Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.869428828514920.0
YOR228C3022795383e-67
CAGL0J04004g2882774791e-58
KLLA0D07238g2832754754e-58
ACR114C2342204393e-53
Scas_640.203022844349e-52
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.8694
         (285 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.8694                                                          579   0.0  
YOR228C (YOR228C) [5019] chr15 complement(766869..767777) Protei...   211   3e-67
CAGL0J04004g 375642..376508 similar to tr|Q12106 Saccharomyces c...   189   1e-58
KLLA0D07238g complement(618435..619286) weakly similar to sgd|S0...   187   4e-58
ACR114C [1161] [Homologous to ScYOR228C - SH] (553753..554457) [...   173   3e-53
Scas_640.20                                                           171   9e-52

>Kwal_26.8694
          Length = 288

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/285 (100%), Positives = 285/285 (100%)

Query: 1   MANYIELKEVTPEPIRNYRPLEGIEKPSGVLSFLNARFVRLSLRRIQKHAVWPLAVYFPL 60
           MANYIELKEVTPEPIRNYRPLEGIEKPSGVLSFLNARFVRLSLRRIQKHAVWPLAVYFPL
Sbjct: 1   MANYIELKEVTPEPIRNYRPLEGIEKPSGVLSFLNARFVRLSLRRIQKHAVWPLAVYFPL 60

Query: 61  HALNTLVVPAISTESAPNDILMMIREVLPGFTSRLLTWSITAHVASGFALRIWSLASRWT 120
           HALNTLVVPAISTESAPNDILMMIREVLPGFTSRLLTWSITAHVASGFALRIWSLASRWT
Sbjct: 61  HALNTLVVPAISTESAPNDILMMIREVLPGFTSRLLTWSITAHVASGFALRIWSLASRWT 120

Query: 121 KLKKRGRSIPQDQKERESQRQIGLIGGLSGYFIGVSKQLAYNPQVVSGYILLPIIWYHAR 180
           KLKKRGRSIPQDQKERESQRQIGLIGGLSGYFIGVSKQLAYNPQVVSGYILLPIIWYHAR
Sbjct: 121 KLKKRGRSIPQDQKERESQRQIGLIGGLSGYFIGVSKQLAYNPQVVSGYILLPIIWYHAR 180

Query: 181 LMKKIPTAEDIDIDFDFVKWVLQNDSVWIKWFGGIIPLSILIWTASYHIVAGFCTYAKIR 240
           LMKKIPTAEDIDIDFDFVKWVLQNDSVWIKWFGGIIPLSILIWTASYHIVAGFCTYAKIR
Sbjct: 181 LMKKIPTAEDIDIDFDFVKWVLQNDSVWIKWFGGIIPLSILIWTASYHIVAGFCTYAKIR 240

Query: 241 RLDVRKAMSTLVFSLTATGFFSLWRLSKSLPVFESSQWSVLMRKA 285
           RLDVRKAMSTLVFSLTATGFFSLWRLSKSLPVFESSQWSVLMRKA
Sbjct: 241 RLDVRKAMSTLVFSLTATGFFSLWRLSKSLPVFESSQWSVLMRKA 285

>YOR228C (YOR228C) [5019] chr15 complement(766869..767777) Protein
           of unknown function, has low similarity to
           uncharacterized C. albicans Orf6.5264p [909 bp, 302 aa]
          Length = 302

 Score =  211 bits (538), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 118/279 (42%), Positives = 165/279 (59%), Gaps = 18/279 (6%)

Query: 5   IELKEVTPEPIR--------NYRPLEGIEKPSGVLSFLNAR--FVRLSLRR----IQKHA 50
           I+L EV PEP+         N    EG   P            F R S RR     QK +
Sbjct: 2   IKLHEVPPEPVDPASLPHDVNAHSPEGDGNPDKRKKIFGIPYPFSRSSCRRFLWNCQKIS 61

Query: 51  VWPLAVYFPLHALNTLVVPAISTESAPNDILMMIREVLPGFTSRLLTWSITAHVASGFAL 110
           V P+A+YFPLHA NTL+ PA+S +SAP+D+LMM+RE+LP  T++LL   IT HV++G  L
Sbjct: 62  VLPMALYFPLHAANTLITPAVSPDSAPDDVLMMVREILPSITTKLLVAGITLHVSAGVLL 121

Query: 111 RIWSLASRWTKLKK-RGRSIPQDQKERESQRQIGLIGGLSGYFIGVSKQLAYNPQVVSGY 169
           RI    + W K ++ R R +    ++  SQ  IGL GG+SGY  G+ K     PQV+SGY
Sbjct: 122 RI---VNNWNKPRRNRHRHLKISAEQDLSQDSIGLTGGISGYLFGLYKTFRIPPQVISGY 178

