG 
Sbjct: 7    KRKRDDESPLVRQDATEAPAKSALSKSEEISFPRGGSSALSPLEVKQVGNEVVADVLFGK 66

Query: 66   ESAAPAPVSDSQRPXXXXXXXXXXXXXXXDEDSEDSSVTVIDHLNFRNLPVGTLLLGQIS 125
            + +A      +++                DE+ ED +  +I+H   + +  GT++LGQI 
Sbjct: 67   DESATGAEGPTKKKKKNAKNNFDQITTGDDEEKEDKT-DLIEHFGMKQMTKGTIVLGQIQ 125

Query: 126  QVNKHDLCVSLSDNLCGFVTLPSISEPFTKLLEDLDESMNSDGEEEVNGXXXXXXXXXXX 185
             ++KH+L +SL D L G+V+L  ISE  TK+LE+LDESM SD E+  +            
Sbjct: 126  SISKHELKISLVDGLHGYVSLTDISEQMTKILENLDESMESDDEKNEDSEYDSSDD---- 181

Query: 186  XXXXRAQDTKGKELPDLQRFFSQGQWLRCSVQSNSALDKDNKKSKRIELSIEPSITNQLV 245
                 +  T  KELPDL ++F  GQWLRC VQ+NSAL+ +  K+K+++LSIEPS+ N   
Sbjct: 182  ----ESDITTPKELPDLNKYFKIGQWLRCMVQNNSALESN--KNKKLDLSIEPSVVNVFE 235

Query: 246  EEDLVRNCTVQCAVKSIEDHGAILDLGIEGITGFISKKDYALLPNLLPGSVFLANVAKKS 305
            ++DL +NC +QC++KSIEDHGAILD+GIE +TGFISKKD     +LLPG VFLA V K+S
Sbjct: 236  DDDLAKNCPLQCSLKSIEDHGAILDIGIENLTGFISKKDIPEFSSLLPGMVFLATVTKRS 295

Query: 306  GRTATVNFDFKNKKSKVSHISSIDAIIPGQAVDFLCQKKTSNGVIGKVFGLVDGFLNVSQ 365
            GRT  VN D  +K +KV  ISSIDAI+PGQ++DFL Q  T++GVIGK FGL+  FL +  
Sbjct: 296  GRTVNVNLDLASKNTKVEKISSIDAIVPGQSIDFLPQTITNHGVIGKAFGLITAFLPLPH 355

Query: 366  QSAFYSSGKKNDEAYSVGSNTRVRILATLMNKAGEKFVVVSELPHILSFATEALERPALN 425
             + F     K+   YS+G     RILAT + K+G+K  VVS  PHI+S   +  E  AL 
Sbjct: 356  SNFFTVEDLKH--HYSIGDLVNARILATTIVKSGDKVAVVSTQPHIISLHPKLQETEALE 413

Query: 426  AFPVGYIFEDCDLMGRDSQYFYLKINNDLVGQVHISKIGTEEPSGKVRARVLGYNNLDGY 485
            +FPVGYIF+ C + GRDSQ+FY+ INN+ VGQ+H+SK G  EP+G V+AR+LGYNN+D  
Sbjct: 414  SFPVGYIFDSCTVKGRDSQFFYVSINNEQVGQIHLSKAGETEPTGTVKARILGYNNVDKL 473

Query: 486  YQLSTDPKTLSVKYLRTSDIPVGTIIPSCEITQVSDKGIQLSILGGQFKASVPPLHISDI 545
            Y L++DP  L VKYLR+SDIP G ++ +CEI  VS KGI+L I   QFKA VPPLHISD 
Sbjct: 474  YTLTSDPALLDVKYLRSSDIPAGEVLSACEIVTVSGKGIELKIFNDQFKAFVPPLHISDT 533

Query: 546  RLVYPERKFKIGSKVKAILISANNRGHLFVSLKKSLVNLDREEVQLASSFQDIDRIATDG 605
            RLVYPERKFKIGSKVK  +++ ++ G + V+LKKS+VN D E V L     DI  + +  
Sbjct: 534  RLVYPERKFKIGSKVKGRVLNVDSVGRVTVTLKKSIVNADEESVTLVCKNDDIQTVESQE 593

Query: 606  LKVAATVDIFKTNGCVVSFLGGLRGFLPNSEISEAFVKRPQDHLRLGQTVIVKVLQHNAQ 665
            LK   TV+IFK NGCV+SF   ++ F+PN EISEAFVK+PQ+HLRLGQ+V+VK+L H+ +
Sbjct: 594  LKTIGTVEIFKPNGCVISFFNNIKAFVPNKEISEAFVKKPQEHLRLGQSVLVKILNHDFE 653

Query: 666  QNRVIVTCKVSSEAASQQKEAIENMIVGRSIIKVAVVEKTKDSLVVEQXXXXXXXXXXXX 725
            +NR+I +CK+S+E++S+QK AIE+++VG+SII   V+EKTKDS++VE             
Sbjct: 654  RNRIIASCKISAESSSKQKSAIESLVVGKSIIDAIVIEKTKDSVIVESKDSGLRGVIYTG 713

Query: 726  HLSDSRIEQNRAQLKKIKIGNEFEGLVIDKDARTRVFNLSCKKSLIKDAEKSLLPVNYQD 785
            HLSD RIEQNRA  KK+KI +E  GLV+DKD RT VFN+SCKKSLIKDAE   LP+++ D
Sbjct: 714  HLSDDRIEQNRASQKKLKINSEVRGLVLDKDIRTHVFNMSCKKSLIKDAEDGTLPLSFSD 773

Query: 786  VKERGTHSAMNGYVKSVSEKGVFVAFNGQFVGLVLPSYAVDSRDVDLASKFYSNQSVTVY 845
            +K +     M+GYVKSVS++GVFVAFNG+FVGLVLPSYA ++RD+D+  K+Y NQSVTVY
Sbjct: 774  IKNKDKTEPMHGYVKSVSDRGVFVAFNGKFVGLVLPSYAAETRDIDIHKKYYINQSVTVY 833

Query: 846  LLRTDDANERFLLTMKEPKNEKSSKPIPEVRGAV-NPVDSSIKDLSDFSVGKITKAMVKA 904
            LLRTD+ +ERFLLT+ + K +     + ++  +V NPVD SIKDLSDF++GK+TKA + +
Sbjct: 834  LLRTDEEHERFLLTILKQKTD-----VKKINSSVINPVDKSIKDLSDFTIGKVTKATITS 888

