Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.917655152420150.0
KLLA0B08305g7353399421e-119
AFR563C5762789101e-116
YMR227C (TAF7)5902348371e-105
Scas_594.66553148291e-103
CAGL0M11264g5492277521e-92
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.9176
         (543 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.9176                                                          780   0.0  
KLLA0B08305g 737967..740174 some similarities with sp|Q05021 Sac...   367   e-119
AFR563C [3755] [Homologous to ScYMR227C (TAF67) - SH] (1444641.....   355   e-116
YMR227C (TAF7) [4183] chr13 complement(722612..724384) Component...   327   e-105
Scas_594.6                                                            323   e-103
CAGL0M11264g complement(1106912..1108561) similar to sp|Q05021 S...   294   1e-92

>Kwal_26.9176
          Length = 551

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/524 (77%), Positives = 405/524 (77%)

Query: 11  ELENADAEPQLKKIKLKTKGSADIGKGSSGLKVKLAKKDGSAEQDKANVGGIKLKINLGX 70
           ELENADAEPQLKKIKLKTKGSADIGKGSSGLKVKLAKKDGSAEQDKANVGGIKLKINLG 
Sbjct: 11  ELENADAEPQLKKIKLKTKGSADIGKGSSGLKVKLAKKDGSAEQDKANVGGIKLKINLGS 70

Query: 71  XXXXXXXXXXXXXXXRFRIKPVRVPGEGYDSEASDIEDDPLIEEGVILRVLPDVQTEFVK 130
                          RFRIKPVRVPGEGYDSEASDIEDDPLIEEGVILRVLPDVQTEFVK
Sbjct: 71  KETSSSTASAPPKAPRFRIKPVRVPGEGYDSEASDIEDDPLIEEGVILRVLPDVQTEFVK 130

Query: 131 NCIESGDFSGLSLKWKGERHAVVKINGYQYGAVLVNLPTTIEVNKSIDRKNLLKTFDVSQ 190
           NCIESGDFSGLSLKWKGERHAVVKINGYQYGAVLVNLPTTIEVNKSIDRKNLLKTFDVSQ
Sbjct: 131 NCIESGDFSGLSLKWKGERHAVVKINGYQYGAVLVNLPTTIEVNKSIDRKNLLKTFDVSQ 190

Query: 191 MLLCVRTIDHEEEVFSLVPPDSEDLVTKHYDEYKNEIIECKKTLYRGFNGGPLTDAEANN 250
           MLLCVRTIDHEEEVFSLVPPDSEDLVTKHYDEYKNEIIECKKTLYRGFNGGPLTDAEANN
Sbjct: 191 MLLCVRTIDHEEEVFSLVPPDSEDLVTKHYDEYKNEIIECKKTLYRGFNGGPLTDAEANN 250

Query: 251 IDNIVKKGYDYKHGLTPPLYNVXXXXXXXXLTTQEVDYVEKTVEHLLEQDAEAEGVSYDL 310
           IDNIVKKGYDYKHGLTPPLYNV        LTTQEVDYVEKTVEHLLEQDAEAEGVSYDL
Sbjct: 251 IDNIVKKGYDYKHGLTPPLYNVRNRRFRRRLTTQEVDYVEKTVEHLLEQDAEAEGVSYDL 310

Query: 311 VDEDILAQRSASADELRQQSADSGIDLFGXXXXXXXXXXXXQALQEDRGPIEQNVSDSCV 370
           VDEDILAQRSASADELRQQSADSGIDLFG            QALQEDRGPIEQNVSDSCV
Sbjct: 311 VDEDILAQRSASADELRQQSADSGIDLFGEDDHEDLEMELEQALQEDRGPIEQNVSDSCV 370

Query: 371 PAVEETXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVPNVTKPAVDEERQHSXXXXXXXXX 430
           PAVEET                            IVPNVTKPAVDEERQHS         
Sbjct: 371 PAVEETGDDVEQDNGEDDDEDEEEEDVEDEGDEDIVPNVTKPAVDEERQHSELLQDELEE 430

Query: 431 XXXXXHQNKQKLEKATNPLLKSRFIESIXXXXXXXXXXXXXXXIGHEQSANRSESVAQSV 490
                HQNKQKLEKATNPLLKSRFIESI               IGHEQSANRSESVAQSV
Sbjct: 431 LESTLHQNKQKLEKATNPLLKSRFIESIKKLEKEVELKRKQLKIGHEQSANRSESVAQSV 490

Query: 491 XXXXXXXXXXXXXXXXXXXXXXXXXXAGPMVPATSIQKPATEEL 534
                                     AGPMVPATSIQKPATEEL
Sbjct: 491 EDGEEDEDEEEEEDVDEDDDEDDDDEAGPMVPATSIQKPATEEL 534