Query: 170 ILLPIIWYHARLMKKIPTAEDIDIDFDFVKWVLQNDSVWIKWFGGIIPLSILIWTASYHI 229
           IL+P++ YH  +MK +P +   ++DF  +K +L + + W KW GG++PL+IL+ +  YHI
Sbjct: 179 ILVPVLIYHLLIMKWVPNSISTEVDFASIKQLLSSKNRWWKWLGGLVPLAILLESGVYHI 238

Query: 230 VAGFCTYAKIRRLDVRKAMSTLVFSLTATGFFSLWRLSK 268
            +G C Y  +R++  RK  ST +  LT  GF SL RL K
Sbjct: 239 GSGLCRYFGVRKMTSRKKWSTAINLLTLVGFVSLIRLMK 277

>CAGL0J04004g 375642..376508 similar to tr|Q12106 Saccharomyces
           cerevisiae YOR228c, hypothetical start
          Length = 288

 Score =  189 bits (479), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 106/277 (38%), Positives = 162/277 (58%), Gaps = 9/277 (3%)

Query: 6   ELKEVTPEPIR-NYRPLEGIEKPSGVLSF-LNARFVRLSLRRIQKHAVWPLAVYFPLHAL 63
            LKEV+P P++ + RP+     P  +L   ++   V  +L ++Q+ ++ P+A+YFP+HA+
Sbjct: 4   NLKEVSPTPLKPDERPIS--YNPRKILGIEVSTTTVVHALFKLQRLSIVPMALYFPVHAV 61

Query: 64  NTLVVPAISTESAPNDILMMIREVLPGFTSRLLTWSITAHVASGFALRIWSLASRWTKLK 123
           NT++ P ++ E+AP+  L  + + +P   S++L  S+  H+ASG  LR W L    + + 
Sbjct: 62  NTMITPLVNPETAPDSFLTAVHKWVPQAASKILIASLLTHIASGVLLRGWKLYK--SHVL 119

Query: 124 KRGRSIPQDQKERESQRQIGLIGGLSGYFIGVSKQLAYNPQVVSGYILLPIIWYHARLMK 183
           K    +    K   SQ  IGL GG+SGY  G+ KQ   +P  +SGY+L P++ YH  +MK
Sbjct: 120 KEKYHLHHQHKHTTSQDDIGLTGGISGYLFGIYKQFTLSPLSMSGYVLTPLVLYHLLIMK 179

Query: 184 KIPTA-EDIDIDFDFVKWVLQNDSVWIKWFGGIIPLSILIWTASYHIVAGFCTYAKIRRL 242
            +P +  +    FDFVK +L+    WI+WF GIIPLS LI  ASYHIVAG C    ++ +
Sbjct: 180 WVPESLGEPATGFDFVKQLLRASEWWIRWFAGIIPLSALISAASYHIVAGACRLLDVKDM 239

Query: 243 DVRKAMSTLVFSLTATGFFSLWRLSKSLPVFESSQWS 279
             RK  S ++  L+  GF S+ RLS +     SS WS
Sbjct: 240 KKRKNASRIISGLSIAGFLSILRLSNAKSF--SSDWS 274

>KLLA0D07238g complement(618435..619286) weakly similar to
           sgd|S0005754 Saccharomyces cerevisiae YOR228c, start by
           similarity
          Length = 283

 Score =  187 bits (475), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 108/275 (39%), Positives = 157/275 (57%), Gaps = 9/275 (3%)

Query: 6   ELKEVTPEPIRNYRP-LEGIEKPSGVLSFLNARFVRLSLRRIQKHAVWPLAVYFPLHALN 64
           +L  + P P ++  P L    + + V   LN   ++  LR  QK +++PL  YFPLH +N
Sbjct: 5   KLTPLKPIPTKHIDPDLAKTPEDASVNLVLN---IKKWLRWTQKWSLFPLVTYFPLHGIN 61

Query: 65  TLVVPAISTESAPNDILMMIREVLPGFTSRLLTWSITAHVASGFALRIWSLASRWTKLKK 124
            L++PA+   S PND LMM+RE+  G  S+L+   I+ H+ SGFALRI       +K   
Sbjct: 62  ALIIPALEPSSFPNDALMMVRELTSGLGSKLIWTGISIHILSGFALRIMRKLPTSSK-TH 120

Query: 125 RGRSIPQDQKERESQRQIGLIGGLSGYFIGVSKQLAYNPQVVSGYILLPIIWYHARLMKK 184
              S+   Q    +Q +IGL+GGLSGYFIG+ + L YNPQ ++G++L P++++H  LMK 
Sbjct: 121 NAESLLDTQSL--AQSRIGLVGGLSGYFIGIKRNLQYNPQELTGWLLTPVLFFHGALMKW 178

Query: 185 IPTAEDIDIDFDFVKWVLQNDSVWIKWFG-GIIPLSILIWTASYHIVAGFCTYAKIRRLD 243
           +P    +DIDFDFVKW+L  D   +   G G  PL  LI   SYHI+AG   Y  +R L 
Sbjct: 179 LPNTAKVDIDFDFVKWLLDKDRGALVRIGLGYGPLVALIGLGSYHIIAGTVQYMHVRSLK 238