Query: 905  VKRNQLNVVLSDNLHGRIDISEVFDKIEDISDTKSPLATFKKGDLLDVKVIGYHDVKTHK 964
            VK+NQLNV L+DN+HGRI ISEVFD  EDI + K+PL+ +KK D L V+VIG+HD+K+ K
Sbjct: 889  VKKNQLNVTLADNVHGRISISEVFDSFEDIKEQKAPLSVYKKNDSLSVRVIGFHDIKSRK 948

Query: 965  FLPVSHRSSKNVLLELTAKPSRLNGAGGVAIDNVKVGD-----SIVGFVNNISKDILWLT 1019
            FLP+SH +SK+ L+EL+AKPS L       +   K+ D     +  GF+NN S D  WLT
Sbjct: 949  FLPISHTTSKSHLVELSAKPSSLTS----PVSEKKLKDFTPEQTTFGFINNYSNDTAWLT 1004

Query: 1020 VSPVLKAKIDFFDLTDESSQHNANIEDAFPLGSALRATVVKIDQDRNTLSVSGRSHSVSD 1079
            ++P +KAK+  F+++DE    +  IE+ +P+G+A+R TV  ID + ++L VS RSH++S 
Sbjct: 1005 ITPTVKAKLPIFEISDEGHDFSLPIEEKYPIGTAVRVTVKSIDTEHDSLVVSARSHAISS 1064

Query: 1080 IKDINVGDNLPARLLNVADSYLLLEVGKDVKGVAFVTDALDDYTKSLKDVYGNQKNNIFS 1139
            I +I  GD LPAR+++V D+Y+LL +GKDV GV+F+TDALDDY+ SLKDVY ++K NI S
Sbjct: 1065 ISEIKEGDVLPARVISVQDTYVLLSLGKDVTGVSFITDALDDYSLSLKDVYDSKKKNIVS 1124

Query: 1140 AKVISVDTKNGKLNLSLRSEDAQDGNVKTHKDLKRGQIVRGLVKKATDKGIFVYLSSSLQ 1199
            A V++VD  N K+NLSLRS   +D  + +  +LKRG IVRG VK  TDKG+F+ LSS LQ
Sbjct: 1125 ATVLNVDIDNNKINLSLRSSSPKDRTIISSSELKRGDIVRGFVKSITDKGVFISLSSVLQ 1184

Query: 1200 AFVPVSKLTDSYIKEWKKFYRPMQSVVGKIVNCDDDSHILATLKESEVNGTLNILKNYAD 1259
            AFVPVSKLTD++IK+WKKF+R  QSVVGK+VNCD+D  +L TL+ESEVNG LN+LK+Y+D
Sbjct: 1185 AFVPVSKLTDAFIKDWKKFFRRGQSVVGKVVNCDNDDRVLLTLRESEVNGQLNVLKSYSD 1244

Query: 1260 IKVGEIFEGSVKNVTDFGLFVKLDNTMNVTGLAHKSEVADAPVNDLSTIFGAGDKVKAVV 1319
            I VG+IF+GSVKNVTDFG+FVKLD T+NVTGLAHKSEVADA +++L  +FG GDKVKA+V
Sbjct: 1245 INVGDIFQGSVKNVTDFGVFVKLDGTVNVTGLAHKSEVADAKIDNLQNLFGEGDKVKAIV 1304

Query: 1320 LKVNAEKKQLSLGLKASYFKENK 1342
            LK N EKKQ+SLGLKASYF   K
Sbjct: 1305 LKTNPEKKQISLGLKASYFTNEK 1327

 Score =  436 bits (1122), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 198/302 (65%), Positives = 236/302 (78%)

Query: 1400 LSTDGLSLSAGFDWTTSILDQAQXXXXXXXXXXXXXXXXXXXXRSVGGVEDQTIDINTRA 1459
            +STDGLSLS GFDWT SILDQAQ                    +    V+D+T+DINTR 
Sbjct: 1399 VSTDGLSLSTGFDWTASILDQAQDEEESSEEDEDFIKSRKQKKKKTQIVQDKTVDINTRI 1458

Query: 1460 PESVGDFERMIMGNPNSSVVWMNFMAFQLQLGEIDKARDVAERALKTISFREEAEKMNIW 1519
            PESVGDFER+IMGNPNSSVVWMN+MAF LQL E++KAR++ ERALKTI+FREE+EK+NIW
Sbjct: 1459 PESVGDFERLIMGNPNSSVVWMNYMAFHLQLSEVEKAREIVERALKTINFREESEKLNIW 1518

Query: 1520 IGMLNLENTFGNESSLNEVFSRACQYMDSYVIHTKLINIYQMSHNIDXXXXXXXXXXXXX 1579
            I  LNLENTFG E ++ +VF++ACQYMDS+ +H KL++IYQMS  I+             
Sbjct: 1519 IASLNLENTFGTEETVEDVFTKACQYMDSFTMHMKLLSIYQMSEKIEKAKELFKITAKKF 1578

Query: 1580 GSEKVPIWVSWGEFLIDQGQADEAHQVLASALKSLPRRHHIEVVRKFAQLEFAKGDQEQG 1639
            GSEKV IWV+WGEFLID    DEAH+VL ++LKSLP R+HIEVVRKFAQLEF+KGD EQG
Sbjct: 1579 GSEKVSIWVAWGEFLIDNNLIDEAHEVLGNSLKSLPTRNHIEVVRKFAQLEFSKGDPEQG 1638

Query: 1640 RSLFEGLLADTPKRIDLWNVYVDQEIKAGDKKKVEDLFERIVNRKLTRKQAKFFFGKWLE 1699
            RSLFEGLLAD PKR+DLWNVY+DQEIK G+K K EDLFER++ +K+TRKQAKFFF KWL+
Sbjct: 1639 RSLFEGLLADAPKRVDLWNVYIDQEIKHGEKSKAEDLFERVITKKITRKQAKFFFNKWLQ 1698

Query: 1700 FE 1701
            FE
Sbjct: 1699 FE 1700

>KLLA0F17996g 1645592..1647646 similar to sgd|S0004107 Saccharomyces
            cerevisiae YLR117c CLF1, start by similarity
          Length = 684

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/237 (21%), Positives = 100/237 (42%), Gaps = 29/237 (12%)

Query: 1466 FERMIMGNPNSSVVWMNFMAFQLQLGEIDKARDVAERALKTISFREEAEKMNIWIGMLNL 1525
            +ER ++ +     +W+ ++  +++   I+ AR++ +RA   +      +K+  W   L L
Sbjct: 86   YERALLVDHGFIPLWIQYIDSEIKWKNINHARNLLDRATNALP---RVDKL--WFKYLLL 140