>KLLA0B08305g 737967..740174 some similarities with sp|Q05021
           Saccharomyces cerevisiae YMR227c TAF67 TFIID subunit
           (TBP-associated factor), 67 kD singleton, hypothetical
           start
          Length = 735

 Score =  367 bits (942), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 196/339 (57%), Positives = 233/339 (68%), Gaps = 29/339 (8%)

Query: 17  AEPQLKKIKLKTKGSADIG---KGSSGLKVKLAKKDGSAEQD---KANVGG-------IK 63
            EP+LKKIKLKT GS+      K +  LK+KL K+D   ++D     NVG        +K
Sbjct: 47  TEPKLKKIKLKTGGSSSSSNNSKPAPKLKIKLKKRDNQEDKDISNNNNVGTSKGSSRPMK 106

Query: 64  LKINLGXXXXX---------------XXXXXXXXXXXRFRIKPVRVPGEGYDSEASDIED 108
           LKINL                                +FRIKPVRVPGEGYDSEASD+ED
Sbjct: 107 LKINLKKREDSHPQLVPHSQSHQQQQQRKSTSVVKTPKFRIKPVRVPGEGYDSEASDVED 166

Query: 109 DPLIEEGVILRVLPDVQTEFVKNCIESGDFSGLSLKWKGERHAVVKINGYQYGAVLVNLP 168
           DPLIEEG+ILRVLPD+  EFVKN IESGD+S +S+KWKGERHAVVK+NG QYGAVLVNLP
Sbjct: 167 DPLIEEGIILRVLPDLSAEFVKNSIESGDYSDVSIKWKGERHAVVKVNGVQYGAVLVNLP 226

Query: 169 TTIEVNKSIDRKNLLKTFDVSQMLLCVRTIDHEEEVFSLVPPDSEDLVTKHYDEYKNEII 228
           + IEVNKS+DRKNLLKTFDVSQML+CVRT++ EEEVFSL   D+EDL  KH++EY+ EI 
Sbjct: 227 SIIEVNKSVDRKNLLKTFDVSQMLICVRTVNKEEEVFSLQVSDTEDLTKKHFEEYQKEIT 286

Query: 229 ECKKTLYRGFNGGPLTDAEANNIDNIVKKGYDYKHGLTPPLYNVXXXXXXXXLTTQEVDY 288
           E +K   RG+NGGPLTDAE+ NI+ I+ K YDYKHG+TPPLYN         +     DY
Sbjct: 287 EQRKQQLRGYNGGPLTDAESKNIEQIINKRYDYKHGITPPLYNARNRRFRHRMGPTAFDY 346

Query: 289 VEKTVEHLLEQDAEAEGVSYDLVDED-ILAQRSASADEL 326
           VE+TVE LL+ DAEAE   Y+LV+ED I  QRS SA +L
Sbjct: 347 VERTVEKLLKLDAEAEEFGYELVNEDAIQQQRSTSAADL 385

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 22/46 (47%)

Query: 413 AVDEERQHSXXXXXXXXXXXXXXHQNKQKLEKATNPLLKSRFIESI 458
             +EE QH                 N+ K  + TNPLLK+RF+ESI
Sbjct: 534 GANEEEQHRELLLDELRELESTLELNRNKASRTTNPLLKTRFLESI 579

>AFR563C [3755] [Homologous to ScYMR227C (TAF67) - SH]
           (1444641..1446371) [1731 bp, 576 aa]
          Length = 576

 Score =  355 bits (910), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 170/278 (61%), Positives = 211/278 (75%), Gaps = 4/278 (1%)

Query: 62  IKLKINLGXXXXXXXXXXXXXXXX-RFRIKPVRVPGEGYDSEASDIEDDPLIEEGVILRV 120
           +KLK+NL                  R R+KP R+PGEGYDSEASDIEDDPL+EEG+ILRV
Sbjct: 73  VKLKLNLKKDTPPTSVPASALTKAPRIRVKPPRIPGEGYDSEASDIEDDPLMEEGIILRV 132

Query: 121 LPDVQTEFVKNCIESGDFSGLSLKWKGERHAVVKINGYQYGAVLVNLPTTIEVNKSIDRK 180
           LPD+Q EFVKN IESGD+S +S+KWKGERHAVV ING+QYGAVLVNLPT IEVNKS+DRK
Sbjct: 133 LPDLQAEFVKNSIESGDYSNISIKWKGERHAVVSINGHQYGAVLVNLPTVIEVNKSVDRK 192

Query: 181 NLLKTFDVSQMLLCVRTIDHEEEVFSLVPPDSEDLVTKHYDEYKNEIIECKKTLYRGFNG 240
           N+LK FDVSQMLLCV  I  EE+VF L PPD+EDLV KH++ Y+ EI + +K + +GF G
Sbjct: 193 NMLKAFDVSQMLLCVALISREEDVFDLQPPDTEDLVKKHFENYEKEICDARKIMIQGFQG 252