Query: 244 VRKAMSTLVFSLTATGFFSLWRLSKSLPVFESSQW 278
            RK +   +  L  TG+  + RL   + VF   ++
Sbjct: 239 TRKRIMNFILLLICTGYIGISRLGSEI-VFGMDKY 272

>ACR114C [1161] [Homologous to ScYOR228C - SH] (553753..554457) [705
           bp, 234 aa]
          Length = 234

 Score =  173 bits (439), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 92/220 (41%), Positives = 137/220 (62%), Gaps = 5/220 (2%)

Query: 57  YFPLHALNTLVVPAISTESAPNDILMMIREVLPGFTSRLLTWSITAHVASGFALRIWSLA 116
           Y PLH  NTL VP I    APND+L M+RE+LP  T ++L W++  HVA+G ALR  +++
Sbjct: 5   YMPLHLTNTLFVPLIEPTYAPNDVLRMVRELLPAATDQVLVWTVGVHVAAGVALR--AMS 62

Query: 117 SRWTKLKKRGRSIPQDQKERESQRQIGLIGGLSGYFIGVSKQLAYNPQVVSGYILLPIIW 176
                 ++  R + + + +  S R+IGLIGGLSGYF+G++K + +NP  VSGY+L+P++ 
Sbjct: 63  WYRRWTRRGRRYVTRVESD-TSPRRIGLIGGLSGYFLGLNKTVRHNPHAVSGYLLVPLLA 121

Query: 177 YHARLMKKIPTAEDIDIDFDFVKWVL--QNDSVWIKWFGGIIPLSILIWTASYHIVAGFC 234
           YHA LMK +P    +D+DFDFV+W+L     S W +W  GI+PL+ L+   +YH+  G  
Sbjct: 122 YHAALMKWLPARAGVDVDFDFVQWLLYGGTGSAWTRWGLGIMPLAGLVSVGAYHMFTGLV 181

Query: 235 TYAKIRRLDVRKAMSTLVFSLTATGFFSLWRLSKSLPVFE 274
              + R L +R+ +  +V  +   G  SLWRLS   P+  
Sbjct: 182 QLLRWRSLALRRKVFNVVVGINVVGLVSLWRLSTVRPIMN 221

>Scas_640.20
          Length = 302

 Score =  171 bits (434), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 104/284 (36%), Positives = 152/284 (53%), Gaps = 28/284 (9%)

Query: 5   IELKEVTPEPIRNYRPLEGIEK---------PSGVLSFLNARFVRLSLRRIQKHAVWPLA 55
           +++KEV PEPI      E +E          P     F N   ++ +L+  QK++VWP+ 
Sbjct: 1   MQIKEVAPEPILP----ESVELTPESSSPFFPESKNVFSNRNLIK-ALKGFQKYSVWPML 55

Query: 56  VYFPLHALNTLVVPAISTESAPNDILMMIREVLPGFTSRLLTWSITAHVASGFALRIWSL 115
           +YFP+H++NT  +P I     P  +L +IRE  P F SR+L  S+  H+ASG  LR+   
Sbjct: 56  LYFPVHSINTFGIPLIQPNKLPGRVLTIIREKSPLFLSRILIGSLVIHIASGVLLRVSHW 115

Query: 116 ASRWTKLKKRGRSIPQDQK-----------ERESQRQIGLIGGLSGYFIGVSKQLAYNPQ 164
              + +    G     D             E  SQ  IGL GG+ GYF+G  K+  ++P 
Sbjct: 116 LYHFQRRMGEGEESEADHHLNHDASQLLVSEDISQGSIGLTGGIVGYFLGWRKKFKHSPL 175

Query: 165 VVSGYILLPIIWYHARLMK-KIPTAEDIDIDFDFVKWVLQNDSVWIKWFGGIIPLSILIW 223
           +VSGY+L P + YH  +M+  +   E     F FV W+L N   WI+  GGIIPLS+LI 
Sbjct: 176 IVSGYLLTPFLLYHVIIMRWGLVNPESKG--FTFVDWLLTNSDWWIRVVGGIIPLSVLIV 233

Query: 224 TASYHIVAGFCTYAKIRRLDVRKAMSTLVFSLTATGFFSLWRLS 267
           + +YHI AG C Y KI+ ++ RK  +  +  L+ TG  S++RLS
Sbjct: 234 SGTYHIGAGICKYLKIKDVNKRKKWAGGITLLSITGLISIFRLS 277

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.138    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,310,641
Number of extensions: 368780
Number of successful extensions: 1116
Number of sequences better than 10.0: 6
Number of HSP's gapped: 1118
Number of HSP's successfully gapped: 6
Length of query: 285
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 185
Effective length of database: 13,134,309
Effective search space: 2429847165
Effective search space used: 2429847165
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 61 (28.1 bits)