Query: 1526 ENTFGNESSLNEVFSRACQY------MDSYV-IHTKLINIYQMSHNIDXXXXXXXXXXXX 1578
            E + GN+  +  +++R C +       DS++   T+ +N ++   NI             
Sbjct: 141  EESLGNQGIVRGIYTRWCSFEPGPDAWDSFIEFETRCLN-FENVRNI--------YSKFV 191

Query: 1579 XGSEKVPIWVSWGEFLIDQGQADEAHQVLASALKSL------PRRHHIEVVRKFAQLEFA 1632
                ++  W+ W  F    G       V + AL +L      P      V+  FA  E +
Sbjct: 192  LVHPQIDTWLKWVRFEQTHGDISSVRTVFSFALDTLTSFSGTPLVDIERVIGSFASWEAS 251

Query: 1633 KGDQEQGRSLFEGLLADTPKRIDLWNVYVDQEIKAGDKKKVEDLFERIVNRKLTRKQ 1689
            +G+ E+ R+L+   +   P    L    +  E K G  K +ED+   I  RK   +Q
Sbjct: 252  QGEYERSRTLYRLAVERWPISEALKEQQIQFEKKFGSSKNMEDIV--IAKRKAEYEQ 306

 Score = 38.1 bits (87), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%)

Query: 1625 KFAQLEFAKGDQEQGRSLFEGLLADTPKRIDLWNVYVDQEIKAGDKKKVEDLFERIVN 1682
            ++AQ EF + D  + RS++E  L      I LW  Y+D EIK  +     +L +R  N
Sbjct: 68   RYAQFEFDQKDIRRARSIYERALLVDHGFIPLWIQYIDSEIKWKNINHARNLLDRATN 125

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/93 (22%), Positives = 44/93 (47%), Gaps = 3/93 (3%)

Query: 1586 IWVSWGEFLIDQGQADEAHQVLASALKSLPRRHHIEVVRKFAQLEFAKGDQEQGRSLFEG 1645
            +W+ + EF I Q    +A ++L  +L   P+    +V + +  LE    + ++ R L+E 
Sbjct: 400  LWIMYAEFEIRQNNLLKARKILGVSLGKSPKP---KVFKYYINLEIRLKEFDRVRKLYEK 456

Query: 1646 LLADTPKRIDLWNVYVDQEIKAGDKKKVEDLFE 1678
             +   P  +  W  Y + E   GD+ +   +++
Sbjct: 457  YIDFNPSSVQSWLDYAELEENLGDEDRSRGIYD 489

>CAGL0D02376g complement(244241..246328) similar to tr|Q12309
            Saccharomyces cerevisiae YLR117c CLF1, start by
            similarity
          Length = 695

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 3/88 (3%)

Query: 1586 IWVSWGEFLIDQGQADEAHQVLASALKSLPRRHHIEVVRKFAQLEFAKGDQEQGRSLFEG 1645
            IW+ + EF I Q   ++A  +L  +L   P+R   +  + +  LE    + ++ R L+E 
Sbjct: 402  IWILYAEFEIRQDNLEKARSILGRSLGLCPKR---KTFKYYIDLETKLREFDRVRILYEN 458

Query: 1646 LLADTPKRIDLWNVYVDQEIKAGDKKKV 1673
             L   P  +D W  YV+ E   GD+ +V
Sbjct: 459  FLKFDPLNLDTWRAYVEFEDSLGDEVRV 486

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 50/234 (21%), Positives = 95/234 (40%), Gaps = 30/234 (12%)

Query: 1466 FERMIMGNPNSSVVWMNFMAFQLQLGEIDKARDVAERALKTISFREEAEKMNIWIGMLNL 1525
            FER +  + +   +W+ ++  +L+LG I+ AR++ ERA+  +      +K+  W   L +
Sbjct: 84   FERALRVHISYVPLWIRYIESELKLGYINHARNILERAITKLP---RVDKL--WYKYLIV 138

Query: 1526 ENTFGNESSLNEVFSRAC------QYMDSYVIHTKLINIYQMSHNIDXXXXXXXXXXXXX 1579
            E +  +   +  +F + C         DS+         Y+   NI              
Sbjct: 139  EESLAHFDIVRNLFQKWCSLEPAAHVWDSFTDFEVRQERYEDVRNI--------YSKYVL 190

Query: 1580 GSEKVPIWVSWGEFLIDQGQADEAHQVLASALKSL----PRRHH-----IEVVRKFAQLE 1630
               +   W  W  F +  G       V + AL +L      R+      I ++ +F++ E
Sbjct: 191  IHPQFSTWRKWINFEVRYGSTKTVRSVYSLALDALIAYSESRNELVDDCINLIVEFSKWE 250

Query: 1631 FAKGDQEQGRSLFEGLLADTPKRIDLWNVYVDQEIKAGDKKKVEDLFERIVNRK 1684
              + +  + +SL E  +   PK   L N  +  E + G  + +E+    I+NRK
Sbjct: 251  ALQKEYIRSKSLLEIAIQKWPKSNTLNNALLQFEREHGTAETLENTI--ILNRK 302

 Score = 34.7 bits (78), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 56/118 (47%), Gaps = 7/118 (5%)

Query: 1584 VPIWVSWGEFLIDQGQADEAHQVLASALKSLPRRHHIEVVRKFAQLEFAKGDQEQGRSLF 1643
            VP+W+ + E  +  G  + A  +L  A+  LPR    ++  K+  +E +    +  R+LF
Sbjct: 95   VPLWIRYIESELKLGYINHARNILERAITKLPRVD--KLWYKYLIVEESLAHFDIVRNLF 152

Query: 1644 EGLLADTPKRIDLWNVYVDQEIKAGDKKKVEDLFERIVNRKLTRKQAKFFFGKWLEFE 1701
            +   +  P    +W+ + D E++    + V +++ + V   L   Q    + KW+ FE
Sbjct: 153  QKWCSLEPA-AHVWDSFTDFEVRQERYEDVRNIYSKYV---LIHPQFS-TWRKWINFE 205

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 29/59 (49%)

Query: 1625 KFAQLEFAKGDQEQGRSLFEGLLADTPKRIDLWNVYVDQEIKAGDKKKVEDLFERIVNR 1683
            ++A  E  + D  + RS+FE  L      + LW  Y++ E+K G      ++ ER + +
Sbjct: 66   RYAVFEIEQHDMRRARSIFERALRVHISYVPLWIRYIESELKLGYINHARNILERAITK 124