Query: 241 GPLTDAEANNIDNIVKKGYDYKHGLTPPLYNVXXXXXXXXLTTQEVDYVEKTVEHLLEQD 300
           G LTDAE+ ++D I++KGYDYKHG+T PLYNV        +T  E+DYV++TVE LL+QD
Sbjct: 253 GSLTDAESKHMDAILEKGYDYKHGITAPLYNVRNRRFRRRMTGSEIDYVDRTVEFLLKQD 312

Query: 301 AEAEGVSYDLVDEDILAQRSASADEL---RQQSADSGI 335
            EAE  +Y+LVDED + Q+SAS  +L    Q++A SG+
Sbjct: 313 GEAEEFTYELVDEDAVLQKSASTIDLAHFAQKAAASGV 350

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/23 (73%), Positives = 20/23 (86%)

Query: 436 HQNKQKLEKATNPLLKSRFIESI 458
            QN+ KL KATNPLLKSRF++SI
Sbjct: 456 QQNRDKLAKATNPLLKSRFVDSI 478

>YMR227C (TAF7) [4183] chr13 complement(722612..724384) Component of
           the TAF(II) complex (TBP-associated factor), required
           for activated transcription by RNA polymerase II [1773
           bp, 590 aa]
          Length = 590

 Score =  327 bits (837), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 150/234 (64%), Positives = 185/234 (79%)

Query: 86  RFRIKPVRVPGEGYDSEASDIEDDPLIEEGVILRVLPDVQTEFVKNCIESGDFSGLSLKW 145
           + R+KP+R+PGE YDSEASDIEDDPLIE GVILR+LPD+Q EFVKN +ESGD+SG+S+KW
Sbjct: 86  KLRLKPIRIPGEAYDSEASDIEDDPLIESGVILRILPDIQLEFVKNSLESGDYSGISIKW 145

Query: 146 KGERHAVVKINGYQYGAVLVNLPTTIEVNKSIDRKNLLKTFDVSQMLLCVRTIDHEEEVF 205
           K ERHAVV IN   YGA+LV+LPT IEVNKS+DRKNLLKTFDVSQMLLC+R I  EEEV+
Sbjct: 146 KNERHAVVTINDVMYGAILVDLPTVIEVNKSVDRKNLLKTFDVSQMLLCIRPIQEEEEVY 205

Query: 206 SLVPPDSEDLVTKHYDEYKNEIIECKKTLYRGFNGGPLTDAEANNIDNIVKKGYDYKHGL 265
           +L  PD+EDLV KH++  ++EI E K+T  +G+NG PL+D EA ++  I  KGYDYKHG+
Sbjct: 206 ALEAPDTEDLVVKHFEGIEDEIWENKETFLKGYNGAPLSDMEAKHLKEIALKGYDYKHGI 265

Query: 266 TPPLYNVXXXXXXXXLTTQEVDYVEKTVEHLLEQDAEAEGVSYDLVDEDILAQR 319
           +PPLYNV        +   E+DYVEK V+ LL+QD +AE VSYDLVD+  L  R
Sbjct: 266 SPPLYNVRNRRFRRKMDPNEIDYVEKVVDMLLKQDKQAEEVSYDLVDKSELQAR 319

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 24/44 (54%)

Query: 415 DEERQHSXXXXXXXXXXXXXXHQNKQKLEKATNPLLKSRFIESI 458
           DE RQH+                 K KL KATNPLLKSRFI+SI
Sbjct: 436 DENRQHTELLADELNELETTLAHTKHKLSKATNPLLKSRFIDSI 479

>Scas_594.6
          Length = 655

 Score =  323 bits (829), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 170/314 (54%), Positives = 215/314 (68%), Gaps = 5/314 (1%)

Query: 13  ENADAEPQLKKIKLKTKGSAD--IGKGSSGLKVKLAKKDGSAEQDKANVGG-IKLKINLG 69
           ++ + EP+LKKI++KTK   +  I K    LK+ L K+  +       VGG +KLK++  
Sbjct: 42  DSTNKEPKLKKIRIKTKNKDNEQIPKKPK-LKISLKKRKVTDPLMDKPVGGPLKLKLH-R 99

Query: 70  XXXXXXXXXXXXXXXXRFRIKPVRVPGEGYDSEASDIEDDPLIEEGVILRVLPDVQTEFV 129
                           R R+KP+R+PGEGYDSEASDIEDDPLIE G+ILRVLPD+Q EFV
Sbjct: 100 KPSASPIVEKKVHKAPRLRLKPIRIPGEGYDSEASDIEDDPLIESGIILRVLPDIQVEFV 159