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 37/79 (46%), Gaps = 7/79 (8%)

Query: 1465 DFERMIMGNPNSSVVWMNFMAFQLQLGEIDKARDVAERALKT-ISFREEAEKMNIWIGML 1523
            +FE  +  N      WM +  F+++  ++ +AR + ERAL+  IS+      + +WI  +
Sbjct: 49   EFEGYLKRNRLDVKQWMRYAVFEIEQHDMRRARSIFERALRVHISY------VPLWIRYI 102

Query: 1524 NLENTFGNESSLNEVFSRA 1542
              E   G  +    +  RA
Sbjct: 103  ESELKLGYINHARNILERA 121

>YER013W (PRP22) [1436] chr5 (178840..182277) Pre-mRNA splicing factor
            of DEAH box family, required for release of mature mRNA
            from the spliceosome [3438 bp, 1145 aa]
          Length = 1145

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 3/73 (4%)

Query: 1264 EIFEGSVKNVTDFGLFVKLDNTM--NVTGLAHKSEVADAPVNDLSTIFGAGDKVKAVVLK 1321
            +++EG V+N+T FG FV++  T   N  GL H SE++D    D   +   G  +   V+K
Sbjct: 179  KVYEGKVRNITTFGCFVQIFGTRMKNCDGLVHISEMSDQRTLDPHDVVRQGQHIFVEVIK 238

Query: 1322 VNAEKKQLSLGLK 1334
            +    K +SL +K
Sbjct: 239  IQNNGK-ISLSMK 250

>Scas_713.42
          Length = 699

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/219 (21%), Positives = 92/219 (42%), Gaps = 16/219 (7%)

Query: 1466 FERMIMGNPNSSVVWMNFMAFQLQLGEIDKARDVAERALKTISFREEAEKMNIWIGMLNL 1525
            FER ++ N +   +W+ ++  +L+L  I+ AR++ +RA+ T+      +K+  W   L +
Sbjct: 94   FERALLVNNSYIPLWIRYIDAELKLKCINHARNLLDRAITTLP---RVDKL--WYKYLFV 148

Query: 1526 ENTFGNESSLNEVFSRACQYMDSYVIHTKLINIYQMSHNIDXXXXXXXXXXXXXGSEKVP 1585
            E +  N   +  +F + C            ++     +N +                KV 
Sbjct: 149  EESLQNWDVVRSLFRKWCSLEPGINAWKSYVDFETRQNNWNNVREVYSKYVAIHP--KVA 206

Query: 1586 IWVSWGEFLIDQGQADEAH-------QVLASALKSLP--RRHHIEVVRKFAQLEFAKGDQ 1636
             W+SW +F +  G              VL    K+ P  +   IE    FA  E ++ + 
Sbjct: 207  TWLSWVKFEMVHGDVSTIRTVFSLGSDVLNEYEKTDPGFKEDCIEFAIAFANWEASQMEY 266

Query: 1637 EQGRSLFEGLLADTPKRIDLWNVYVDQEIKAGDKKKVED 1675
            ++ R++++ L+   P    L +  +D E + GD   +E+
Sbjct: 267  DRSRAIYKILIDKWPNDGKLQSGMIDFEKQFGDVSTMEE 305

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 45/92 (48%), Gaps = 3/92 (3%)

Query: 1586 IWVSWGEFLIDQGQADEAHQVLASALKSLPRRHHIEVVRKFAQLEFAKGDQEQGRSLFEG 1645
            IW+ + EF I Q     A ++L  +L   P+    +V R++ ++E +  + ++ R L+E 
Sbjct: 412  IWIMYSEFEIRQNDIGTARKILGRSLGLCPK---PKVFRRYIEIEISLREFDRVRRLYEK 468

Query: 1646 LLADTPKRIDLWNVYVDQEIKAGDKKKVEDLF 1677
             L   P  +  W  Y + E    D+++   +F
Sbjct: 469  FLEFDPSNLKTWIAYAELEQNLDDEERARSIF 500

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 47/98 (47%), Gaps = 3/98 (3%)

Query: 1584 VPIWVSWGEFLIDQGQADEAHQVLASALKSLPRRHHIEVVRKFAQLEFAKGDQEQGRSLF 1643
            +P+W+ + +  +     + A  +L  A+ +LPR   +    K+  +E +  + +  RSLF
Sbjct: 105  IPLWIRYIDAELKLKCINHARNLLDRAITTLPRVDKLWY--KYLFVEESLQNWDVVRSLF 162

Query: 1644 EGLLADTPKRIDLWNVYVDQEIKAGDKKKVEDLFERIV 1681
                +  P  I+ W  YVD E +  +   V +++ + V
Sbjct: 163  RKWCSLEPG-INAWKSYVDFETRQNNWNNVREVYSKYV 199

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 41/90 (45%), Gaps = 2/90 (2%)

Query: 1594 LIDQGQADEAHQVLASALKSLPRRHHIEV--VRKFAQLEFAKGDQEQGRSLFEGLLADTP 1651
            ++D  +  E      +  ++  RR+ ++V    ++A  E  + D  + RS+FE  L    
Sbjct: 43   ILDLEELKEYQGKKRTEFETYLRRNRLDVGQWMRYALFEVEQHDIRRARSVFERALLVNN 102

Query: 1652 KRIDLWNVYVDQEIKAGDKKKVEDLFERIV 1681
              I LW  Y+D E+K        +L +R +
Sbjct: 103  SYIPLWIRYIDAELKLKCINHARNLLDRAI 132

>Kwal_56.23875
          Length = 680

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 62/155 (40%), Gaps = 19/155 (12%)

Query: 1466 FERMIMGNPNSSVVWMNFMAFQLQLGEIDKARDVAERALKTISFREEAEKMNIWIGMLNL 1525
            FER +  N     +W+ ++  +L+   I+ AR++ +RA   +   E+     +W+  + +
Sbjct: 82   FERALQVNNQYVPLWIKYIDSELKAKNINHARNLLDRACNLLPRVEK-----LWLKYVIV 136

Query: 1526 ENTFGNESSLNEVFSRACQY------MDSYVIHTKLINIYQMSHNIDXXXXXXXXXXXXX 1579
            E + GN S +  +FSR C         D+YV        ++ +  +              
Sbjct: 137  EESLGNVSLVRSLFSRWCSLSPSKNAYDAYVGFETRCGEFEKARKV--------YSGYVS 188

Query: 1580 GSEKVPIWVSWGEFLIDQGQADEAHQVLASALKSL 1614
                V  W+ W  F    G  D   QV +  L +L
Sbjct: 189  VHPAVDTWLKWVAFEKRHGSLDTTRQVFSLGLDTL 223

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%)

Query: 1625 KFAQLEFAKGDQEQGRSLFEGLLADTPKRIDLWNVYVDQEIKAGDKKKVEDLFERIVN 1682
            ++A+ E  + D  + RS+FE  L    + + LW  Y+D E+KA +     +L +R  N
Sbjct: 64   RYAKFEIGQHDMRRARSIFERALQVNNQYVPLWIKYIDSELKAKNINHARNLLDRACN 121

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 22/100 (22%), Positives = 48/100 (48%), Gaps = 3/100 (3%)

Query: 1586 IWVSWGEFLIDQGQADEAHQVLASALKSLPRRHHIEVVRKFAQLEFAKGDQEQGRSLFEG 1645
            IWV + +F + Q    +A ++   AL + P++   ++ +++   E    + ++ R ++E 
Sbjct: 397  IWVMYSKFELRQENLAKARKIFGYALGTCPKQ---KIFKEYINFEIQLKEFDRVRKIYEQ 453

Query: 1646 LLADTPKRIDLWNVYVDQEIKAGDKKKVEDLFERIVNRKL 1685
            LLA  P     W  Y + E   GD+ +   ++   ++  L
Sbjct: 454  LLAFDPLSNANWIAYAELEENLGDEDRARGIYHIAISENL 493

>Kwal_55.21029
          Length = 1105

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 1264 EIFEGSVKNVTDFGLFVKLDNTMN--VTGLAHKSEVADAPVNDLSTIFGAGDKVKAVVLK 1321
            +I+ GSVK +T FG F+++  T +    GL H SE+A+  + D S +     +V   V++
Sbjct: 178  KIYSGSVKKITTFGCFIRIQGTKDPRCDGLLHISEMANRRLEDPSELVSLNQQVYVKVIR 237

Query: 1322 VNAEKKQLSLGLK 1334
            +    K +SL +K
Sbjct: 238  IQNNGK-ISLRMK 249

>AGL184W [4128] [Homologous to ScYLR117C (CLF1) - SH]
            complement(350805..352856) [2052 bp, 683 aa]
          Length = 683

 Score = 38.9 bits (89), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%)

Query: 1625 KFAQLEFAKGDQEQGRSLFEGLLADTPKRIDLWNVYVDQEIKAGDKKKVEDLFER 1679
            ++A  E+ + D  + RS+FE  LA  P  + +W  YVD E++A D     +L  R
Sbjct: 65   RYAAFEYEQRDMRRARSVFERALAVAPGDVVVWLRYVDCELRARDVNHARNLLVR 119

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 45/92 (48%), Gaps = 3/92 (3%)

Query: 1587 WVSWGEFLIDQGQADEAHQVLASALKSLPRRHHIEVVRKFAQLEFAKGDQEQGRSLFEGL 1646
            W+ + EF I Q + D+A ++L  +L   P+    ++ + +  LE    + ++ R L E L
Sbjct: 398  WIMYAEFEIRQEKLDKARKILGMSLGMCPK---PKLFQYYIDLEIKLKEFDRVRRLHEKL 454

Query: 1647 LADTPKRIDLWNVYVDQEIKAGDKKKVEDLFE 1678
            L   P  +  W  Y + E   GD+ +   ++E
Sbjct: 455  LEFQPDVLSNWIEYAELEENLGDEDRARGIYE 486

 Score = 35.4 bits (80), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 42/221 (19%), Positives = 86/221 (38%), Gaps = 14/221 (6%)

Query: 1466 FERMIMGNPNSSVVWMNFMAFQLQLGEIDKARDVAERALKTISFREEAEKMNIWIGMLNL 1525
            FER +   P   VVW+ ++  +L+  +++ AR++  RA   +   +      +W   + +
Sbjct: 83   FERALAVAPGDVVVWLRYVDCELRARDVNHARNLLVRATALLPRVD-----KLWYKYVLM 137

Query: 1526 ENTFGNESSLNEVFSRACQYMDSYVIHTKLINIYQMSHNIDXXXXXXXXXXXXXGSEKVP 1585
            E + G    +  V+++ C    +       ++       ++                   
Sbjct: 138  EESLGQVELVRGVYTKWCTLEPAAAAWDAFVDFETRQGQVEHVREVYSRYVMVHPV--AA 195

Query: 1586 IWVSWGEFLIDQGQADEAHQVLASALKSLPRR-----HHIE-VVRKFAQLEFAKGDQEQG 1639
             W+ W  F    G A    +V + A  +L        H +E +V  FA+ E  + + E+ 
Sbjct: 196  TWLKWVAFERKHGDAGTVRRVYSLACDTLTAFAGADVHEVEQLVVSFAEWEATQQELERS 255

Query: 1640 RSLFEGLLADTPKRIDLWNVYVDQEIKAGDKKKVED-LFER 1679
            R++    ++  P+   L +     E K G  +  E  LF+R
Sbjct: 256  RAVLSVAVSRWPESSTLKDATAQLEKKFGGARAGESILFKR 296

>CAGL0F02915g 281010..283517 similar to sp|Q04048 Saccharomyces
            cerevisiae YDR416w SYF1 synthetic lethal with CDC40,
            hypothetical start
          Length = 835

 Score = 38.5 bits (88), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 45/90 (50%), Gaps = 4/90 (4%)

Query: 1601 DEAHQVLASALKSLPRRHHIEVVRKFAQLEFAKGDQEQGRSLFE--GLLADTPKRIDLWN 1658
            D   Q+L+  ++ LP    I  V KF +LE +  D  + R L +    L    K  +LW 
Sbjct: 710  DSLRQLLSECIQELPNSKAITYVLKFTKLEMSLSDYTRARELLQYGAQLLPPIKNEELWG 769

Query: 1659 VYVDQEIKAGDKKKVEDLFERIVNRKLTRK 1688
            ++   E++ GDK   +++   ++ +KL ++
Sbjct: 770  LWEQFELEHGDKSYYKEML--LLKQKLEKE 797

>KLLA0B11638g complement(1020591..1023926) similar to sp|P24384
            Saccharomyces cerevisiae YER013w PRP22 pre-mRNA splicing
            factor, start by similarity
          Length = 1111

 Score = 38.5 bits (88), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 41/75 (54%), Gaps = 5/75 (6%)

Query: 1264 EIFEGSVKNVTDFGLFVKL---DNTMNVTGLAHKSEVADAPVNDLSTIFGAGDKVKAVVL 1320
            +++ G V+NVT FG FV++    NT NV GL H SE++ + V+    +      V   V+
Sbjct: 180  KVYPGKVQNVTKFGCFVRIFGVRNT-NVDGLVHVSELSSSHVDKPEDVVHRNQDVFVKVI 238