Query: 130 KNCIESGDFSGLSLKWKGERHAVVKINGYQYGAVLVNLPTTIEVNKSIDRKNLLKTFDVS 189
           KN IESGD+SGL++KW G RHAVV ING  YGA+LV+LPT IEVNKS+DRKNLLKTFDVS
Sbjct: 160 KNSIESGDYSGLTVKWLGHRHAVVNINGNMYGAILVDLPTVIEVNKSVDRKNLLKTFDVS 219

Query: 190 QMLLCVRTIDHEEEVFSLVPPDSEDLVTKHYDEYKNEIIECKKTLYRGFNGGPLTDAEAN 249
           QML+C++TI  E+EVF+L  P+SEDLVTKHY + + EI+  KK L +  N   L++ E  
Sbjct: 220 QMLICIKTIQKEDEVFTLKAPNSEDLVTKHYSDIEEEILGNKKVLMKEQNTDLLSELEKQ 279

Query: 250 NIDNIVKKGYDYKHGLTPPLYNVXXXXXXXXLTTQEVDYVEKTVEHLLEQDAEAEGVSYD 309
            +D I  KGYDYKHGL+PPLYNV        +   E +Y E+ VE LL QD +AE V+Y+
Sbjct: 280 YLDEIATKGYDYKHGLSPPLYNVRNRRFRRKMGPSEFEYAEEVVETLLRQDEKAENVTYE 339

Query: 310 LVDEDILAQRSASA 323
           LVDE  +  RS S 
Sbjct: 340 LVDESEMLGRSNST 353

 Score = 35.8 bits (81), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%)

Query: 416 EERQHSXXXXXXXXXXXXXXHQNKQKLEKATNPLLKSRFIESI 458
           E+RQH                  + KL+K TNPLL+SRFI++I
Sbjct: 486 EDRQHVELLADELSELETTLTHTRNKLQKVTNPLLRSRFIDNI 528

>CAGL0M11264g complement(1106912..1108561) similar to sp|Q05021
           Saccharomyces cerevisiae YMR227c TAF67, start by
           similarity
          Length = 549

 Score =  294 bits (752), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 133/227 (58%), Positives = 177/227 (77%), Gaps = 1/227 (0%)

Query: 86  RFRIKPVRVPGEGYDSEASDIEDDPLIEEGVILRVLPDVQTEFVKNCIESGDFSGLSLKW 145
           R R+KP+R+PGEGYDSEASD+EDDPLIE G+ILRVLPDVQ +F+KN IESGD++G+S+KW
Sbjct: 75  RLRLKPIRIPGEGYDSEASDLEDDPLIESGIILRVLPDVQVDFIKNSIESGDYTGISIKW 134

Query: 146 KGERHAVVKINGYQYGAVLVNLPTTIEVNKSIDRKNLLKTFDVSQMLLCVRTIDHEEEVF 205
           KGERHA++K+N   YGA+LV+LPT IEVNKS+DRKNL KTFDV+QML+CV+ I  E+E+F
Sbjct: 135 KGERHAILKLNNVTYGAILVDLPTIIEVNKSVDRKNLFKTFDVTQMLVCVKPITSEDELF 194

Query: 206 SLVPPDSEDLVTKHYDEYKNEIIECKKTLYRGFNGGPL-TDAEANNIDNIVKKGYDYKHG 264
           +L  P++EDL++KHY+EY +EI + K  L++  N   L ++ EA N++ +  K Y YKHG
Sbjct: 195 TLEAPETEDLISKHYEEYLDEINDHKVKLFKNANHVNLHSETEAKNLEKLALKKYHYKHG 254

Query: 265 LTPPLYNVXXXXXXXXLTTQEVDYVEKTVEHLLEQDAEAEGVSYDLV 311
           LTPPLYNV        +   E +Y EK V+ LL+ DA+AE V +DL+
Sbjct: 255 LTPPLYNVRNRRFRRQMHADEFEYAEKIVDMLLKADAQAEDVKFDLI 301

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 26/44 (59%)

Query: 415 DEERQHSXXXXXXXXXXXXXXHQNKQKLEKATNPLLKSRFIESI 458
           +E+RQH+                 K KLEKATNPLLKSRF++SI
Sbjct: 413 NEKRQHTELLADELNELVSTLEHTKDKLEKATNPLLKSRFVDSI 456

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.131    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,194,520
Number of extensions: 501867
Number of successful extensions: 1130
Number of sequences better than 10.0: 8
Number of HSP's gapped: 1136
Number of HSP's successfully gapped: 14
Length of query: 543
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 436
Effective length of database: 12,891,983
Effective search space: 5620904588
Effective search space used: 5620904588
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 64 (29.3 bits)