Query: 1321 KVNAEKKQLSLGLKA 1335
            K+    K +SL +K 
Sbjct: 239  KIQNNGK-ISLAMKG 252

>AAR020W [206] [Homologous to ScYER013W (PRP22) - SH]
            complement(376250..379588) [3339 bp, 1112 aa]
          Length = 1112

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 2/73 (2%)

Query: 1263 GEIFEGSVKNVTDFGLFVK-LDNTMNVTGLAHKSEVADAPVNDLSTIFGAGDKVKAVVLK 1321
            G+I+   ++N+  FG F + L    +  GL H S+++ + V   + +   GD V   + K
Sbjct: 183  GKIYRAVIRNIKPFGCFARVLGTKRSCEGLIHISQLSHSRVGSPNDVVSVGDHVYVKITK 242

Query: 1322 VNAEKKQLSLGLK 1334
            V    K LSL ++
Sbjct: 243  VQDNGK-LSLSMR 254

>YLR117C (CLF1) [3530] chr12 complement(382472..384535) Essential
            pre-mRNA splicing factor that plays a role in the
            initiation of DNA replication, has tetratricopeptide
            (TPR) repeats and has similarity to Drosophila crooked
            neck (crn) protein, component of Prp19p-associated
            complex [2064 bp, 687 aa]
          Length = 687

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/92 (21%), Positives = 45/92 (48%), Gaps = 3/92 (3%)

Query: 1586 IWVSWGEFLIDQGQADEAHQVLASALKSLPRRHHIEVVRKFAQLEFAKGDQEQGRSLFEG 1645
            IW+ + +FLI      +A ++L  A+   P+    +  + + +LE    + ++ R ++E 
Sbjct: 406  IWLMYAKFLIRHDDVPKARKILGKAIGLCPK---AKTFKGYIELEVKLKEFDRVRKIYEK 462

Query: 1646 LLADTPKRIDLWNVYVDQEIKAGDKKKVEDLF 1677
             +   P  + +W+ Y + E   GD  +V  ++
Sbjct: 463  FIEFQPSDLQIWSQYGELEENLGDWDRVRGIY 494

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 28/58 (48%)

Query: 1625 KFAQLEFAKGDQEQGRSLFEGLLADTPKRIDLWNVYVDQEIKAGDKKKVEDLFERIVN 1682
            ++AQ E  + D  + RS+FE  L      I LW  Y+D E+K        +L  R ++
Sbjct: 70   RYAQFEIEQHDMRRARSIFERALLVDSSFIPLWIRYIDAELKVKCINHARNLMNRAIS 127

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 32/195 (16%), Positives = 79/195 (40%), Gaps = 16/195 (8%)

Query: 1466 FERMIMGNPNSSVVWMNFMAFQLQLGEIDKARDVAERALKTISFREEAEKMNIWIGMLNL 1525
            FER ++ + +   +W+ ++  +L++  I+ AR++  RA+ T+      +K+  W   L +
Sbjct: 88   FERALLVDSSFIPLWIRYIDAELKVKCINHARNLMNRAISTLP---RVDKL--WYKYLIV 142

Query: 1526 ENTFGNESSLNEVFSRACQYMDSYVIHTKLINIYQMSHNIDXXXXXXXXXXXXXGSEKVP 1585
            E +  N   +  ++++ C            ++      N +                ++ 
Sbjct: 143  EESLNNVEIVRSLYTKWCSLEPGVNAWNSFVDFEIRQKNWN--GVREIYSKYVMAHPQMQ 200

Query: 1586 IWVSWGEFLIDQGQADEAHQVLASALKSLPRRHHIEV---------VRKFAQLEFAKGDQ 1636
             W+ W  F    G  +    V + A+ ++    ++++         V  FA  E A+ + 
Sbjct: 201  TWLKWVRFENRHGNTEFTRSVYSLAIDTVANLQNLQIWSDMEVAKLVNSFAHWEAAQQEY 260

Query: 1637 EQGRSLFEGLLADTP 1651
            E+  +L++  +   P
Sbjct: 261  ERSSALYQIAIEKWP 275

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 58/118 (49%), Gaps = 7/118 (5%)

Query: 1584 VPIWVSWGEFLIDQGQADEAHQVLASALKSLPRRHHIEVVRKFAQLEFAKGDQEQGRSLF 1643
            +P+W+ + +  +     + A  ++  A+ +LPR   +    K+  +E +  + E  RSL+
Sbjct: 99   IPLWIRYIDAELKVKCINHARNLMNRAISTLPRVDKLWY--KYLIVEESLNNVEIVRSLY 156

Query: 1644 EGLLADTPKRIDLWNVYVDQEIKAGDKKKVEDLFERIVNRKLTRKQAKFFFGKWLEFE 1701
                +  P  ++ WN +VD EI+  +   V +++ + V   +   Q + +  KW+ FE
Sbjct: 157  TKWCSLEPG-VNAWNSFVDFEIRQKNWNGVREIYSKYV---MAHPQMQTWL-KWVRFE 209

>Scas_617.9
          Length = 302

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 37/72 (51%)

Query: 1261 KVGEIFEGSVKNVTDFGLFVKLDNTMNVTGLAHKSEVADAPVNDLSTIFGAGDKVKAVVL 1320
            +V +I   +V+ + + G +VKL    N+ G+   SE++   +  +  +   G    AVVL
Sbjct: 15   EVDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVL 74

Query: 1321 KVNAEKKQLSLG 1332
            +V+ EK  + L 
Sbjct: 75   RVDKEKGYIDLS 86

>Scas_479.2
          Length = 302

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 37/72 (51%)

Query: 1261 KVGEIFEGSVKNVTDFGLFVKLDNTMNVTGLAHKSEVADAPVNDLSTIFGAGDKVKAVVL 1320
            +V +I   +V+ + + G +VKL    N+ G+   SE++   +  +  +   G    AVVL
Sbjct: 15   EVDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVL 74

Query: 1321 KVNAEKKQLSLG 1332
            +V+ EK  + L 
Sbjct: 75   RVDKEKGYIDLS 86

>YJR007W (SUI2) [2909] chr10 (450934..451848) Translation initiation
            factor eIF2alpha subunit [915 bp, 304 aa]
          Length = 304

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 37/72 (51%)

Query: 1261 KVGEIFEGSVKNVTDFGLFVKLDNTMNVTGLAHKSEVADAPVNDLSTIFGAGDKVKAVVL 1320
            ++ +I   +V+ + + G +VKL    N+ G+   SE++   +  +  +   G    AVVL
Sbjct: 15   EIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVL 74

Query: 1321 KVNAEKKQLSLG 1332
            +V+ EK  + L 
Sbjct: 75   RVDKEKGYIDLS 86

>Scas_570.11
          Length = 858

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 39/85 (45%), Gaps = 4/85 (4%)

Query: 1603 AHQVLASALKSLPRRHHIEVVRKFAQLEFAKGDQEQGRSLFE--GLLADTPKRIDLWNVY 1660
            + Q+    ++ +P       +  FA  E + G+  + R + E    L    K   LWN +
Sbjct: 733  SRQIYEDCIQQVPNSKSAPYIIGFADAETSGGEITRSREILEYGARLIPPAKNTSLWNYW 792

Query: 1661 VDQEIKAGDKKKVEDLFERIVNRKL 1685
               E+K GDK+  +D+ +  + RKL
Sbjct: 793  ETFELKHGDKETYKDMLK--LKRKL 815

>Sklu_2413.4 YJR109C, Contig c2413 10886-14254
          Length = 1122

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 56/120 (46%), Gaps = 18/120 (15%)

Query: 525 QLSILGGQFKASVPPLHI------SDIR------LVYPERKFKIGSKVKAILISANNRGH 572
           ++  L  +F AS   L+       SDI       LV     ++IGS V+    + N    
Sbjct: 551 KIDTLAAEFPASTNYLYTTYNATKSDIEFNDNGMLVLGSGVYRIGSSVEFDWCAVNTARA 610

Query: 573 LFVSLKKS-LVNLDREEVQLASSFQDIDRIATDGLKVAATVDIFK---TNGCVVSFLGGL 628
           L    KK+ ++N + E V  ++ F ++DR+  + L     +DI++   + GCV+S  G L
Sbjct: 611 LREEGKKTIMINYNPETV--STDFDEVDRLYFEELSFERVMDIYELENSEGCVISVGGQL 668

>KLLA0D14663g 1238190..1239416 similar to sp|Q06103 Saccharomyces
            cerevisiae YPR108w RPN7 subunit of the regulatory
            particle of the proteasome singleton, start by similarity
          Length = 408

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 1/68 (1%)

Query: 1582 EKVPIWVSWGEFLIDQGQADEAHQVLASAL-KSLPRRHHIEVVRKFAQLEFAKGDQEQGR 1640
            EK   W++ GE+    G  D A + L  AL K++     I+++    +L F   DQ   +
Sbjct: 107  EKAQSWINLGEYYAKIGDKDNAEETLTKALDKAVSTGAKIDIMLTITRLGFFYNDQHYVK 166

Query: 1641 SLFEGLLA 1648
               EG+ A
Sbjct: 167  QKLEGVNA 174

>AGR320W [4631] [Homologous to ScYJR007W (SUI2) - SH]
            complement(1330185..1331093) [909 bp, 302 aa]
          Length = 302

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 36/72 (50%)

Query: 1261 KVGEIFEGSVKNVTDFGLFVKLDNTMNVTGLAHKSEVADAPVNDLSTIFGAGDKVKAVVL 1320
            +V ++   +V+ + + G +VKL    N+ G+   SE++   +  +  +   G     VVL
Sbjct: 15   EVDDVVMVNVQQIAEMGAYVKLLEYDNIEGMVLLSELSRRRIRSIHKLIRVGKNEVVVVL 74

Query: 1321 KVNAEKKQLSLG 1332
            +V+ EK  + L 
Sbjct: 75   RVDKEKGYIDLS 86

>Scas_594.1
          Length = 651

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 22/29 (75%)

Query: 1655 DLWNVYVDQEIKAGDKKKVEDLFERIVNR 1683
            DL+N + +  +K G+ +K+ED+F+R +NR
Sbjct: 3    DLFNAWYESXLKIGNLQKLEDIFKRPINR 31

>KLLA0F03190g complement(296883..300236) highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2 arginine-specific
           carbamoylphosphate synthase, large chain, start by
           similarity
          Length = 1117

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 42/79 (53%), Gaps = 6/79 (7%)

Query: 554 FKIGSKVKAILISANNRGHLFVSLKKS-LVNLDREEVQLASSFQDIDRIATDGLKVAATV 612
           ++IGS V+    + N    L    KK+ ++N + E V  ++ F ++DR+  + L     +
Sbjct: 589 YRIGSSVEFDWCAVNTTKALRKEGKKTIMINYNPETV--STDFDEVDRLYFEELSFERVM 646

Query: 613 DIFK---TNGCVVSFLGGL 628
           DI++   + GCV+S  G L
Sbjct: 647 DIYELENSEGCVISVGGQL 665

>Kwal_33.15422
          Length = 302

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 36/72 (50%)

Query: 1261 KVGEIFEGSVKNVTDFGLFVKLDNTMNVTGLAHKSEVADAPVNDLSTIFGAGDKVKAVVL 1320
            +V ++   +V+ + + G +VKL    N+ G+   SE++   +  +  +   G     VVL
Sbjct: 15   EVDDVVMVNVQQIAEMGAYVKLLEYDNIEGMVLLSELSRRRIRSIQKLIRVGRNEVVVVL 74

Query: 1321 KVNAEKKQLSLG 1332
            +V+ EK  + L 
Sbjct: 75   RVDKEKGYIDLS 86

>Kwal_26.8439
          Length = 1146

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 4/70 (5%)

Query: 1490 LGEIDKARDVAERALKTISFREEAEKMN----IWIGMLNLENTFGNESSLNEVFSRACQY 1545
            +  ID+ R+  E   K ISF    +  +     W+G LN   T  NE    E+  R+  +
Sbjct: 713  VSNIDERRNDYESITKGISFTRSRQIPHHDAIFWLGDLNYRLTLSNEEVRRELTDRSGDF 772

Query: 1546 MDSYVIHTKL 1555
             D  ++H +L
Sbjct: 773  PDRLLVHDQL 782

>YDR416W (SYF1) [1241] chr4 (1298420..1300999) Pre-mRNA splicing
            factor with similarity to Drosophila crn protein, has
            tetratricopeptide (TPR) repeats, component of
            Prp19p-associated complex (Syf1p, Clf1p, Prp19p, Cef1p,
            Isy1p, Snt309p, Ntc20p, Syf2p) [2580 bp, 859 aa]
          Length = 859

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 37/75 (49%), Gaps = 2/75 (2%)

Query: 1605 QVLASALKSLPRRHHIEVVRKFAQLEFAKGDQEQGRSL--FEGLLADTPKRIDLWNVYVD 1662
            ++    ++ LP    +E V KF+  E + G+  + R +  +   L    +  +LW+ +  
Sbjct: 727  ELYQECIQILPNSKAVEFVIKFSDFESSIGETIRAREILAYGAKLLPPSRNTELWDSFEI 786

Query: 1663 QEIKAGDKKKVEDLF 1677
             E+K GDK+  +D+ 
Sbjct: 787  FELKHGDKETYKDML 801

>CAGL0B03795g 376266..377177 highly similar to sp|P20459 Saccharomyces
            cerevisiae YJR007w SUI2, translation initiation factor
            eIF2, start by similarity
          Length = 303

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 31/62 (50%)

Query: 1271 KNVTDFGLFVKLDNTMNVTGLAHKSEVADAPVNDLSTIFGAGDKVKAVVLKVNAEKKQLS 1330
            + + + G +VKL    N+ G+   SE++   +  +  +   G    AVVL+V+ EK  + 
Sbjct: 25   QQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVLRVDKEKGYID 84

Query: 1331 LG 1332
            L 
Sbjct: 85   LS 86

>Sklu_2031.3 YBL054W, Contig c2031 3063-4811
          Length = 582

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (56%), Gaps = 7/60 (11%)

Query: 371 SSGKKNDEAYSVGSNTRVRILATLMNKAGEKFVVVSELPHILSFAT---EALERPALNAF 427
           SSGK+     S G+ TR     TLMN +G K+V+ S+  H  S AT   +A + P+LN+ 
Sbjct: 522 SSGKERSPTVSDGT-TRSN---TLMNTSGFKYVLPSQAHHPHSVATATPQATQLPSLNSI 577

>YOR290C (SNF2) [5074] chr15 complement(855144..860255) Component of
            SWI-SNF global transcription activator complex, acts to
            assist gene-specific activators through chromatin
            remodeling, involved in sensitivity to UV irradiation
            [5112 bp, 1703 aa]
          Length = 1703

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 73/176 (41%), Gaps = 37/176 (21%)

Query: 1032 DLTDESSQHNANIEDAF-----PLGSALRATVVKIDQDRNTLSVSGRSHSVSDIKDINVG 1086
            D   ES++ NA + D +     PL  A+R  V++ +  +N+L  +   + +S I++INV 
Sbjct: 519  DECTESTRENA-LYDYYALQLLPLQKAVRGHVLQFEWHQNSLLTNTHPNFLSKIRNINVQ 577

Query: 1087 DNLPARLLNVADSYLLLEVGKDVKGVAFVTDALDDYTKSLKDVYGNQKNNIFSAKVISVD 1146
            D L    L      L LE  K  + VA +        KS+     NQ N          D
Sbjct: 578  DALLTNQLYKNHELLKLE-RKKTEAVARL--------KSMNKSAINQYNR-------RQD 621

Query: 1147 TKNGKLNLSLRSEDAQDGNVKTHKDLKRGQIVRGLVK--------KATDKGIFVYL 1194
             KN +L    R        + TH +L+R +  R   K        KA D+  ++ L
Sbjct: 622  KKNKRLKFGHRL-------IATHTNLERDEQKRAEKKAKERLQALKANDEEAYIKL 670

>YJR109C (CPA2) [3001] chr10 complement(629500..632856)
           Carbamoylphosphate synthetase of arginine biosynthetic
           pathway, synthetase (large) subunit [3357 bp, 1118 aa]
          Length = 1118

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 42/79 (53%), Gaps = 6/79 (7%)

Query: 554 FKIGSKVKAILISANNRGHLFVSLKKS-LVNLDREEVQLASSFQDIDRIATDGLKVAATV 612
           ++IGS V+    + N    L    KK+ ++N + E V  ++ F ++DR+  + L     +
Sbjct: 589 YRIGSSVEFDWCAVNTAKTLRDQGKKTIMINYNPETV--STDFDEVDRLYFEELSYERVM 646

Query: 613 DIF---KTNGCVVSFLGGL 628
           DI+   ++ GC++S  G L
Sbjct: 647 DIYELEQSEGCIISVGGQL 665

>Scas_691.19
          Length = 1117

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 57/120 (47%), Gaps = 18/120 (15%)

Query: 525 QLSILGGQFKASVPPLHIS------DIR------LVYPERKFKIGSKVKAILISANNRGH 572
           ++  L  +F A+   L+I+      D+       LV     ++IGS V+    + N    
Sbjct: 548 RIDTLAAEFPATTNYLYITYNATKNDVEFDDHGMLVLGSGVYRIGSSVEFDWCAVNTAKT 607

Query: 573 LFVSLKKS-LVNLDREEVQLASSFQDIDRIATDGLKVAATVDIF---KTNGCVVSFLGGL 628
           L    KK+ ++N + E V  ++ F ++DR+  + L     +DI+   ++ GC++S  G L
Sbjct: 608 LRDEGKKTIMINYNPETV--STDFDEVDRLYFEELSYERVMDIYELEQSEGCIISVGGQL 665

>YBR112C (CYC8) [302] chr2 complement(462826..465726) General
            repressor of RNA polymerase II transcription that is
            brought to target promoters by sequence-specific
            DNA-binding proteins, Sko1p-Ssn6p-Tup1p complex undergoes
            Hog1p-dependent conversion to a transcriptional activator
            [2901 bp, 966 aa]
          Length = 966

 Score = 31.6 bits (70), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 36/76 (47%), Gaps = 3/76 (3%)

Query: 1466 FERMIMGNPNSSVVWMNFMAFQLQLGEIDKARDVAERALKTISFREEAEKMNIWIGMLNL 1525
            +ER ++ NP  S VW       L L ++ +A +  ++AL  +S         +W G+  L
Sbjct: 103  YERALLVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLS---NPNVPKLWHGIGIL 159

Query: 1526 ENTFGNESSLNEVFSR 1541
             + +G+     E F++
Sbjct: 160  YDRYGSLDYAEEAFAK 175

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.133    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 50,446,669
Number of extensions: 2146683
Number of successful extensions: 6832
Number of sequences better than 10.0: 54
Number of HSP's gapped: 6873
Number of HSP's successfully gapped: 82
Length of query: 1701
Length of database: 16,596,109
Length adjustment: 116
Effective length of query: 1585
Effective length of database: 12,580,421
Effective search space: 19939967285
Effective search space used: 19939967285
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)